Skip to main content

Full text of "Dictionary of the Welsh language"

See other formats


Google 



This is a digital copy of a book that was preserved for generations on library shelves before it was carefully scanned by Google as part of a project 

to make the world's books discoverable online. 

It has survived long enough for the copyright to expire and the book to enter the public domain. A public domain book is one that was never subject 

to copyright or whose legal copyright term has expired. Whether a book is in the public domain may vary country to country. Public domain books 

are our gateways to the past, representing a wealth of history, culture and knowledge that's often difficult to discover. 

Marks, notations and other maiginalia present in the original volume will appear in this file - a reminder of this book's long journey from the 

publisher to a library and finally to you. 

Usage guidelines 

Google is proud to partner with libraries to digitize public domain materials and make them widely accessible. Public domain books belong to the 
public and we are merely their custodians. Nevertheless, this work is expensive, so in order to keep providing tliis resource, we liave taken steps to 
prevent abuse by commercial parties, including placing technical restrictions on automated querying. 
We also ask that you: 

+ Make non-commercial use of the files We designed Google Book Search for use by individuals, and we request that you use these files for 
personal, non-commercial purposes. 

+ Refrain fivm automated querying Do not send automated queries of any sort to Google's system: If you are conducting research on machine 
translation, optical character recognition or other areas where access to a large amount of text is helpful, please contact us. We encourage the 
use of public domain materials for these purposes and may be able to help. 

+ Maintain attributionTht GoogXt "watermark" you see on each file is essential for in forming people about this project and helping them find 
additional materials through Google Book Search. Please do not remove it. 

+ Keep it legal Whatever your use, remember that you are responsible for ensuring that what you are doing is legal. Do not assume that just 
because we believe a book is in the public domain for users in the United States, that the work is also in the public domain for users in other 
countries. Whether a book is still in copyright varies from country to country, and we can't offer guidance on whether any specific use of 
any specific book is allowed. Please do not assume that a book's appearance in Google Book Search means it can be used in any manner 
anywhere in the world. Copyright infringement liabili^ can be quite severe. 

About Google Book Search 

Google's mission is to organize the world's information and to make it universally accessible and useful. Google Book Search helps readers 
discover the world's books while helping authors and publishers reach new audiences. You can search through the full text of this book on the web 

at |http: //books .google .com/I 



Digitized b, Google 



I 



Kiiiniti eCoUtge lilnmi 



THOMAS WREN WARD 



r~] 



DgitizBdb, Google 



Digilizedb, Google 



Digitized b, Google 



%'i:]C '::.(: 



littlonata 
V^t Wclsij iaitguagc. 

Jl(c. g. jSiten (Soaitj, S.g. 



iarclr. 1. SU&an <E&ang, BID. 




AiirmtiTt^n : 

WILLIAM SPUERELL. 

LONDOS: SIMPKIS, MARSHALL, & CO.; TBUBXER & CO. 



.VAii-i^H 



CHIEF ABBUKVFATrnN!^, 



A.B. Four Ancient Books of Walca 

(1868). 
A.tj. Anglo-Saxon. 
A.V. Authorised Version 

(of the Bible). 
Br. Breton, Armoric 

C. CoraiGh. 

C.C. Cyfreithian Cymm (8vo ed. 

1841). 
C.a. CoU Gwynfii. 
C.8. common or colloqnial epoedi. 
C.V. Cornish VocBbulttry. 

D. Daries (Dr. John). 
E., £ng., English. 

E.A.y. English Aathorieed VorBion 
(of the Bible). 
Esg. Esgob. . 
Ga. Oaelic. 
Q.C. Grammatica Ccltica (Zeaes), 

ed. Ebcl, 1871. 
Ger. German. 
Gr. Greek. 
Uel). Hebrew. 
Hum. Honiiliau. 
Ir. Irish. 



L. Latin. 

L.L. Low or Late Latin. 

L.W. Leges Wallicae (Wotton's od. 

1730). 
M.A. or Myv. Arch. Myvyrian 

Arehaiology (1801— 7). 
Mod. Modern. 

M.W. Middle or Medieval Welsh. 
Mz. Manx. 
N. Anonymous. 
" N.W. North Wales. 
N.W.W. North West Wales. 
N.E.W. North East Wales. 
O.E. Old English. 
O.Ir. Old Irish. 
O.V. Old Vocabnlary. 
O.W. Old Welsh. 
P. Pnghe (Dr. W. Owen). 
S.W. South Wales. 
Syr. Syriac. 

W. Walters (Rev. John). 
W. Welsh. 

• marginal reading. 
t ol)8olcte form. 



a. adjeetive. 

ac. adjectiTe conunon gender. 

af. adjective feminine. 

al. aliter, otherwise, another reading. 

am. adjective masculine. 

adv. adverb. 

art. article. 

cf. confer, compare. 

con, conjnnction. 

Gontr. contraction. 

corr. corruption. 

cp. (degrees of) comparison. 

dim. diminntive. 

f. feminine. 

gl. gloss. 

int. interjection. 



modf. modification. 

pi. plural. 

pr. prononn. 

pr. prep, pronominal preposition. 



pr. rel. prononn relative. 

prep, preposition. 

ppt. perfect or past participle. 

pt. participle. 

pt. a. participial adjective. „^ 

8. substantive. 

ac. substantive common gender. 

s.d. substantive collective. 

sf, substantive feminine. , 

sf-m. substantive feminine, but 

sometimes masculine. \ 
sg. singular. 1 

tgl. singulative. i 

stn. snbstantive masculine. | 
am-f. substantive masculine, bul 

sometimes feminine. \ 
B.pl, eubBtantire plural. ' 

V. verb, 1 

va. verb active or transitive, j 
va. verb nentor or intransitive. | 



' A complete List of authors and books refevred to will be gi' 
with the concluding part of the Work. 



nanzsdbv Google 



DICTIONARY 



WELSH LANGUAGE. 



a. Into«; aa, raru, cerau ; att.b,€tyb; cattdl,tt»- 
tyil ; giSn, gltndid. 

b. laU) y ; ae,atiat, ftti/l ; buttach, buttych ; eadam, 
cedym. The cWiges into e and y oft«n occur 
in the same word. 

t. Tntoei; aa, bardd, beirdd; mab, meibian; hardd, 

Iteirdd; dal, dfil; tafiu, teifl; eadw, ceidw. 
d. Into ai ; u, br^, brain ; tant, laini ; dafad, 
de/aid; btiaa, buatn; traan, truain; attal, ft- 
tail (=ettyl). 
JL, Ac (1), con. 1. and. A ia osed only before 
iForde MffinDing with a consonant; and ac 
(q.T.}, wiUi some exceptions, precedes words 
with a Towel initial ; as, dydd a nos ; mab a 
merch. 
Tr BiDberbwdrr Arthur oed jrgkaerlliQO arwTB. Rf yd- 
oed ja cisUd diwnnuiwl rnj yatnaell. ac rnyt ac ef Oinin 
uah (TiTai. a C>;7Iubi uab 07^110. a Cba lub Kyner. n 
" ' "" " m Tugvaikv wrtli trenflBtr. 



a ffrDd pan ve 






AcjT^jiTiceljgHn yarsirt Orafnd Anryntli a Cheri 
d CtiJ^tilAWA, a H&wdwy a UochuaDt, ir Cbaer Bmaini. 

Brta II TyKumfiari, SH. 

Pnd hAU. a ehvnh&u&f, ie oemi, 1 ffwm, a hmf, gauaf, 
a ajM, a u, ni phud mwy boUddTddiiia'r ddsiar. , 

IColtutj d gD^<Hiiant. a doelhiiwb. if diolcb, 44c anriiydedd 
ac BirdurdDd, n iieith, ■ lo i'r bwn irdd to eiatodd u yr 
onaddfunc — Storgan UtegJ: IHig- K'l Aur. Itif. 

Cam a cAam, step by step. 
2. also; both. Cf. L. ri . . . ri. 

Ygw mji na rt h goren aallwyfl beb hi mi u ffwnAr of Haw 
me 7 uvcb. — JfafniifiaA, ii. 13. 



O djKVfdKU- odlet a rwartbud a g 
AltkBT.—ffrW (7r. <ii ArJw: H.A. ii. S 



3. j4 or oc is occasionally used with consideiable 
latitude of meaning, especially in medieval 
praae, being fret^uently employed to denote 
tMBJtion, or to mtzoduce an explanation of 
ivkat preoedea, and may be rendered lum, or 
1 



and now. In some cases it is more adversatiTe 
than connectiYe, and in others it may be re- 
garded as little more than an expletive. 

A phan 7 gweleia i ef eaa drnenau avDebthum Htt«w, 
* chTfarch giiell b. wneuUinni Idaw. at f" ^«h»t irwvlwi^ 
ef kynt y lmiarcba'~^ "* — " 



I. g (eT. 6, is] 230; li.ei 
lUbodd ac a ddywedodd, MyB a 



% With the abbreviated possessive pronouns 
and the article : a'm (^la ym), a'tk (^a yth], 
a'i (=a ei), a-n {=a ein), a'ch (=a eich). a4 
(=ft eu) ; or (=a yr). 

L, J^: (2), jit-iTi. 1. with; by; towards. A is 
used before consonants, and ng before voweb, 
and sometimes before the a8pirat« A, and 
the semi-consonant 1; as, Iladd & chleddyf; 
prynu ag arian. 

Parth 3 Llundain, towards London. Parth ag 
atom, towards us. 

Wynt a ^ezdaasaut tnumo«th parth a Djuet. 
MynrtMK 



rr Tedg^ ad^uC f7c yateoint o ved 



chviorydd. J (fwiuif ac i) kwt, nj athraw at li dimblion, 
d chTtumydof^ioD ac rf cbyrncHiflaNl. a obyttylwytb ac d 
chydnabod.— /)r. Jnhti, Vatnttr IJjliy Em. 11. i. ir. 

Nm ymgyiwhora H ([wraig. am yr hon y mae hi yn dal 
eiddigedd wrthi ; nac i4*r Uwfr nm ryfel ; nac ffr marcb- 
nwlwr am ^yfoewld ; hap pf'r ptyuwt nm wi^hii • nm- J'l- 
cynfigflnna am ddiolch^arwc-h ; na 






*i^ll! 






(fgWMdiog 



2. With some of the pronominal prepositions it 
has often the force of han'ng. poeaeuing, 
potMSKd of; as, dyn ag iddo enw da; dyB i 
chyfoeth ganddo. 

Pn ddyn honooli d cbnndda ^ant o ddefald . . . Ntfu 
pa «rai)f if chanddl dde^ dryU o arian.— ^t xt. 4, 8. 

Yr w^ efe yu ea dyi^ hiryot fd UK ag awdDTdud 
ganddo. —Jfiili. Til. W. 






YmawT a druaDi oed y rot ef vn tlawt, 

' 5(. e^M 188 (rf. Ufl). 
Ou Ol&nJhebef mordnrc^i both genuyfld^ ^ollidf. 

Byclum it peth e dyelleist ti ft evmgeUwl Ammfrvtrd 

PmB a both r smnbwu i.—Bauv n Hamnm, \ IS. 
M»wr o drirtjTl byd bol bir ordinil oer 

ArYveiDTiipOruffud.— fifeJ'fysfVirrf'I.'M.A. i. see. 
Y. Sffhywir a belli n vyddut tmi.— WmI*!wi Shu/ain, \ S§. 
Lluayet miwT ■• g« M™!^ " "'"'■ 

b. Similarly we find a dan frequently written 
for o dan, and a hfTurydd for o herwydd, with 
Borne other interchanges of a and o. 

Gwyr ma o dan ebbudeu s gwyr aoo a rfnn Mfyp wynt 
H allunt prydun eu tjT ^hd ^nhyat yreyn Ejuny qa 



-fj/"*' 



B.I.I 



A IhtU Curllion a tfaiau yi]t«l- — lolo Jf*J", 74. 
Yd oed T bnnhin ae wyr da yn elsUd y meirti hepber. yn 
UavoD y^jrt A <faq breo gDdyrj'U. 

Co-poB CAnrljdM™, 1 83 Icf. 991- 
Adi«ifioiiiAg^-wn.—TiiIunH: A.B.U.SOI, 
Ynteu liev LUv Gyffea dlweith uina^ryanwyi y wUt^ 
•o ae fwledyobwyi yn UwydyaiiniiB. n t^ncW y djweit y 
kyiuTwydyt ef «au STBlwyd wedy hynny sr wyiief. 

EHwelth yd enhla y bobyl y Telr. a lowp. uifon Ie«u 
yr ynxfl y dyan Itythyr. a Kervgd sorchymyii hyiufdt. 



A (4), pr. «;, {of all genders, numbers, and 
persona, used before both vowels and coi 
sonants, and in the nominative and objecti' 
cases] who, which, that, whom. 

Bet genou ir pant a raid in Unun, 

Libt Latidavimi,. 1D1 



bic veDDyf bot yDtfgach yr hhcr^t ooadDnl 
yn deckaT a welekC ti eiryoet yn ynys t>ryde 

it yn llyfwT kyradirf a do 



bwynt 



X-i/ux, col. 4U. 

Ai; o acbaiTfl y tivyddavt a vi'bui yodaw y ba hoffAch a 
bATS ganthaw y urdaw.^-f f. Oreai, ) t. 

Cefaia y dryll a golkewn.— tue n, 9. 

Eft a autonodd lytbyr at y brcnin a clwid CamaUon, yn 
y gBiiinu bya.—Theo. Bvaat: D.P.O. i. a (^7). 
b. The relative a often includes the antecedent, 
and is equivalent to luhal, Ihai which, he who 
or whom, he that. When thus employed it 
fieqnently stauds first in the sentence, which 
is never the case with the affirmative verbal 
particle a. 

A ddyco*r Dodv^'dd, a ddvg y crogwydd. 

A wnelo hyn, nid ysgo^ yn dia^yrydd. — Sntm. w. A. 
A hHUo dyo hyil einloeB. 
Afedaet wediou.— rAaaiK Lla^d. 
A oTPlfygo ymn, a goronir try.—DiBrib. 
A wado hyn, aed i kii, 
A gwaUed iY biuU goal.— 
Na chaffer ynot « wnelo 
tewyl tin.— Itn.(. jviil. 10. 

Lt beri ei ddvyn gcr dy Fran, a thi a g^ 
sto «r, ac yna burnuparth aK pf . 

l>a/!/-id Ft/shan: EffJI^l Xioodcrana, 1- 



Alolygwn amat beri ei ddvyn ger 
Slywed mrtli a ireto Bt, ac yna barauj 



'. Belated to this appears to bo the use of a 
in the older poetic language, when it stands 
first in an optative sentence, where we now 
would either employ the imperative form, or 
place the verb after ita subject in the optative 
or subjunctive mood. 

A^n cymono Dnw t hvn.-Jfgrddii,^ M.A. i. 149. 
Am ToUt dauyt dcdiryt dnrcint, 

Uxjyn/nnM KryhriKii^ : M.A. i. t70. 

In some cases a in this position seems to be a 
modification of the pronominal particle t 

(.=■/<',/,). '^ 

A^m rhodda Rheot riaidd anrheg- — Gronieg Otetiin, 28. 
L (3), adi'. an eiplotive particle placed immedi- 
ately before a finite verb which follows its 
subject or its object. When the verb precedes 
the subject, or is negatived, the partide is not 
employed ; and if it does not occur in the 
first dause, it should not be inserted in auy 
subsequent clause, unless the subject or the 
~''ect comes before it, in which case thero 
I be a change of construction. 
. Subject preceding. 

Ao ynteu Pendni n gyoliwyiuiiiTa yn 

Daw Hi imn Tbwng dau aniferdd : 
DyTod i'r cytii. damd 



wiiib 






Ir. Grj/g (D. ab Owflym, crrfv. «). 

Pwy a gta sercb i fenh tain f—ronom/i F^nglur^. 

A'rhwyrn fn, a'rboren to, ydydd cyntsf.— tf'n. i. 6. 

Ifyfl 1 ajngrtchain gyl^^h y q^ocdd fy bnnjin, ac a rodlaia 
yng ngwaelod y dyfnder.— £«f. xiiv. 6. 

Ewy s aethant 1 un babell, ac n firylaaanC. ac a yfaaant, 
■c a Hymmpraaant oddi yno aiian. ac aur. a rwisgoedd. oc 
a aethant, ac ir'i cuddiaflant. a« r ddychwclaaant; ao i 
actlumt i babeU anUl. ac a ^vmnmramnt oddi yno, ac a 
aelhant, ac a'i ouddiaaant.— S Bnm. ™. 8. 

i. Object preceding. 

Nawd erchie y nurdiain: idav. nawd a geffy h»b FcT' 

Ti, Dduw. a folwn ; ti n KTdnabyddwn yn Aiglvydd. 

Llg/r GierMi Onfirdin (TtDema]. 

A'rddaiarn toddMefei reibiondynioD.— So^in.ccT, IS. 

Cildynr»ydd a chwaneRirch.— iW. i. 6. 
H This particle is omitted before some tenses 
of the substantive verb bod, especially when 
the predicate comes first; in others the use of 
it is optional ; and in the older language it is 
seldom found before piau. In good prose, 
including the Bible and Prayer Book, it is 
rarely omitted, except in these cases; though 
modem writers, esped^y the poets, for toe 
convenience of metro, frequently dispense 
with it ; but the practice cannot be con- 
sidered elegant, and when piacticable should 
be avoided. 

A pharth ar pehyll ydoeth. adrm y pebj'll oshI yn 
agoT^t. a cha d f i T eureit oed yn agoa yr drva. 

MabitiogiOH, i. SSQ. 

A phan wybuant iry puiyH Lawnalot aond yno Uamn 

Etravc inrll binat iaHIaeth y gogled.— .VdiJiuvHin. t. gSS. 
Myfl tux dial. my« a dalaf.- 
Yrhwnad 
a'rboU fyd, a _, „ „,__ , 

L (6), adv. as (after Comparisons expressed or 
implied); as, cynunaint a chawr; mor boetb 
a th&n; cystal a neb; y fath eiriau a hyn. ^ 



du.'V^itn 






Ag is need before vowels. Some condder o 
or ag in this connection a preposition ; but it 
sppearB to be simply an adVerb with tbe verb 
understood. 

Tr hwn «ydd yo nwrw yn eaoft o bediod tOBHrol, 
cdiMrVDb. fffdd jrn AimeutbnJ' cynunaintd phebuo^ 
pcchD TD dngywyddol.— £/i> Lrwit: Drateliiu, ii. i |4i 

A (7), con. (=mod- o, m) if; in case. We now 
KeneTBlly prefer o; but the other Celtic 
djalecta have u in this sense. 

Ac a Bhlyv y Uywitiirdr hjn. ni k'i drgn ef 1 irinidii. 
if. SoI-'I'uy;- bsH. xiiiil. 14. 

A (8J, odn, 1. an interrogative particle (=L. ii^ 
affixed to the verb), used ciclusively before 
finite verbs; ai being its equivalent in " 
other positions. It simply inquires, without 
imping either that a negative or an af^- 
mative reply is expected. 
A rmntjai cf athi heb bi, do beb ef.— JTiUaayio*, ij, n. 
A luniK'r npr icrfddelwt n orpiirm'r euirob hla^iul 
•r a davdd at gadvyui o visD ) u a ddcwii jx bvn frtho 
uwi fiaim »bEtth bien beb bjdm f u gsia ef aaer crwraint 
i bsntoi eewiiOeiir'—EdicarJlamrt: Horn. ii. 78. 

A OS nn bsvb ddoniaD i incUn ! a yw pawb th tlDfam 
1 IbiJodiU ! a JW |>«b 7n dfleilbu I-l Cor. »ii, 30. 

Aju wfTctbolMusttumT^/'iiAir/ />fftt, 30. 
This interrogative is sometimes, but impro- 
perly, omitted; as at Lue xii. SI; loait ii. 40. 
'1. whether; if. Oenerally connected with an 
indirect inqiiiry (cf. L. an; O.E. an, and), 

A Gfarvrdnw CT aijTB urac i ■jrlln a kniufei on ffwyd- 
Iwdjn u ef.— Bnri tfr. at Anh,r: M.A. u. S7S. 
EdiTchim a ddair E&u i'w waredu ef .— JTiUI. nni. 4S. 
Bwjr a'i trwyliuuiE at, a ischii ef e ar r dydd Sabbath. 

A, Ac (9), adv. a particle denoting the absolute 
ease. When a (before s consonant] or uc 
(before a vowel) is placed before a noun or 
j»onoiin which is followed by a participle, 
or ite equivalent, or sometimes when the 
participle of the substantive verb ia omitted, 
and which stands out of the usual syntacti- 
cal ooustmction with the rest of the sentence, 
it constitutes an absolute clause. 
0> arbo]' ditbm eoo. a thi yn nardiawc. sf atb edeu 
JD bedentTT.— Jfnftimvion, i, 8. 

A't Cyiarj ™ dychwelrd jm en bol. (rrfarfuant yn ™ 
hairyo Uril Arwndel, ac larU rserluew, ac AniaUt Har- 
BWTt.-«™i AbtTfrrtw^: M_4. ii, 630. 
.f^rCymryyucyfl^, rfautbrodd y ^ynam eupeoau. 



(hirie Uwyn ar gryi y 

y dydd cynlaf o^r irj 

lure, a hi eto yn dywyU, 

Ac * hwT yn myDHl ymajlh, yr 
vtdyd mUi y twbloedd un luu. 

Quid of^ iKledwaeth a, vf-Ibd 
diaeUiwdi. pan d#iredaHicfa, Y: 

Bi ddi^yblion a ddaethaut o hrd no 
ef, a BjTU jn ejigii.— jrui. ixriil. 13. 

An sbwyirt yn puntol iddn, fe ayTUtlodd anu Inryg. 

Pa mor yntyd fyddai Bf, yi hwn, a; ef yn fab i frenin 
V'^SS^fi^'^^ .i b»B yB fwi- am fod yB fab i 

Gn.Ssdi n-^,„: YBtJTiKPthKU, i. 3 |23). 



U.WlZena^Q.C. lOM). 

A WT beb hi pa bryt y tebyn' di dyiiot Oenint you.t 

A oabeiinea bob y Lawmlot. waldy jmina vi. 

SI. Gth^, 
A uabemufl. doa di y bea y i^^n.^-BoaA o Hamticit. \ t 
A frenla Agrippa, a irredi di y prophwydil 



■Efe a rwygodd ei 



s ddywedodd, Ail till fy 



k (II), I'. 3rd pera. sing. pres. and fut. of the 
unused verb du (^myned): goes; will go (L, 
it. ibil). 

Nyt a Kel 0-r llya allan.— JfaMio^i., {. tnO. 

t>yB Hyf a a dan ei Tad, 

Eioad d'rnn I'l dywad.— i/ynrl CUan. 



Oddwy 



^ant ydd a gwt. 






Nid If rhinwcdd i'r bedd byth.— ZXarrt. (M.A 
A d pob dyn i eylcb y njofyd, aef y nef, 
marw '.—Banidar, C 33t. 
Cyflym ydd U rym yr oea.— tfra. Ovwk, 38. 
Dan Iflamia, dan nia*T a 
YrAndoai Fflr India.— Ua/Vdd /onam-; Gwaith, 18S. 

H Formerly it was usual to circumflex this 
verb (d) in the some way as the preposition; 
but of late it has been more customary to 
mark it with a diuresis, which, while it leaves 
the sound unaltered, has the advantage of 
distingruishing the verb from the preposition. 
In M. W. it was sometimes written aa ; as, 

Amhanal ar Eloyden 

Td aa Trydonwy yn Tien 

Acydaa Oeim yn AJweiu—tlyBarf* Hnt: A.B. ii. 387. 

Some modem writers have, but without suc- 
cess, endeavoured to revive this form. 
^, A, in senses 1, 2, G, 7, 9, aspirates the 
triptotes f^, />, t, leaving the other lett«rs un- 
affected; and in 9, 4, 5, 8, 10, is followed by 
the soft sound. 

1[.In M.W. a, like most of the particles, is 
very commonly prefixed to the word follow- 
ing it. 

% In most cases the other Celtic dialects agree 
with the Welsh in the use of a in its different 

^ The forms Aa and har. for a and nr. found in 
tiie Oxford Glosses, the Cambridge Codex of 
Juvencus, the Codex Lichfeldensis, and the 
Liber L&ndavensis, may be dialectal, and pe- 
culiar to the district of Ovrent, where oue of 
these and possibly the others were written, and 
where a similar inability to distiuguisb between 
aspirate and unaspirated sounds, or rather a 
tendency to reverse them, is observable at the 
present day, not only in the spoken, but also 
to some degree in the written language. And 
this supposition appears to be confirmed by 
the fact that the aspirated has almost become 



Ab 



the reoognised form of these particleB in Corn- 
ish Bud Breton, which of all tlie Wolah dialects 
the Owention most resembles ; while this pe- 
cuharity is aJtogother unknown in Dyfed and 
North Wales, and probably never pr«viiiled in 
those parts of the Principality. 
Ab (d). pi. abau, K. [Ir. ap, apa ; Ga. ap. npt : 
AS.apa; Ger.o/e; E.upe]anape; amonkey. 

Rubnthnfi; kymrrt biKWel tiTw wdodi wrUuw, 

Mrd^saoo Mtdd/ai. I AT. 

Nb chui yr il» el nub mal.—Mri Ooch. 



TJAlnog'tfr; Jlyna gybjmd. — GuU>*r 
A,'tii dduryn aedd» woith arHJl, 



OJffB. 



n M. fab y ttll.-dni-a!, Owiii,. U. 
Ab (d), pi. abau, <m. [see vlftarf] an abbot. 

Darllen /el yr d6, to read like a clerk. — Dyftii. 
Ab, nn. [from mah: Br. aft, uji] a son; used 
almost eicludvely in pedigrees, being a later 
form of /ab {uab, inah) ; as, Cynan ah Owain 
Cynan the son of Owain ; Bleddyn ah Cynfyn 
rjywelyn ab lorworth ; Dafydd ab Gwilym 



tJywelyn 
Rhys al " 
Dafydd. 

lartyij, at_ OwrgM, a* ntu^. ah tHMin, n* Mman Hei^ 
, -^ uweuvad. -tft htdciiIa'' ' *'- - ■ 



&hwn s elwid vn ei ucx Moi«tui Mttwr, abS^fi ^ 
n, ab Artlifuel, ab Oveirydd, ah Brdchrul, ah Meirig, 
at irtUad, a* Rhya, ab Einyild ah Munpm, ai AdtM. ab 



:. InstaJices like the following are rare :- 



H Ap, which is the more usual form in the 

older language, stands in the same relation to 

ab an map does to mab, lat to tad, and trc to 

tfg. 

1[ Ab being enclitic or unemphatic, the Towel, 

which is long in mab, has become short 

{=jfc). 
Ab-, a prefix found in a few words, having a 

negative or depredating force. Cf. eb and 

Act. 
Abad, -au, $m. [L. a6hi<^m (from Syr. abba; 

Heb. afc); C. abal; Br. aftnrf; Ir. ab, abb; 

Qa.ab,aba: A.S. abbod, u^'baif] an abbot 1 th« 

hoad or superior of au abbey. 
Paybenap agTiem 






yn yuam «clayB talflt ydy peAtyr 
ilHtl or byd duyuaul leth?ruT ar~ 
u.-CufrnlhiaH fli/mn., i. 7V. 



Edwut afc £d< 



sas 



gwmrtgw^, 



b. When the Welsh adopted sumamoe, as dis- 
tinguished from this kind of patronymics, ab 
was in many instances pre&ced in an ab- 
breviated form to the father's name; and by 
that process, ab Owain, ab Einion, ab Ithcl, 
ab Ifan. and the like, became Bowain, Beinion, 
Bithel, Bifan ; which have been further modi- 
fied into Bowon, Boynon, Bethel or Betbell, 
Bevan or Beavan, with other variations. If 
the name has h or rh for its initial, 6 be- 
comes p; as, Pywel, Pryddcrch, Piys; for 
ab Hywel, ab Rhyddereh, ab Rhya. This mode 
of f onning surnames is not yet extinct in some 
parts of Wales ; and English names like Harry 
or Rirkurd are treated in the same way as 
those of native origin. 

c. Before m, ab sometimes coalesces with that 
letter, which then becomes mh ; as, Arahadog, 
Amheirig. Amheredydd, Ambeirchion.Amhor- 
gan; for ab Madog, ab Meirig, aft Morodydd, 
ab Meirchion. ab Morgan. 

Datyddo* Ehyi yaydd Mut, 



Am hil Hywd AitUixilir 

d. Occasionally />ci/;y(Wa6iBCOntractedinto/>a6; 
as. Dab Owilym, for Dafydd ab Gwilym; 
Hywel Dabian. tor Hywel Dafydd ab leuan; 
Sion Dab Wiliuiu, for Biun Dufydd ab Wiliam. 



Lc yna Bvrt a ymcho«1awd drachefyn u 
i. ac «n?hj y bawb Tot yn Uaven vrlbav. 
Ihadau, a'r ffw^T bydol, 



Dejllia 7 gair nbail oddi wrth y gair Abba, yr him a ar- 
tenr yu yr Y^rythyr, aG sydd yii arwyddo TfU- 

Oylekgrawa, 1. 101. 

Abada«tli, -an, «/. an abbacy; abbotship; the 
office, dignity, rights, and privileges of an 

Da bydol dy ahadarth. — Quiffn Ovain. 

Abadea, -au, «/. [from abad: Br. abadez ; L. ab~ 
batiiia, L.L. abbadiaea'] an abbess; the female 
superior of a nunnery. 



Byw ydwyt yn nef fa] abadet.—Iole Gock. 

Yr nioriM y gelwid yr ban a flaenorai mewn Uaiandy nen 
wyryfdy. . - Ni oddeAr Vr abadt dderbyn cyfaddenadaa 
o'u iwchodau oddi wrUi y gTryryfoa - , . er yr ymddeiwya 
fod yr bawl bon befj-d yn peruiyn i'r nbadfta* yn yr hai 



iecadence. 

Gwne bi y dreic eooh kaJia y hal-all ymyd yn biywyaw. 

Brv, Gr. ab Ariinr |ti) : U.A. ii. ««. 
Tpffwyn SanC a dda«Ih i'r ynyi boa ?yda Cbadfan . . . i 
adnewyddu cred a be^'dd yn yr yny-^ .,^11, acboa y coll a'r 
ahalt a ddaetluu ar y flydd yu^ Nghrin<L -7olo M$9, 108. 

nlfyddyd pUgsnd, fo d JseUi o*oH ar lythytn 



OOeds — ^urdrf-M, 



i-rbydwi 



Ii boddi CynUTi heddyw. a 



IJa«Ddd, ar abail oiaoea, 
CyoBgen ei pben, a ffoea. - 
I abaa a, tbnllswd, 



Tnnydd( _ . ._... ., 
Ued^ goloQ a bruu brawd. — loio . 
^baUpobanymgaifl. — Diareb. 

Aballedigaeth, -au, ■/. failure ; deficiency ; de- 
fection ; miscarriage ; ruin. 

Aballiad, -an, am. a failing; a perishing; a 
decaying. 



Aballu, vn. to fail; to decay; to perish ; to 
miscftrrj. 

Ac ^wedv UithTAV mis beibi&ir. b daljTiai 



Rwekt « pobFl CD iba 

Aral cjmmerj^ ymi 

lofnidilkd. gallmi gu^lo 1 



uOr.at AMur: HA. li. SIS. 

Ar ol cjmmerj^ ynujtli jr nron Hrddcmha^ hwnw Vwy 

" i^iuiiiniic.- HuuaCjnnni, 991. 

AIaIIiu, a. fuling; perighing; defectiTe; fal- 
lible. 
AbaU'WT, wyr, «in. a defaulter. 
Aban, (m. din; noiso; nprotu*; tumult; war, 

KmI yn lyt Aldbt kat ynwren. 

Kit ys UoHuliTTt uhii.n udnn.—rolBriii.' A.B, ii, les. 

Abvm 1 ddaw beuajdd yn', 

Fn bru ni a twur newyo, — loio Qtdi. 



Abaii,nn.coni marigold, yellawoxejre {Chryian- 
themum ugdum). — Hugh Davia: Welsh Bot. 
80. 153. 

Abandid, »m. turbulence ; tumult ; uproar. 

jf baiulid, bn sndair '.—Dianb. 

Abwnt, a. [pant] low ; depressed ; hollow. 
Tir abatd, land lying low and sheltored. — 
(hotnt. 
About, «ni. laud lying low and sheltered ; the 
same as Tir abatU. 
Attwl, tir th Komdd yn i«l *c ni niaodig. 

Abar, tm. carrion ; putrid fiesh ; a c&rcaae. 

rnum.— WjMorotHB..- A.B.ii.Ml. 



UtmhrB Uyw Prrdeiii u phar . . . 



UtK. ab hirmiin'.- U^. L me (cf. 3X>, 130J. 
Diudv; abwj ulnr Ijti.—OrB, Oiinu, 1 29. 

Abar, a. putrid, corrupt, rott«n. 

I abar feddaa rh^ddiau rfauddkm. 

D.BffrM! M.A.I.Sie. 

Abarth., prep, [parth: C. abarth, abard, abarh'] 
1. with respect or reference to ; respecting, 
regarding, concerning, relating to. 
Tiir deddf j rjdi w tudd o alhraw adelriawg aiarili 



2. on the part or side of. 

AhariA j drw »*r ffenesto 7 lias y brawd, ac heb neb jm 
d wybod.— />iort*. 

Abattir, -oedd, am. abbey-land ; land belong- 
ing to an abbey or monastery. 
Nt dyly imtjT b<rt yu dymwihyn. O byd abbalgr, ew 
Bdjij QOimt bydADt leyftyuD dvruy a chAmJwra ac amobyr 
ac ebedyw a lln^d a lledr»t,— Ci/i»iUfau Cm"*. i. i™. 

Abatt^, tai, *nt. [sbad-f-ty] 1. an abbey; a 
monaiitery presided over by an abbot. The 
Breton abaly (Catholicon) or abatti {Le Ooni- 
dec) is similBrly compounded. 

Tr fawn lydd boD neo leMi ar tfoaeUog s elwlr abad ; 
al ly« ■ic'i df, abaiit, 

Simon Tomai: Haoei y Bfd *'r Anu. 190. 
2. an abbey church. 

AhaU^, matb ar l«lvy> lt,vT.—Orirttfr n. Joxia (leeS). 

^tuMy (rM(ntin«(rr, Westminster Abbey. 



Abcedilroea, 

Bef iff ot 



Abkk 

a ffZaddiryd yn AbaUj/ 
yn caelfd niuul. 

as Abcedilrot, q.v. 

— if B«BlTtnan J goelbrBB, 

I, ac abcfldiirua, tal a^i gelwtr ya avr. 

Aarddiu, i. 84. 

Abcedilroa, am. the alphabet ; a word composed 
of the ton primary letters {a, J, c, d, e, i, i, r, 
o, a), to which number the Welsh alphabet is 
alleged to have been at one time limited. 

AbeMilrM, tiet f«l]y 7 i^lwid y deni^-llyUiyr cynlaflffioii, 
aebo« eu dodi ar ap-4^ir pedryiqll, nof 4 u doflpcrtbidlier* 
wydd y gair.— SnixMffir, i. 74 (cf. 24, 76, 7r4). 

AbcednilrOKwin, «m. a fictitious term said to 
have been given to the Welsh alphabet, when 
apparently it oonsbted of thirteen letters. 

Eto cynnal yr hcoi alv amynt, tet abcedOroa; a hea 
lyfr a'b geilw abadnilrof'^fA.—Barridiu, i. 76. 

Abediw, -au, -iau, im. [from L. obita, obitaa'] 
a heriot ; a r«lief payable to a superior lord in 
most cases by the heir of a deceased vassal. 
Also written Ebediw and Obediiv. 
HiwT achy^hellawT onffont trayan evbtva mfTchet 7 
tayo^CQ atfarayan ea (Ainlvrw HtJuayui ev hnbtJim albnTan 
0u hyt pan foynt or wlat a thrH7aa yr 7t ar bvTt gbob 
marwdy eayava.— CK/WiMioii Cj/tom, i. 873. 



Caaydoea a^nreyc oindjAii 1 



n ebamubor vrtb benufi 
■ij/H 7 vwifl lifliae aydele 

^nyc talb ameb m ■inobDr cHJiydoH ydhy bi a6fd^ nam«n 

tltmobor.—C'ii/rri'Jliaii Cirtra, i. 98. 

^bnA'HwzibeUachaddylyef dcy^fdtboanyflpawb wwyr 
ef ar 7 bo nttrfiio atiui* o lyfreith oyfreithBHrl yw 7ddaw 

Etm caDel 7 iAaIiui o b7dd ac Ealo 007 b7dd, ef a niS 7 
.— CjlA'rfttfaii Cirn™, fi. 608. 



O myiin Bf y tir gofynaet et mo ddariot fn dat (rynt 
abfdite^att' 7 tir bwimw ac y d7l7 7iiteu drof y dat a fdJy 7 
dyly. — CgfreitkiaiL Cj/mnt^ li. QAE. 



Oohaitii rhy iiiMog nk*' 
Affwjnynwylni'iiiyii 



Cyrdud diiiaid 70 nA«//, 

CynMd doeth « ynUteli.-Jtfyo. .IrcA. iii. 9S. 

Abell, (in. distance, ^r ab^/, at a distance, 

CHdo ar abdl nddl wrth feilchioii, 

Rhai Tut a ganut glwyfo'tb raloo ; 

Ond lie ba achoa nn n^wiider, 

Rho ditbau glwyf 1 galoD balcbder. — loUj Morgnnurff. 
Ab«r, -oedd, ebyr, am. [O.W. apw (Nonnius ; 
Lib. Land.), for adber or atber (Zeuss, O.C. 
148, 897, 905), from bh (cf. Cymmtr, Yn/er) ; 
C. and Br. after. Some Mss. read (fperlinn, 
while others have Aperlin (^Aber Llyn Llitan) 
in Nennius, § 73. Oprr occurs also in Lib- 
Land. 241] 1. a confluence of waten; the 
mouth of a river ; the tall of a less river into 
a greater or into the sea ; an embouchure. 
Aber, which in this sense is equivalent to 
moutli in Falmouth, Tynemouth, Mimmouth, 
eaters into the oompomtion of numerous 
names of places; as, AberAeron, Aber Vonwy, 
Aber Dyji, .dfer Ttiji, Aber I'etivyth, com- 
monly, but less accurately, written Abemftvn, 
AbfTConipy, Abtrdyji, Abertriji, Abrryatwyth, 



jM.v^.(,K)t;ie 



situatGd respcctiTcly at the mouth of tho 
Acron, Conwy, Dyfi, HviS. and Tatwyth. 
When one river falls into another, tbe smaller 
or tributary gives its name to the junction, 
. and the united Btrenui bears the name of the 
larger; as, Aber Himdihi or Abfrhoniidu, the 
conflnence of the Honddu and Wysg; Affr 
Owiti or Abrrgwili, the junction of the Gwili 
with the Tywi. The some element oocurs in 
several place-names in Scotland. 



>.• Oad«lIii,S0. 
Owr un rrt rut sordswa 
Arlletf toiTt nc twrjl kuiuwii 
Dal twTjt ctifr m ilnllswQ.— Cj^fJiIu..- M.A- i. 411, 

L dduDitaWB petJi o'i 

., yrlisn BiiT iredrig 

r, yni a«U] yr boll lu drwodd yn droednych. 



2, the flow or flux (of the fide). 



a port, haven, or harbour 



4. (^. a 



I, brook, or rivulet. 



Si. Onot, 1 3. 
T, u bMd.—D. ab Owai/m. bd». SB. 
Troedda&frddwfr yn tcadd] rliyiigddyDt. . . Apbikn 
nelodd afB J boM yn ofni mined tniy jr oVr ddwfr, tta 
& Aeth trwodd yn gyntaf. — 1 Marx. x*l. fi. 6. 
A ddiffydd yr hinl UD i «rni fachludo t 
Oe psUodd yr abtt, a tyohodd y mOr t 

B'.ack\titlt: CvuioD Alan, lOT. 

Aberfk, -oedd, */. the place where a river falls 
into the sea or into another stream; a har- 
bowr, port, or haven. 

Dy lytu TbUsu Fyfnotut hi talhnriByUi ynn larinUt, hmj 
itpfmn u* dir Teliiiu dyrlonpu a dym^'ono ny tlur. 

I.tl-r L^iudatimii; 118 (rf. 3fi8|. 
Onryn^pj, ■ ^wymp i'r ELin. yn Atm- Gvryu^u, uch lav 



Kid rhaid march bi 



iff/n 






Aberg^ofi, V. [ab+argoflo : cf. Ebargofi] to for- 
get: the same as Kbargofi and Abyrgufio. 



GwyD em byd, ryw rs 



Aberig, tf. a smiLll stream or brook, a rivulet. 

Ffrwd t?ilua. Abrrig A lifai yn ague i dan] ic^nmlom. 

I. II. y/raid: Coll Owyn(», SJ9. 

Aberog, n. abounding with outlets of streams, 

or with harbours ; streamy ; abounding with 



Ab«rth, pi. ■ 



ebyrth, t 



rO.W. aperth, pi. 



r. edpurt, edbart, idbart, idpart; Mod. Ir. 
iod/iboirl; Ga. iobairt] 1, a sacrifioe; an obla- 
tion or offering ; a victim. 



; OododiD, 748. 

Gyt ac y kygleu ef dyTodedynetli c Bnrtanyejt emadav 
ae abcrtiru a oruc.— flrul Gr. ab Anki^r: M.A. ii. soa. 

.*»rr<*aii DnwydyntTupryd dryUiedig. . . Yoaybyddi 
foddlawn i tb^rth cyfiairnder, 1 boethaffrwm ac abfttA lloiv. 



Tr oedd amiyiTial tatfa o abrrOau, yn ol tiaiunuwi 
Uowa : megya, abtnk hedd. nbtn* dlolch. aim* droa gram- 
wedd, ftc— r*. ckarlet, >.*. 'Aba-th.' 



& a6«r(Aaa, burnt si 



Aberth molimil, the sacrifice of praise ; the 
sacrifice of thanksgiving. — Salin. cvii. 22 ; 



the host. 

...,. . arsil ob4 nut vlwydyn 

ymbyiyit i ac et. aheb -wneathur Ofni o 



2. the sacrifice of the 
Nyi luwd 
Tngwneuthur y pw ymbyry 

A ayidiafael yr ci*»«» 

Hyd y ocn aircb ben y bath.— C oft tTiinJjni, xlv. 9. 
Owedy diweddu T weddL ml a dderbyniaia yr ebtnl 
nnlaidd yn ddDwioI.— JTnrcAD^ Cncyifnttt, u. 7. 
Aed Bobeit i dS'r atwrt.— TW.r .^(tol. 



Aberth offerm, the sacrifice of the mass. — ff. 
Baletbury, s.v. 
C2ocA aberth, a sacring bell i a aauctufi bell. 

Clerwiaig oant i iTflJit a gAn, 

Cloch nbtrlli, duu a chwibaii.— Z). ni bViV^n, xIt. «». 

3, wealth, opulence, riches, property, — Gweni. 
Abrrtli mcToh, aet goddid ; athrwyddfd mab, act etitedd- 



I, «/. the act of sacrificing ; 



Aberthged, -au, sf. a gift, donation, or contri- 
bution in the form of on offering ; an offering 
or oblation. 
TBir ntcrlkgal ([yllradm b«rfd : nn yw bllthged, a'r 
Altna Hefin ei rbiidiii ; aU jv pctllged, a lionno'r Albao 
E](*d; Irydydd, m-'infd. a'i rlioddi'r Albnn Aithan; a 
dognau obob un u'r ui yr Albnn Eilii, ml r^n y brcinir 
y oerddi newyddion. A tnloJiou, ac rillioa. at: eatTODiun a 
gr^ont eu dwnob Wr tair ah^rilt^^ yt amaeru'dd byay, 
can nad oea Lddynt drwyddPd ddyledti^ a dir a da. 

Banidat, il, M(ct.U]. 

AbertbUd, ■ 



a sacrificing; an i: 
w yn d^>yn yr atyrfliin^ yn gymnnrradwy 



iT^ylede. ii. «. 
Abertbiedydd, -ion, tm. a sacrificcr, a sacri- 



Dj ltd a'Ui nnad ith H«mrK netoedd, 

Ag*SwYt 

Tnry gat Bteain tiugamws ! 

D^gii oi Gvtili/a, ocxIt, 177. 
2. rich, -wealthy, opulent. 

Arglipydd cyfoethog ac aherthog iawn, a very 
wealthy and poworful nobleinan.^/ofc Mtt. 



kith pwlrtoM Ruefrr, a gmJu WT a glodfiwr di 
gAwq 7 clawdd jn bwyta bua hAidd nyt^ djeallrn- 



Tr oedd ef [leDi 

«*«*<ij iawn, meddBDI.— £d»iir<) ^an. 
Aberthol, a. BOcrificial; sacrificiiig. 

AceiDadaedddefadiuiiiA«'lM;TdnidiW7liaeUi Fixaen- 
udd yn dilea neb pcchodan rii wirionaMol, eto ft oeddynt 
gftgadol o ddaloniu betbsu I ddrfOd. 

lotffh narrit! Ow^Qi. ISO. 

Abertliu, ^. 1. to sacrifice; to iiumol&t«; to 
offer up ; to offer. 
Ji«rtAua6«rfA, to offer sacrifice. — Cm. zzxi. ai. 



Yn rjlL a**rl*« yn djTgel yr dwrweu yd mcy ef yno. 

At toordwjTryr m alwont unaw ya wu«d&wl kr a a6«rM^ 
>u idda*.— BuiAaW Cr. ab c^« .■ JI.A. ii. aS4. 

2. to oonsecnite; to devote; to dedicate. 
Al^hu gwylfa, to establieh or consecrate a 
festiTaL^Oru/ydd ab Arihat. 
AhaiKu Umlau, to oonsecrate temples. 

Af BVF^y damjt ir ^wynvydedyc dyscodryDn bymiy 
goLchy a dyleu ageret towy holl ynyii ftydeyn hayirfi v 
Umplban y rhey a oedynt abtrihedge ja eoryded yi 

d-feyirpn yr r^ hrnny a rodea yatm ' 

kyvorthawc IMuw.— fl™i Gr. oi Jrinar.- n. 

T t^mleu a oed ^edr seilaw yr gfiodm 

*yt ac mJ,fnkv]ft yr ^wij Duv hoUffyooeChai 

Ami Gr. obArtluiT (B] 



li yu BantU 



3. toeddow, to enrich; to present. — Llanover M». 
Aberthwr, wyr, \ tm. 1 . a sacrificer (used both 
Aberthor, -ion, | of the priest that offers and 
Aberthydd, -ion, ) thepereonwboproridesthe 

■acrifice) ; an immolator. 

^ Bydd pob crochan yn IcruHaL«m ac yn luda 

^■diirwydd i Aivlvydd y lluoedd : a daw pub 

a ^ymiwiant o bonynL— &eA. str. SI. 

2. one who celebrates mass ; a priest. 

Abad cars j Tlad Caet Fflni, 
Aboth iKf a byitb ni(«r, 
A'l byith beb gia nea bdiUmr, 
I bonb Dehm nturMic^r ; 
Betthog a tblawd a boithir 
Ar banhaa yr abrnhm; 

Guio'r aiiri, 1 Abad Yatrad F&nr. 
Hon wramdd Qnynedd a'u gwfi 
Ith bortb gyda'r attrtlaryr.—i. D. si Ituan. 

Abern, vn. to disembo^e ; to fall, flow, or nu 
(as one stream into another or into the sea). 
Tr afocki^ l^mll a ddylifa o Lyn CVm y Llwoh, ac a 
abm i Wyig ar eyf er Abcrbondda. 

Oindlter Kecl^ln: QiFaiUi. U. sec 
Abi, Ml. a tiact of land or oonntry. — Gimnt. 



Abie, am. the a, b, c. or WeUh alphabet: a 
word formed, like Bethluieni<m in Irish, in 
imitation of alphabet {alpha beta), the i being 
inserted to supply the vowel sound necessary 
to enunciation. Cf. AbredilTDt. 
MaI byn >; cafod arwydd a rayddor llafar waranLedi^, 
yr hon a elwir JT aiir ; acerdlJa'l f^w yr abctdilnie. 

Abid, -iau, ef. [L. habitm; E. fioWt] habit. 



pls/yt ae y daddwyt yn Ystrat Fflur w 
oretyd ymdanaw.— Brui s T^wsmgrnn, !S 



^ettai anwybodaetb ynaAJ wne tro«b«bod, te^ygallal 
ly fod yn acbos i ddynion i frw yn annuwiol. 

Dr. John i>at™ ; Uyft y Bw. 1. L S, 



_ , _.. „, . It ondbyf. 

a cbvedy en pn>ff«fl ymcbwelut yr byt dravheuyn I 

Tr hvn a vana^ y padriarcbawl altit y Tot yn padri- 

Yr alarch ar ei wiw-lyn, 

Abid galch, FaJ abad s:vyn. — D, ab QieUynt, ac. 1. 
Abl, cp. apled, -ach, -af, a. [from E. able; 
L. kabiUa] 1. able; sufficient; competent; 
capable. 
.IMdigabldawndoniswgddeBU.— r/V«M.' M.A. 1. Wi. 
boddldno. — 

U^ygallal 
Uyfty" 

A'r wlad nid oedd abl !■» cynnal hwynl I drigo yng 
nghyd.--tfn. xiii. 6. 
Ac felly yn apla^ ao yn debynadi i benwadoV bob!. 

2. powerful; rich, wealthy; influential. 
Ih/n aU iawn, a Tery opulent person. 
Lien aH oedd yn Uo Bleiddyd, 
TJwyr ben 1 boll w^ y byd. — Sion Bruywig. 

Ablcdd, -au, stn. ability; sufficiency; power; 

Er bod . . . gan bob ea^b ddeu-fli o amser i ymofyn ac 
i ymliyflpyin yng nghylch nbtfdd a chynneddfau pob ffwein- 
iSa^.—Vimmaa ffffFu.yiij, 95. 

Abludd, em. [lludd] obstruction, hiudtsnce, 
■O.V. 
1 #)n. carrion; putrid flesh; a 






Abo blaifid, a wolf's carcase: in the Welsh 
Laws, the carcase of an animal killed by a 
wolf or other beast of prey. 

Ala Utidd, ret yw hyony o dnfydd y ddyn oad dc wedy 
dechnn o flaidd neu two y yam, 

(yrdMau C„ir<.. U. 7M |cf. 2ffil. 
Bleit . . . 
Ouawd y lat ny Iwyt y abo. 

LIffutareh ab IJi/vr«ii/Ji: U.A. i. 199. 
Bhai a havdd fenrawdd ferir trigWTH tan 
EJiaib abo pcrllan rbai a bobea. 

Maieg Daggraig : M.A. f. 487. 
.«(. (S.H-.) 



Ycyffyloellidiogllwyd . . . 
BiJEtawd brath mab allMd tnych 
A'i «0o ai ahod oeSyl.— Z). ab Ouil 



oeSyl.— Z). ai OuUi/m, icriii. at, S2. 
Aboatol, -ion, em. [Qr. antirro>J)i ; L. apoetdtu ; 
C, and Br, ahottol; Ir. ahtdal, eaibal ; Ga. ab- 
atol; Mx.o«(^r on apostle: the same as opoiM, 



the t 






similated form. 



1 but less modified and aa- 



01 oodd bencb o'r banner. 



7-Jo.V_.(,K)t;lc 



H^IC 



Abredolion 



Yr yd™ yn srfer arwydd j (triw U" " ddoiJirmid j gyt- 
Kaoiawl egl»y», at o aoiser rr nlni-tolim hyd yr swron. 

ior,,. I.Vjno^; Athr. Orirt. 10, 

AY pryd hyny y derbyniuHiLt ela Denedl ni o Gymry 

y ffydd ynjr Nvm^ drwy bmn^th yr Afrnitnlioa vuiludd- 

O^A~^d, y «<.>*(, 7 (of. SI. 118). 

Abraidd, mlv. [braidd] acarcely ; hardly ; 
BCButJy 1 almost. 



w iDwit idiwr. Koirridrjd ittl J 



AdoM yndiLiv ; 



Abraidd, a. scarce ; scant ; faint, dim, obscure. 

Qoleuni abraidd, dim light. 

Y cyfryw, abraia.1 idlet miiwl ■ ra, 

Oodiir»Uaii chwln Anbis a buliliit. 

W. O.P^iln: Pid. 19. 
Abred, -au, »m. [ab+rhed?] 1. the state or 
condition through which, by a regular upward 
gradation, all animaitcd bein^ pass from the 
lowest point of existence in which they origi- 
nate, towards hvuiiamty and the highest state 
of happiness and perfection. All the states 
of animation below that of humanity are 
necessarily evil ; in the state of humanity, 
good and OTil arc equally balanced ; and in 
all the stat«s above huinanity, good prepon- 
derates, and evil becomes impossible. If man, 
as a free agent, attaches himself to evil, he 
falls in death into such an anim^ state of exist- 
ence as corresponds with the turpitude of his 
Boul, which may be so great as to cast him 
down into the lowest point of existence, 
from which be shall again return through 
such a succession of animal existences as is 
most proper to divest litm of his evil pro- 
pensittes. After traversing such a course, he 
will again rise to the probationary stato of 
hmoHiiity, whence, according to contingencies. 
he may rise or fall ; yet should he fall, he shall 
again rise; and, should this liappen for mU- 
lions of ages, the path to happiness ia still 
open to him, and wiQ so remain to all eternity ; 
for, sooner or later, he will infalHhly arrive 
at his destined station of happiness, from 
which he can never fall. This doctrine of 
metempsychosis or evolution, attributed to 
the dniids and the Welsh barda, is succinctly 
but fuUy stated by its hierophant, lolo Mor- 
gnnwg, in his 'Poems' (1794), ii. 193—206, 
and elucidated by documente which had not 
previously been made public, but of which 
none are of au early date. The same doctrine, 
derived from the same source, is promulgated 
in the Introduction to Owen's 'Uywarch 
Hen' (1792). 

Tri chyAur hulod bTwsdigion : cyflvr ahrtd yn uum ; 
cyflvr Thyddyd yn nyndod ; a ohyflwr oaiiad, vA girynfyd, 

O driphoth y «jrth Mwhm nkreiJ «■ ddyn : uiringua 
4 ?wybuda«thi uiymlyn Vt^" • ' — "'-* — ■- 



"r dH ; ac ymlya Vi drwv ; aef y 
/A ei jydryw yn nlmd. a tlir«Blo 
Bnrtidiu, i. 174- 



Cykh f/r abred, the circle of transmi^nition, 
through which all finite beings pass in their 



progressian from the lowest to the highest 

state of existence. 
Tri chylch hanfod y lydd : cfldl y c«igant. ac cid oM 
Tuunyn T>uir a eill ei drf iglo ; cy IcA >r ahrnl, b dyn a'i treigl- 
vya ; a chylch y gwyntyd, a dyn a'i treigla. 

A iibaB fynynt yn ol i'r gwynlyd, nii eellynt, (uhava 
marwoldeb a'o mdwai yn ol; ac yna *yrthiaw i gflf* f 

Treiglo yr aired, to traverse the circle of trans- 
migration; to iH«gTess towards the goal of 
nltiinat« perfection and happiness. 

Tri pben aiwhen y ndd cyn cyflvyr wrboda^th : tntfite'r 
ttrrd: tndgla'T gwynfyd ; a dtot o'T cynn kyd yn annaii. 

2. In the earlier writings, in which the word 
is of rare occurrence, it appears to denote 
Hades, or the place of depturted spirits be- 
tween the creation and the advent of Christ. 



Oodaiit oddj wr'b j cedvyr 
O't bsdd, ei gwydnedd y pwjr, 
Qan ddwyn pnmoei o'u gtwflau 
O'u If wm gifth, o nffem gan, 
1 wlod oef a'i diartrefydd. 



Y tynaist, adwedduat dyn, 
O'i ddnncH, drwy d4aic»ni, 
Oriflt, dy navdd I on ^yniat 



Trwy aoih chwim a^mynt Ran 
Chirytn encil a dhan drySar craa y p) 
nff flmawL ar en col ry^n ctdcd 
Dvmoau. hyd nai crynai iwi nwdd 
OAiTBl.— iV. O. Plight: C.G. 11.829, 



mid .- Owelth. M (ef . 91, »). 

4, Chaos, confusion, disorder. 

Hae wedi myned yn alind ^wyllt,— Our«e. 
Meddwl am dy Dduw bob aman. 
Am d gmriad 4'i ^yflawnder. 
Am dy waiCh at am dy ddyled : 
Ka ad i'th oriau fyn'd yn abrtd. 



derives it from pred. a word apparently formed 
for the occasion ; but if composed, as has been 
suggested, of the prefix ab, and rked, an evil 
course would fairly axpross ite etymological 
meaning. 
Abrediad, -au, am. transmigration; the migra- 
tion or progression of the soul through a suo- 
cession of animal existences towards a higher 



Abredig, 1 a. belonging or relating to abr«d 
Abredol, ) transmigratory. 

Tn abredol, by way of transmigration or me 

tempsychosis. 

Byr an^henfod yw en bocdled a'u bywydfod. eiUii' o 
ac an^en y nuu lyinmud iddynts yn abrfdal, \ mdd a 
L _. y^^ p^^ chwanegriad bywyd -*----- - - ■ 



oradd i raddyi 



Ju nei n«e St citbat bywyj a daion 



Md 



Abred^ion, ) t.pl. those who traverse abrod or 
Abredolion, j the transmigratory stat«; the 

subjects of abred; transmigrants. 



^li uwbm /j^rrdiavm .- tnch gwTtfa a chxthraut ni twydd 
Krmllu; uuteddlgmnBuglwii; acuigea nsortrech. 

IhiT. o'i m nff i rtn jl nmH, a ddoK yr abndoiion drwj 
j^lch poh dJT^a a ddichooai er dkn^wi wa haufFawa 
[iujuftivddf]^ maJa'a ^wrpidvf fdd ytDgcdwid o henyut. 

Abredo^, a. being in s state of progress 
towards a higher oondition ; transmigrant. 

Abr«da, vn. to pass through abred ; to progress 
towards a higher state of oxistenco ; to trans- 
migrate ; to pass from one body into another, 

ddiha id oddi tho at bjd pob cb«»iwgiadj canoliad, tyflfLd, 
wdrBfliadf L chwblhAa^ hyd otpheu oc eiUuiiDDd ; n gur- 
pbvyi yno droa fjrth o Iwyr anvhSLfod, icaJi naa geUir 
pfdlKh luc nwch lu ffirelL lierwrod ffiadd ac abnrd. 

AirdjM, i. M6. 

Abrwysg, n. [brwysg] drunk; surfeited by 
orerloadiiig the stomach; heavy; unwieldy, 
ttyd TK BTd TB ffreidyawl fl(eiUi 

BieiK oSno^ir »brwjiCT' ' 

Edirelwd Pqw^pwy no 

BTETdiliin bmBCir9riu£f~v-v— ^.v ■».■ — -.^j- 

Llyir.ab Kliwrlf: H.A. i. SW. 
Fetfa ainr//gg * ddaotll obry. — 1>. ob Ovil^mf clxv. 31. 
Nm trdd frnfcb Dwwn nitddoedd, noc nn uiuer mewn 
cwmpAaEd abncgwg^ o bydd modd. 

flii H'jnm.- Bh. Bach. Biuct. ii. 2 (SS), 
Abnsgtg pob rhyinch. — D^nb. 

W*dl nwyr Oino »»■ y modi abrmtg hyn, d lethom 
yn oa i*T poi^ i npia rmJluu i fudaerdiog 1fi Cariad. 
£(u IK^n: Banld Cwiig, SI, 

AbrwTB^ad, -an, ftn. intoxication, inebriation. 
Abrwysgl, a. very groat or large ; huge ; vast ; 



CfiM^he: U.A. L SIS. 



UuTFlddvAlfQ] geiifblch gorf a ahrvgtgl-Ajrl^ 

Gr. <tb Mmdgdd: M.A- L 
Gwt abrwjftfl ei faint. — Z>dt^, b.t. 



2. im. To become drunk, inebriated, or int 
Absen, -an ((}, «m-/. £L. ahtentia, from a6*ena] 



Q-Aydd at ab»en, presence and absence. — Cijf- 
rinach y Beirdd, 195. 
Tri djs ■ nir taTodrBwc aliKit dnwdrot. 

Cg/rriOdaa CgtitrtL, ii. * 



dwng ra r aiRi wrCb beUi o bmaw. 

l%All(Jt>iia (Vim, ii. 6i 
A diolwch awnaetb jnten hnmy vdunt yn ? 
mftea^Bml Or. ni /li 

Ao ym yd ymerbynyawd ac ef yowiBwl ycbydlc o Gymry 
Alioladigyon y rei ny vydynt odef y goruot yn abtfit y 
tywyMD^jon. — BnU g TifiB]/»ofiioH, WO. 

odd amKT cyfaddu i'v fivd- 
'iw Dii. e (ot. />*«, ii. IS). 



ychn d iddynt yn ab 



mrehwylio.— riM. i'wi 



yn gynaill yn «i g*ydd ig yn en 



id yn i^ddtui ag yn ddy&l. 



Da ei abten, speaking well of the absent. 



Cadw a bonof tj nirylaw rbap chwilena a Uadrata, a'm 
latod rbag dyiredyd mlvrydd, mblririaii, oa rfnrj n*«f», 

Ut/r (JioraMi dufrrdit. (Cat.). 

Oo^aA yw aDgclotnoH aralli yn y 4iA«rq, drwy vyodu Ibpi-. 
haa eifElot a mwyhdu y ao^lot- An^LDt y« KOf^u aralh 
JD Awj^bo^rOB ja ^ nbKn.— Vntdorlh fir E'laid, \ 7. 

Tn diddymu enilibUB ddruf aUn ei wrthddadlwyt 
lu&drrilig.—GwalUrr If'rhaiij ^1. Oljg. IM. 

Hence (with omissioB of the epithet), 
2. Slander, detraction, calumny, defamation. 



Enwawg wr gwyoh, c 

N«rad> 
IDdus 



.gairga 



W. Phyllp. 

ibKm.—EinI.Eiryila-tdd: M.A. i. 548. 

% Now oft«n treated as fem. aa if derived 
from sen, to which it has no relation. 
Abseiuur, eiriau, sm, a slanderous word or 
expresaiou; evil -speaking, slander, detraction. 

Abntivtir yw cyfartgoT ogan buntungua am baj-ablte neu 
weiUimdoedarailliyny alBeiin.— r™*orl*iir-Aiuiiil, (7. 



Nid lelly gwnaetfa 



ah OwUgn, Izi. SS. 
1] ar dy dnich<«uit 
-- ladrad. 



Cymmer ofal oa ymafhludo [yr 
neu dy ryaedd, oenf^m iwu cabled . , 
neu ar ryw bechod ^orthrwm arall, beb edifarbaii v ■ uw- 
wydd. — ktif J^euAs -' Drexeliiu^ MO. 

Aba«adra, «7n. absence. 

Ny dylyir rodi bam ar alvfrntnt pl^Et tea to ua dady] 
g-yndrycfaawl h«b teruynu yny llys bonno, ochava amser- 
avl yv dyuijt y datlau tfa va y datleu yn parban, ouiya 
dyd datlciu ynyd, so nyt dryU dyd: ac or rodlr batnn ar 
oMflidi'a pldi Tolly, camuam yw a tbmnyc obleit yr anu?r. 
Cg/rrWiiaii Cvmru, U. S50. 



cynDi^enn; 

_,._„-_.„-„ „..., ... rtuntua, dy- 

b rylrwf db, eioeULtigaT, cybudhav. drycdbycbymyc, dy- 
gaaedh. ansbywirdeb. caa. chwerwdec, anundsl), pwatrar. 



2. Absentation. 
Abaennol, a. absent. 



XJawar boffach ^ 



r i-nawd. CT hyny yr ydwyf 
y petbaa preBflnoal iifl*r a/wct- 



Absennoldeb, *m. absence. 

Qwedi son am ajighenrtaeidrwrdd ffoleuni*r haul, a gwaa- 
anaeth yr awyr, mi wniaf ycbjdtB elo am y petbau y mae'r 
Ar^lifydd "odi ™ parstoi goKyfEr 4 cbyflaitni diffyg ao 
a/araai'Mcb JT haul, ecf y ileuad a'r atr. . . IV mur 
nryoh y mae lotj a Ow«ner weithiau yn cyflnvni «iBi«Q eo 

Da/ydd Laeyt : OolTg ar y Byd, ietIiJ. 4. 
yr haul.'— Mmn (;o™r, ui. 1411. 

Absennoli, v. to absent; to render absent. 
Absennoliad, -au, am. absentation. 
Aboest, am. [L. abteittem] absence. 

£fe a ddyly ^annedda y ueoadd yn nhtrvt y brenin. 

Ot tan hmui* ygenlr Bwreicbionen ; ac os chynwrt y 
dBebiynant yr yi^«ed, ynffwrd yrei mwiaf reweiir yr 
ati-rM.—Rm Gr. cb Anlmr.- M.A. ll, l». 



Mem bot' (uhht Jt ntaddhuaich. nid mcgr* T" '■■* 
□B*yd<l jn nnur. eithr yr awrou th tirj lnwer yn fan 
^Strt.l.— U: Salni-ry: AH. u. II. 

Absenu {i), v. 1. t« sUnder, to calumniate, to 
defame, to asperse. 
Heb oUftH I'l i^od.-Sali.. IT. 3. 

2. To absent. 

Aba«nw, -au (e), n». [ab+eenw] dishonour, dis- 
grace. 

Biwl I'j banbl nld yw gsblirT. 



Abwydyn, pi. abwydod, tm. an earthworm; a 



■ydd abvyl^it f 

Abwydyn y cffn, the spinal chord. 



Abw; 






TVC BinTTBiHi ft dilrrwyddmrfu-iroUfti] t 
gyfncwiflnid >m ri olud bydrnwl ; pryfed u 
av^ ; A dijthreuJmd un d auid unfinvol 

jf^. jrcA. iii. ns. 
Abvjol, a, relating to dead and potrifjring 



AbsenwT, wjt {i), *m. one that speaks Ul of 
tbe absent ; a slanderer, a detractor- 
Af»emoT drvg, Drwg abienwr, a malicious de- .... > _. „ 

tractor or calumniator ; a slanderer. AbyxBof, -ion, «m. short memory.—^. 

I AbTT^fiad, -au, un. a forgetting; obliTioD. 

Abyrffoflo, I', to toTtret^Ebaraofi, q.v. 
F/kK LtK^i : Peri m. Adfyd, Cjrfl. ' 



Yn yr nn modd. ablwyr a dnof aK- — ,. - ^ — ..^. -_ , 
■■fua. Ko K ffoant TiDAith yn ullawl, pan ffljirHnt vich 
benwi Dnnith o fen tj Ujtr. 



Ittbodif, m ffwrn^ul 






ddignn d&. Dad oee dim mor wrthvynebiu 
■ ~iffolfla«f Inryddij, ac yii wr o ddy^ 

jtm i(io*d .■ Uwybr HyS. 8T7. 



Abw«rth, tm. wortUessneaa, baoeneas. i 
ness, Tileness. 
T IVn (vwHn llwynogaldd, 
Cnl TB 01 blwyf , calgn blmifld ; 
UAn diwryi; ffnoi, lUwa drvg ffrvyth, 
Uf^n Deding yn IIhwd Hdwj-th ; 



, , I % Tlic orthography is probably affected by a 
"J *"*' I fancied connection with byr. 

Abyrgofiia, a. forgetful, oblivious ; remiss ; 
forgotten. 
Oochf'lwch rhu bod o'r gwJunflnn^lAd yn HtT blr; 
cnnyB |)«i lur fyddju. y lyiivyr a dywyUcr yn ardoo, a'r 
ynudravdd flaoumwl a ai yn ahsrgofuM. 

IlB,ri )Vi^.- Bgl. Ffr. raiiL 
Tn drydydd, ^wOiad nddi aigoel anwybyddii 



Abwy, -aid, 
Arfer a ima g] 



] a bundle, pack, 
(m. carrion, putrid flesh; a 
Lu ar bob peth ; faJ y dyn Vt ahv 



Abwyd, -ion, -au, -ydd, tm. [a-|-bwydF] 1. a 
bait ; a lure ; some substance used to allure 

or attract. 

£f wuaetb a KWnadvaew B«Hed aba^ y arein. 

Cy-iWuiup.- K.A-i. MS. 
CynuueairgTraageddarol gwit^rdiyn atvsd^newjM 



3. sustenance. 

Abwyd, (pL-od),t.cl. earthworms, dewworms; 

A bwt/d y ddniar, earthworms. 
Abwydo, V. 1. to bait; to lure; to allure. 

tud ganddynt yn Ubwo godji 

Eig. Mai 
2. to feed ; to sustain ; to support. 

A moMwch hofyd {faJ y dyffud JT nndiyw Pawll modd 



Abwydwr, wyr, am. i 






>njiJie]-dd)-flg. 

that baits or allures. 



. ..... _i bo dir iddo: ao wrth hynny danpia d 

bunao a1 yn anwybodna al yn ahyrgofMt. 

H. i*rri: B^l. FfT. i»T»iil 

Abymiad, laid, am. [abwmj a beggar, strollsr, 
or vagrant. 

AhpTniad, cardotwr neu rodiad-ddyn. — Liaitover M». 
Ac, con. [tAoc: C ag, hag; Br. hag; Ir. ami, 

r, agaa ; Qa. agin ; Mz, at ; Xi, ac] 1 . and ; 
; both; likewise (■=^A 1). Used, with 
seme exceptions, before words with a vowel 
initial, as a precedes such as begin with a 
consonant; as, aor tu arian; uchel ac isel; 
colli ac ennill. 
Iifanon f cyTareiOi ba biyciut eoclayi Tclian a I^nsln/, 
a rod» brwELbin^ hfnn ha thmjyB»gkni Oymry ya Ijy- 
cyjuydaul dy eocluys Telian, kac dir ™dp oil Buetj e(. 

Lil*er LaMOav^wat, lis. 

j4r yna y kymotb Omnir y llech. tc y dode* y ryn^w ar 



yn Anludwy ml 



tTwydi.^cJynMu i-wydaw yny dpr y freuyn' 'ac yna y llw 



r Pebyr. Ac jnu y 
.. -dudwy ar twil Irwydi. ul v vuinwa 
^wir bi liech Oranw,— Aa/iinoybiii, iiL !1 



■y aimy 



A fTwedy fn^^l^ CLarlymaai bynny. a ni«du of flf ae 
tuner hyntiy. ny Jauaonwd anuon anav o hyimy alJan. 

Cao^iHi CliaHrmtai, | A 
Tra to U*n, ac awenydd, 
A cbln fwyo, aobvyn a fydd. — Qranmy Otprnti^ 90. 

2. The principal exceptions oocor before certain 
adverbs, prepositiona, other conjunctions, and 
some of llie pronouns, beginning with /, h, m. 



11 



c Before the verbs ma*, inattit, and ay or ti/dd 
(bf ellipeis of the particle y). 

Ac BBoit rn mTfrria ar Imwl en crUau iwrddiu. 

BdK. lamti: 'o.om. ii. IBI. 
Cymmg r T^fnVT* * ge()>l>t> ^c Ejrdd un dr liryiuiii, s 

MfgT> T DUw trwTKigion T bjd hwn jn gvneDlliiii. j 
riiai y nwe iddynt Mod lawcr, dc sydd yn cadw Uaw^r- 



d. Before the pronouns mi and ni usage t. 



nrUnL a 



u «Tbyn. — Sal™. V 7 



*. Before A the piactico of good writers is far 
from uniform, and the same writer is not 
nufrequently inconaJHtent with himeelf. 
Ua.'wvz o ddyddiaa vr vrfm mcfbida tenfil h»b fi-^nin, 
■ bcb dTirvKK, a beb (ibeRb, a beb ddelw, a beb epbod. 

^. iii. <. 
OUd Tdwyf, oi beb oowiredd TaDf.-/i>i ixxjii. 9. 
T rtiai ■ radiant yn ol au hyqiryd eu hun, ac beb mied 

a befyi nJt oed deobTmio Br 
.A. ii. 344. 

_^ -*_.., — «. . . -*c benrydd hj 

y OTTiriud 7 droeU ban- yn eu hiaitb bwjnt^ Bi ^-,. 

HfBrtiVrri.- Egl. Ffr. ii. 

/. Interchangeablf with a before i and lu ; as, 
cnioowabio; cyntocwedi; Dafydd a Wiliam, 

Petr, « lago, ac loan ei fnwd.— Jfou. ivU. 1. 
Jf If» a. goiedlodd Dafydd bvuio. ... Ac An ■ 
gawdkidd lonpfast, ac lonplut a. gmedlodd lomm, ik 

Eng. Morgan: Mutt, t, 0-9, 
') lewi s goudladd Ddafydd tm 
^^ji^AAT 1...- _f — -^ibatfljHU. .. 



^ Tydi yn r decfaniDul, Aislirydd. B *ylf unaiat y dd&iar. 
fhb. i. 10. 
Am Imiy y dywodii yn ayfllBdin, Ni bydd meddw bylh 
dBychedi ■"i Bytb ni laninr bola'r glvtfa. 

A. In sTchsic writera ac is sometames found 
where a would now be employed. 
Bnnydd ni fyth y iiiodrDrwn dydl. 

Un/r Qicfldi Osffrtdbi (Te Deuin). 



.ic dynu fejbion y dnkith.— £1^- ^tHV™ - EBsli.l. 
Ac dysu WTDiddyn cdeMAD^ corlf . 

Morgan LItayd: CyFlwyddyd, IM. 

Ac dyna ddinnys aneworal ar fAwndd mor ordderqhw. 

Or. 7oAn Dn.-ia .- Uytr y Km. I. vu. fl. 

^Pirtluat IK Hedieit, u Eluneteit, a' pbtonrylwyr 

"" ■ ' ftc IndAla, mc CBpjaaodar o Pontu*. r" 

fU, OF Pampbilii »c Eitypt ["yr AinLtl i 

ybiL yr ban ay lAr ilaw rvrsn nr ^i^^ttiMit 

.—W. Salrabvry: Act, U. 



fisa.": 



oolmoL— £U. /aMu; Ham.ii. Id. 
H Such expressions as ac fed and ac dilar/od, 
for a bod and a dar/od, used by some modem 
writers, arc simply barbarisms. 



H In the older language or is commonly used 

forbothd'-andn^; and some writers, especially 
those of Gwent, as late as the end of the IStb 
century, or even later, employ ag for ac; but 
they are now always differentiated. 
Ac, adv. {=A 9) a particle denoting the case 
absolute. 

Oni clmdunb^ ai n^irybod ef, lu yntsu ya nn, i 

fwytA^ peCiuu H HberUiwyd I flilanoa T — 1 f-'or. viU. 10. 

Evy ■ nmuit iiWdurdod a ddawn rwlsd t'r Arlwydd 
Bhiiiart N«lel, ae ete'a ben ulwydd MurKuiwe. 

UrtoBlgn Sioi ICyS. y Bdrdd, 9). 

A bo, ae efe yn grwAABnaetliti fnrydd aifeiiud . . 
o ran iddo iToKldart' ' ' " " 

Yrachoaia 



ti, oedd, un iddo. i 



Acan, pf. aoenion, «/. the same as Acett (q.^O : 
a form first introduced in 1793, apparently 
with the object of connectini 
of disguising its relation ti 






poeDsu peohl.—Tigid: Smith, at 

i. accentuation. 

nghenrheididl 



Aconiad, - 

Bydd yn cynuviTH . ■ . naturaipnAuuetlianffhen 
aatriiad, defnydd priodol y eydselniHJd H*r luvbydKiniiud, 
»'r petnau mwyAi eu pwyi mewn cyfanaoddiad. 

(ltcyKnl/,dd, it. 31. 

AcatQrdd, 1 arf".[a+gad+hydd] perhaps, per- 
Acadfydd, I adventure; possibly; Ukely; it may 
be (cf. i'tgatfydd). 
Ky deuthum i ynu yr inrreEks heb y Fercdur spbel 
mynitwn unvreic acatuyd awdi chw&er cnwi a Tynnwn yn 
gyrxlaf. — Mttrntaffimt, i. 71b- 

Acatoedd, adv. [a-(-gad-(-oedd]^.,J^rato'^i 

Aaii/yild, Agaifyild. 
Accws, ( ynau, on. [O.K. akfUm, akUm, acton, 
Actwn, j hakttoii, with other variants] a 
leathern jacket worn under the armour; a 
jacket plaited with mail ; a coat of nuuL 

Ar mardiave a ym^yTodefl ariiynt v yn tHdlawe ae vb 
trewia ynteu ar y yi^vyd deheu yny dyiT y luric ae actum. 

Tn y burduwd Ermin ef yn varcbavs urdawl, so y 
pwiecawd aruou ymdanav. nyt un^n. actvrn da dilio 
yagHfyn. a lliir>'[^ dwy dyplic. — Bmen o i/anfwn, | 9. 

Cen^fTen arcuiu a faffodd ddu iawn. 

Acdo, ailr. with him ; there also. Such are the 
form and meaning givctn in the dictionaries; 
but hoth are doubtful ; for the few passages 
in which the word is thought to occur have 
important variants. The passage in a poem 
attributed to Llywarch Hen {M.A. i. 116) has 
throe readings : 
Bliedataw: tAo ar fayd tnelh 
Echndav (Arid arvaetli c&d aaU [nl. kat ac aJa—al. cod 

Onavd fa ar fraetb. 

The same according to the ' Llyfr Coch :' 

Redenvo toon ar byt traeUi 

Echaaar torrit aruacth 

K^acado gnawt ffa ar ffnelh.— ..I.fi. il. sea. 

Edryched Bnryi pwj^ do 

"nvMronhin K».u ^mtH.]^ brwj9c tUU} [tf/, acdo] 



Le gwellywaw piryll ry twyllo 
Le gwetl Ffiuio na fniwtua Oympo. 



,>glc 



The following from a poom ascribed to 
Llcfoed {A. II. ii. 305) has also varionta in the 

'Myv. Arch.'(i. 1J4): 
Hydyr irwatd jwunw wnb vm 
Pan rfwlr cbwplit anln •it, udo, Bi do]. 
Diuryuic dyn bi wgId. 

Acen, -ioD, «/. [L. arreiUiisl I, an accent i the 
stresB of voice put on a syllable or word. 
Arni yw uin Uoferydd 



Aceniadaeth, ) 
AcenifiAth, ) 



,n, »/. 






D.lfsAi^d. 



HhavDriaeth mawr iu- venld yw'r drefa ju- y nniadopth 
o bftrth Uuk, H pbrainm, eyDffhjmedd, ap kw<U, w nr^'i ; 
■ef i?u trcf Qu yn y cyfryw fJdn u t byddunt berf i^ld-Oiu 
«u suu ^ a hyu a afir o anuvfuela bu, lum tryn^fbADcdd. 
DFu oi-'M^ J1I y i^yTryir rodd h^ y bo uonfa^l viuUAduidd y 
U&ia ■> Ainj am yn diHaa a ifwrthuii y bydd y nin »> 
ILhfar AT w«rod« dni vneir trcfa o bmtb av^D a ehprddmr 
UhrjlithBi hynobnh. W iia ddygonl y b«ii«a ynrliyfaiUi 
yr un 'PH-'K, A thrcfn u* ofa^ at iftr vyDKliAo^l, Jiawer 
modd ■ rhyir y sydd ht ami. — i.}fj/ri'iich g BtirtU, ^ W. 

2. accent ; tone ; a habit or manner of speaking; 
voice ; expression ; words or language. 
Ai'tn y gimui, the oucIloo's noto. 
Dal bi/lh ar yr uii uren, to harp always on the 

Yr ufdd hyny t/n aeengan baivb, that was a com- 
mon saymg with everybody. 

Cum SWBith a«» T gag.—D. ab (in-ilnm. q»ciji. 17. 
Cerau adAT yn y Uwyn 



Hyn. meddAff a tfydd if"- drs^fwyddoT y gydwybod. 

3. an accent ; an accentual mark or chaiacter 
also called nod areii and ucemu'd. 
Arm umgykhrdig, a cireumflexed accent; t 
drciuuflez. 
Aetn dititgi/nfdig, a grave accent. 
Arfii ddyTThnfetlig, an acute accent. 
Actn lein, an acute or abort accent; short 
quantity, 

Aeni hir, Ai-ti, hirilart, a long aeeent ; an accent 
denoting a long sound ; long quantity. 

Ym» nrwlhiDU yr yipyinra pa nvl poUi a bair t aiJUt 
goUi oi cJiyBawo n«». Ch»n phplli a'l pair; nid «mg™, 

fcyiuKlJii yv. «i chyhonddi u aiUIat atuIL : nr yna y mae 
i ja n*»idlm» ei heow, av ya mynwl u dtiyrrhal«liB j-n 
ddwyaedj^. AC yn colli ei chjilairn ar-m ; panscyliHwn iivh 
— '■ -"— — ---" adyrehatedie. ''- ■■'• —~ — -- 



iiiii1«b»iiAi<li. T meddyllr tnto- 
■AU mwuiui ■ mewuuu yr TTSf iUl ,• Onin. Cwlld. SO. 

Aceniaith, «/. language regulated by accents; 
ihytbmical or metrical language ; verse, 

CynnAl *'i bfr ncntml* 

I ryny 'i oedd tauau'r kutb.— />A,rti> Sim Pki^f. 

Acennod, -au, on-/, a mark denoting accent; 
Oao nad o« ^w yr 
broo y darUenydd gynllim cirb) 



ddyblu y cydn 
A pbwyg yr rxi 



■ pswyddiaid amlyoawl a fh>1Telyb heb 
iniaid. ac liefyd htb yr nem ddcjrhafalig ; 
maruji'ii y iiiull oac y UaU i ddan;fawa ^lym 
I.- /'t^i.i: lAwa-LjfUiyremad, 13- 



Soniii mmodotfwyr am dair .ifn. Nid ora achoatrylwyr 
ond uD ddwy yn y tij-mradtr. »f yr hir a'r (er. 

tlicallur MrclvU', : Ulnulli. ii. J38. 

Aceniad, -au, ».m. an accenting; accentuation. 

Yiign«bydiisdrruiViJgciriiiu.orgalludaiilenyDllyIilJi, 
lawn y» ggfulu am fod alteliadau y Uaii yn iryinr UTth 
lafani.— fr. II. Pugkt: Cad. laicli. Gym. i. ui. 1. 

Mwy B nodau -■'<,i,ul a fyddai er inwy rhiryBtt na chyf- 
antyddyd.— OiMllirr i/rtAo«.- Gnaitt. ii. MB. 

i. accent ; rhythm ; poetry. 

Oardd i mimiau. furdu ddymunuMl, 

A gwaBgmtdBjdd u »!■■ gywodiadi, 

T™ hwy'n darilaiii aun arrui<«l bHTddion, 

nil deriiyddon. bylaw udixHldind.— (.'m. Oieam, 9. 



mffydd lythynnaa OtoaR bi 
•1 gofynoL oil ?pllir mmM g< 
rbl tuJdhAo) o'r OaMAdur. 



y rfaaimd ydyaartaol u'u ka^innadi ym miaaeT. 

Aceniadol, ) a. accentual; relating to accent; 

Acenol, j enundative. 

Acftnu (r), V. to accent ; to accentuate. 

Canu eywjdd peduAT, ae amy.—M)rK. Arck. Hi. lOT. 

OeiriAB deaaiU a aenir yn gyffndin ar y nU nntef . 

0>MlUrr Mrduun : Onilb, ii. 13*. 

Acanyddiaeth, -au, i/. accentuation ; prosody. 

Amg.l'liarik . . . ywy Helfyddyd ?fr'™ "hhIo Uythyr- 
ftt^ri Bai-iti: lath. Cym. i. viL 
AcOi adv. variant of acw or ofo. 

Ac yna lurwydd y ddau ow y dywaid cyfraith. 

SanU Loew am. a BBHtl Locaa. 

Saint (>Lrig. Idnilig. MelWAB lacenot ! 

Saint aa> £Um. a Saint loalac— /.. O. CoM, it. xix. SS. 

Aet, -au, »/. [from L. actum (pi. acta): E. oc*; 
It. (ic/it ; Oa. nchd] an act ; a deed ; am edicL 
Kr Aclau, the Acts (of the Apostles). 
Aciaa yr Apatolion, tbe Acts of the AposUes. 
T petban byn b^Iyd a tpitfeir yn ysttfeiudau ac yng 
nghoSytbyrau NebcmlAS, fri y Ewnaet£ efe lyfrdT. ac * 
__ .....la i„..„,ad aV pmpbwjdi, ««■ IWydd 






iJd ^t y^bi 



Hwy . 



aUaccO-li. 



Actwn, im.^iArciim, q.v. 



a naetM y byrd«a on ea IlisIiHn. a 
y vynyd. a girrteichaT eu mcirch AO 
-■1 ehAlaetb. a cbymrytor ysiniereit 

Nid o«dd na nulwr na rhyirwr na gwilliad a allai eu hatoA 
pan ydd elynt mewn rhytd ac yn nerih arfan : a chan 
fntint acMriiul, aa y oeiaynt ea nc^^va. ac yn ryfltal a hyny 
guk bwyll a ayherwyd.—iIarcAogioH LIgt ArlAmr. 

Acw, adv. [generally equated with Or. 'txn 
and L. axe; but probably connected with 
Thai: IB, rhaco, from rhag. Cf. Ceo, Ocei] 
yonder ; there ; at or in that place (not ne- 
cessarily out of sight). 

Vyrda ymledwch yn diirririaiic ar kast^ anbi>. 



ju.A^.(,K»t;ie 



Tma at. ocw, here and there ; hither and thither. 
Ydu t tnitliia m j gtreaieitloL, aj, one y ilugTitliiii i 
ymK TT yniostwng ac jr fmob^^a, ui one yr edrych yn 
oebel ; yma jKWDt aitra btoid, ut anr y ku oobel girnh- 
wjnetnllrr.— iSr. /i>*» DaoiM .■ Ll]rfl y Bco, II. L M. 

Acwy, adti. Tiuiant of acw, — Owent. 

■ r«ch, erwydtu h 
It D«yil.— Sjrr a 

Ach, -an, -oedd, s/. [C. ocA; cf. Ir. aicme, 
geaaa] a genealogy, pedigree, or lin?«g«: a 
stem or stock ; the line of one's anoestAn ; a 
degree of oonaanguiiiitf or relationship. 

CyfcMor Echdcj ^cA diylwyn. — fTm^nui; M.A. i. 301. 
BiQihiTiMdd nefoedd aiAetdd iichaf - 

JfynUin.' M.A.I. 135. 
Huidcet on huAaa kyn en b«duff. 

Cynddebc: M.A. 1. tS3. 
T mif gchofdd k oeddyn', 

4&4aii y tad, o chAid dydd, 

AciarM Kh fenh Dcl^^ydd.— C. 0. t7al«, Qi. iIt. 47. 

Brftiddtrydiun y beirdd jdynt- 

On. Onii, 78 (of. M, la). 
Dynu I ciiwi nedoUssUi le ncA yr ben Oymir. 

r*M. Kmm.- D.P.O. L 1 (7). 

Ynaa/ed aeh, the ninth degree of conBangiiinity 
(at which point recognised relationship ended). 

Byd y nato/ed ack, to the ninth degree of con- 
sanguinity; to the ninth generation. 

Nid oedd iddynt fniint o bawl yn Ynya PiTdHla, nuuyn 
y tJT a't luwdd a rodded iddynt oma draf^oan ; a dodi hi- 
nynt naspcllid brunt C^inry cynh«Did iddvut hvd ytn mhot 
r BM/fii flci.— TWohW r»jr. A^dadi: M.A.U.68. 
Nid yir efe yn pcrtbyn iddo o'r noK/oi sc*. — C,S. 
Aeh ac edryd, Ach ac edryf, kin and descent; 
stock and lineage. A oommon bend^yB in 
the Welsh Laws. 



kyt^wBinndawbo yhswl,rBit y»yhai«duryBit gwiattreu 

di MS gogrdl mwy no tbeir irweith gsn dwyn y ach colledic 
nyd oe b^wl.—Ct/nMiau Cyrnrn, i. 798. 



Tr argbwjd adyly kyn ^wnndAV y bavl ^mryt ednyt 
byiBWgirjT y wlat aiajachaf ulri/ac at g»Y p- ne* ar olri/ 
i^yly J vvando dym.—Cj/rrtfAiaK Ctmru, n. 472. 

Ach, a. [allied to agoa : cf ■ ecA ; Ir. oe, oeut, 
ocui] near, nigh, contiguooB. 

Dffvcb yn 'xt^ a 

Dyn^mSi n«o«wch Suaow, 

DocUi yw ei dyig, da iuth dsg.— H~. fiblotiiry ,' Diet 9. 

Ach, prtrp, near, near to, hard by, close to, by. 



m yny nyd daaatlca nawr > 

A beuHawT yncadw y dcvoit 

m^,M^.m^ - fTwjB ymduww. •guuieliri 



Gui bob Ilanw ydAf i 
dellryf byn ym [yn] itth a 



rKoerloyv. 



Ach, «/. [L. (i^uo ; cf . nrftw] water ; a liquid 
or fluid. The word does not appear to occur 
except as a component part of some riTor- 
names, principally as a bi^Gi: ; as, Mawddach, 
Myiiack, Clydach, Etach (cf. Elwy), Arthach, 
Caiaeh, Gtarach, Ctmiach, Owyrack, Qwyjuich. 
In Athddu, AcMaa, Ach^h, it is probably a 
prefii- 



Ach, «/. [from merch, ferth, ercA] a daughter; 
used in pedigrees, like ab for nmb or fab ; as, 
Eurgain ach Maelgwn, Eurgain the daughter 
of Maclgwn ; Mallt ar^h Owain. Erch is 
similarly used; and vch (for verch or /ereh) 
is of frequent occurrence in genealogies. 

Yt wdd leityn ab tt Arlwydd Owrgu yn briod i D«la 
oelk Bleddyn sb Cyo^ o'i wnig syntiLt, aef oedd bonno, 
Hhc aal Cyhylan.— /oio Mti. il. 
Ach, pr. pote.^Eich. 

Qwoendewdi chwi vygeiTieu i. a eh ymer wBh yn ack 
elualeu vy ymadniwd L— y OrojliW, ) IS (of. 17), 

Ach-, px. an intensi-Te or enhancing particle 

used in composition; as, achluda, ocAUr, 

achrwydd, ar.hrwym. 
A'ch [a (I, 4, b, 9), and the possess, pron. ei'cAj. 

Bee^. 
A'ch [4 (4)-t-eich=ag eich}, with your. 

TigrifenTisb it'<t Uaw eicb hun. 
A'ch [a-4-eich]=a eich. See A (U). 
Pan yi a'c* eyfaill yno. 

Acbadw, V. tokeep; to preserve; to protect 

Etyr eli tefiridv myr. — t/jtoarcA ffm .' A.B. ii. 2BS. 
Oorwyliaii noe yn aclvtdw fin 
Oorioei rydau dytyr Dyzeo Frddin. 

a^HAvii: M.A. i. 1S3 (ct. ase, U2). 

Bbwyf dltndir rbwym iicA<idw Uecbain. 

UiTB^^K Fardd: H.A. 1. SfiS. 
£iAalwvBi ne terryao en torynaa. 

OiM» Ct/i<"0B- M,A. i. M«. 
Achaiu, a. [oain] very precious; beautiful; 
splendid. The word is formed as regularly as 
any of its class; but the following passage 
in the * Uyfr Da,' or Black Book of Carmar- 
then {A.B. ii. 29 ; M.A. i. 79), usually quoted 
in support of its early use, does not contain 
it ; for, if the printed copies are to be trusted, 
the true lection is a chrin, where the a is no 
prefix, but merely the copulative conjunction. 

Qwydi gnnam a phocb a ehein. 

A eoruylBur manr miniein. 

In Llan Helet bet Ownln.— J .S. il. M. 









ii. 1«). 



>ld a wybydd yr boll 
(forphi^irfBoedd, her- 



$/. [c4n] 1. accent; t 
Awenydd. Pa both »w cetdd gadairl 
onbeshd, BwalCh prydydd o bencerdd - 
■flIfAn. a*i ffeiriab, a?t ttcAanati, 
wydd oorf an a chaniadaeth y n 

2. a chant ; a hymn ; a song. 

Nid oedd o't Iluoedd diddan un angel 
Nnc uehangel mwy ucbel ei ncAsn.— IVjiid : I 

Achaniad, -au, sm. I. a murmur or 

ing (as that of water or the wind). 
2. accentuation; accent, tone. 



llarar 



,rf(ao- 

0th ar ddyn y dylai bob doetJi t 
ryll : nwydoldeb golwff : ocAankH 
(6 ymmod.— Jfyv. ArcA, lii. alS Id 



AchanOff, a.=^Acheiwg, Anghmog. 

Ai:ha7Uigion, the poor; almsmen. 

ft ddyly JO el sTdjmdeitluifl ui 






- „ n buguint o wjr ar (eircb, old uOKCn, j pedi 
Bwyddav^ ar hugminC^ a'r dcuddw fnrfiftAL, heb d deulOt 
»'i Ityrt*, «'i wemoo, «'i gerdflonon, ai «Aoi™ion. 

Ltgm WitUtffu^ [. vUi. 
Acbanu, v. \. to chant ; to utter musically ; to 



iikyrd. 



I.- A.B. U 



» {of. 14G). 



«„"•.. 



2. to murmur (as a stream of water, the wind, 
and the like). 

Y ^wynt yn ocAnJiu ,- y dwfr yn «*anii. — A'. W. 

Achauwr, wjr, nn. a chanter. 

Achar, a. [c&r] amiable, affectionate, loving. 

At^r, Bwiana, LoTiUK. — UanovfT Ms. 
N^b baba nyd ocAtr. — JV^. ^Id^. i- 430. 

Acliam, t'. to love much ; to love. 

NHdKAarvaeenacfaarmTirT-— Jf»nftf<n' M.A. i. 1S7. 
Beirdd acb gfigan hwyDt ae^ran yn drapywydd. 

Nyd a-t/ir Uachar UauarwFh 
NydarhlMadwanitwch.— i7y»JiWiip: M.A.i.ZX7. 

Acliaa,<)n. [caa: C.aAoajgteatorextreme hatred. 

Tn berwyt bod arJiat.—Uyw. ab Lli/Hirlipi : U.A. i, 800. 
Achas, a. very odious or batefvd. 
Fob pJBC B milyn yd fydd te«aw 
I drala a ^Uaig swlr nctoMitu.— JM^oiU : H.A. 1. Ue. 

Acliawa, am. See ^cAo«. 

Acltef, If. apparently the 3rd i>era. ainR. pres. 
and fut. of a verb the infinitiTe of wnioh is 
unascertained, the following being the only 
known inatance of ita occummoe : 

Aa bwyf yu nditt 

T lloo a iif*'/* 

Acbce wnhi.—Mfilir : M.A. i. 1S3. 
Davioa leaves it unexplained. Pugho places 
it under achii, which ho makes STnonymous 
with achuh, and in support of which he quotes 
this passage, accompanied by the following 
trauelation, in which ache/ is assumed to be in 
the first person : 

It in Ibe peaccrul grate I iboold FEiaain 
Tin aiU'd, I'U Uien tlie needful fold r(«aili. 

But 8.T. 'Lloc' the verb is rendei-ed in the 
third person ; ' If I should be in my dwelling, 
waiting for the call, the fold wu] secure a 
proximity to it.' Different still is the version 
given by the same writer in the ' Cambrian 
Register,' i. 406. The assumed verb aehu is 
not elsewhere met with ; and aclic/ cannot 
be regularly formed from such an iaflrdtive. 
More probably the word is connected with 
some form of caf-ael with an intensive prefix. 
Actaeiniad, -au, im. accentuation; aceent. 

Cprdd dafavd yw iaith ac ymadrodd a drefncT hcrwydd 
moaur, rbif. ac aehtinitd, a. cburfaA, a cbynahBiiudd, hor- 
wydd cellyddyd.-ila™-cr J/.. 

Achel, a. [eel.] concealed, hidden; sequestered, 
secluded ; ' secret. 



Dafydd . 



aKMor, i't Meudwy. 



Achel, -ion, i/. a place of concealment, retire- 
ment, or secluaion ; a hiding-place ; a recess. 

Mao Dobo'm mhdl nuini acM, 
Ueini y Uwyn wed, man Uawn cd. 

Di^ft^ ab Owilfm, alii. 6. 
Ond oi dewiiwdi diwi p arSii leddt, 
A DhGiBlaw bri ym mbob dlhaUiffg Iwyn. 

T*. Llajii Jmtti: Cdn. Awm, 17*. 

Achen, -au */_. [ach] 1. lineage; kindred; 






: A3. IL sm lot. H.A. t. u 
I'dlen.— ^wll Tiiit SaiU. 



Ym myn^ arofwch y mae 'fgr 

2. order, grade, class. 

l^ir aefiat vabanr^ y fiydd i 
miainC priteirdd.— /»fo Mu. M. 

..,_p .■d 

lUw pnawd-bvyll y i 
wabajiKd bfn^ild ' 
Fob barfd ■ " 



L G. ami, m. "i" a. 

feirdd Yays Frydaia ym 

[th y wieff boruui ; aitiir 
V &i-rhyw pnf ardd yn 

Uff ynv naunedd /ryiyll ueu Son ffrair yn gyAuilliw I'i 
wiag— Zulu *«J. W. 

3. a eoat of arms. 

Yn acAtn y ddrai^ wen wiw, 

Bawnllasa, J mar'r arianlljw.— 7«ld ffsc*. 

4. accent; verse; note.^Jeftan. — Hanover Xs. 
Achenald, eidiau, i/.^Ochenaid, Uchenaid, 

Hhaid Koohelyd y ddull a elwir pogTBHwUt . . . yr byn 
both B Hina y gwnmdmryr ; ar folly ni fyddai ^addaa i 
ffyahyifu y nwydau. na eJiwaitb yn debyff 1 ddiryo afi*™a<d 
o'igtlon.-Ji',<nPir^: Eal.Ffr.ndd. 
Achenedd, -au, «/. [achan] a singing; a sing- 
ing in concert ; a strain or lay. 

Uavor rhmdet aooeUi a doeCh Wynod 

Oeureird agytrwya y beryt a* banrydod. 

/■*»;.> Brtdgdi: MA, i. 878. 
Ai J ooodydd mae'r cu ehrfion, 
Adar A'u cynboa bydr aeeiuan ; 
Aelfifilit ryfedd i'r lua a eiliant, 
Dolyaleluiunt dlos-vawd boew union. 

JJftHriflrf ffjupel.- Tym. 10. 
Hoffai yr hen nth/nrdi 
lion uwph law bwa na cbledd.— R™' H>- Bl. Art. 69. 

Achenog, □. [achen] having kindred or affinity. 

Achenog (e), i. [=anghBnog] needy, poor, 
necessitous, i;idigent. 

A pba le hynn . i y bint »cA"injiion Crist . . . rin rby- 
bndJi-iddrwydd }-.«- en honiddiffjm. — Hr.n^rt Mt. 3fiO. 137. 

Ni Lydd iftAra "ff nebyn yn plilb ni. 

III. Ilicliul /nan fcvtifaill, I 6. 
Mai itrhrnaKg an e) geinlawg.— J>iare». (M.A. iij. ISt). 
Achenog, -ion, sin. a poor or indigent person; 
a pauper ; an almsman. 

truein ar lawr nuetli hob na bwrd na llioin rao tra brona. 
... A gwedy dyaJlu o Cbyariymaen- panyw Hio yr aU™- 
OffB*^ avcioL yd ymvnbodaaae] Ai^lant a bedyd. a gaaai 
o urA-floyjoff yny hoU lu aviBgvva yn hold ac abortbea yn 
enrydedua.— i'Mlarya lU Corals iligio, ml. 3B5 (cf. 3S0]. 

Kynbeilat ymdivait. a ^wra^ed gvedwim. ymborth ae4«- 
ogyoit. kj-uydwreglvyBaeu.— Cai/d/jau Chartyvifun, J IM. 

Achenoges, -au, >/. a poor or indigent woman. 
ewT ffwyallwyt. but yi 



Aclie«, -an, ■/. [ach] 1. water; the bi 

Tfllr llwluc Tn aehv uymca Imi brKVt. 

TalitiUL: A.B. ii. 160 (cf. 119, I! 



CtmUil<i: H.A. i.HC. 
Oomn tnryf twryf oe*M ai dneth, 

CfiddtliD: M.A. i. an (rf. 1*8, 193). 

Achet anoddyn, the fathomlesB deep. 
DiDui tfymaA teyni DTUtx tvrf 

Twiyf aMuancdiin.— (7fivUrlu>,' M.A. i. 143. 



A ddaw D ffymum ; hsfyd ^rii* 



Drdaw drheb^r d^ bru dybrjfl 
KKTWIUt CoTnir Mm kyffroCa. 

DtUTOai^ tip citpim, aelutati, 
A lipnaii tta Uawiudii, 
on a trrddMit m Ud heiri " 



- A.B, a. IW (Df. 66). 



Alu. /WrI.' Tyni. II, 

3. ttotl), spume, foam. 

HvTiid AT Uyn rwyn avktt. 

SfgJ. Bra MtKgtU; XJl. L IMS (d. Tl, «1S). 

i. the muse ; the action or impulse of tbo mind. 



Drtnid Drnt In 



Cr-uUdw: ILA. i. S 



< (ct. 130, 133). 



.^Mtiaanl: It.A. 1.160. 
Aidwyrwt liad o hwf 1 acha kjrrt. 

LJfHDrcJt nfc^Mirwrlrii.- M.A.i. 384 (it. 30). 
Achfen, -au, af. the groin. 
Aichftm, -au, ». the groin. 

Achfte, -on, «/. a shelter ; a covert ; 



wllvTl«edn< 

KeseddeiDi&lefe. 



A thniH Iawv liiAwd is achfrt wnnp 

O Maiyw wj-dd, neu yn* hy drofiu", 

Ai caad^ si hrWel plllb wlionos tern 

Oncdig wj'dd ■ blDdau brvydairl mr 

Bob ti^rn, gwftlth Efa.— IT. O. Pughr: C.Q. ii, 416. 

Achlaf, a. [claf] sick, sickly; ailing. 
Uw^ d&f&wdwst gwfet ffi3aC oMnj oedio^ 

Ai It etdion dybrerf.— Jtfadoj DvufToit: M.A. i. «e. 

Achlai, a. [dai] clayey. 
At atUai wadod, on a clayey bottom. — lolo 
Ut. 174. 

Achlaia, leisiau, «m. a word of ambiguoiu origin 
and rare occurrence. If from daxi [a-t-daia] 
the meaning would be, as explained by Pugbe, 
a blackening, a weal or atnpo; but if from 
Rait fach-f-llais], as suggested by othera, it 
would dgmfy a rumour or whisper. In the 
■following quotation, the only recorded ex- 
ample, tiie latter is probably the sense in- 

boedd. 



AtbiDdwT, ni 

AchUn, a. [ach+gl3in] complete, entire, whole, 
all. 
^ hgd adUSn, the whole world. 



ACHLE80L 

Bot addef net jn olddiav 
Ar byt acMan j dukiiw. 

Pllg'ip Brydgdd: M.A, i. 379 (e(. IM], 

Prydain achian. all Britain. 
UkWT llawT Uwrw Ptydpin arAla». 

Llyv. «t J.I*«Wyp, ; M.A. i. 189 (ct. ISO. 821). 
GwiaMonachletfloaacSfan.— rf-i«(ii.jm, H.A. i. Geo. 
All»d DiwTiiioli ■Wydil » niuemchnn [nrHin]. Dynot 



Wydsl <i 



:wdyff< 



(Iwrdd yv Rhyo. ^arv ddur bwui, 
Onrcfl mynych l^n Mod mMtdn. 

AciU4HVi,uiiiiil^ynijw.-l/a/.tt.Sdtu,r«i: G.D.C.IO 
TywjUwoh Uw yw sllan, 
A cmog o gaddug- achlili. 

Iraan BrydyM llir: OmiCli, a 
Dy hoeledd a ddiBg1«iriA yn ddi-rwym 



AchlAn, adv. altogether, wholly, all, 
pletely, entirely. 

Chwiorydd ■'m bu dUdso 



Pe cwympu yr awyr j gyd f'r Ibwr, mi s'i oymulwn 
adkldn i fyny u ry nvr s^k*- 

ZtenniviM.' TOtest ItSOSI, SM. 
Achlau, a. [clau] sincere ; honest, true. 

A a e rc b a i a y mwyn-lau mad. — Thomas DeFiti/\ f'r Eoa. 

Achled, a. [lied] spread abroad ; spread, scat- 
tered.— 0. V. 

Acbledawr, ».m. [of. arghdr, argleidriad] re- 
fuge; protection; shelter. 

r H' atUedhawT]. 

Janrin.- Oododin, 380. 

AcblM, -oedd, */. [L. axilla f In Gaelic achlaU 
signifies both the armpit and a shelter], 

1. a place of succour and refuge, where one is 
cherished and made much of; a shelter, refuge, 
or harbour. 

S«t Uer LlansT'H y du> ««'« 

Mor yny bo y gjiniea.—A.S. ii. 31 (ct. U9. 183, 140). 

A lIF«r l-r hen oooBdd!— ^ro. Omii; tS (cT. SE, S4J. 
Hodred y doeth a cliwiUodd am acMc ifiag gwythlomleb 
rhyfd.— I'o™;, IW. 

2. defence, protection, succour, support. 

T mu y[ anirpiliald, y Thai a Sotint < ddiddoa i gsel 
acMa iddynteu huiuiii. yn ireU na't tb:A hyn.— Sor. vi. «8. 

3. *m. manure ; a fertilizing substance. — S. IF. 

Hyn a bair oerddor yn deby^ i Irapiwr yn impio afallm i 

a rwrtait^ me ar^drinaeth Vt pren. 

CyfTviadi f Brirdd, 14. 

Achlet&t, -oedd, feydd, »/. an asylum, shelter, 

Achleaiad, -an, tm. a cherishing, protecting, 
defending, or snccouring ; protection ; a ma- 
nuring. 

Achlesog, a. afibrding shelter, defence, or pro- 
tection; cherished, protected; containing 

AcUesol, a. sheltering, protective, defsnsiTS; 
fertilizing. 



,)glc 



Achlemi, v. t. to take into one's care and pro- 
tection ; to protect or defend ; to choriah ; to 
harbour or anelter. 



2. to manure ; to fertilize. 
Achtnu tir, to manure land.— S. IF. 

Tr oedd bHgad yn dilyn hwnmonielli, »P ra nrW-ra m tir 
t nuu-l > thywod y mla.—Thn'. JTiviM.- D.P.O, i, (158|. 
OfernrAl^iu pren cHn.— PHn- K'i/Itaiu.- SBnn. vi, 

Achleswr, wyr, \ am. a protector, defender, or 
Achlesydd, -ion, ] cberisner; amanurer. 

I^m Raffo dryiriotij el ffordd yn rhyd^ njdoefl UD dnfferUi 
Tnornuxld iVarUtufrmtliddimieiiiclioaion ymmlaai, 

Acblin, -au, »f. lineage, genealogy. 

Diben yi Etenplwr yn cyfBosoddi jr mAljn hon ydoedd 

cofrwtfiL y fvif nanu 711 nuryniu] yr oLyDwcth freniuoL- 

bioi SlKarii : Bip. B (cT, I}. 

Acbliw, f . to reproach, to taunt, to upbraid. 

Bcdsv ei butonaliut, u acMiii iddi ei hunmaoedd I't 
■yml duo^yd. — Jolo Jfu. 173. 

AcUod, sm. disgrace, ahame, dispraise. 
Achlod iti ! shame upon thee ! 

Yr wyf yn flymd msl Uwynogod hmBel, cyftTryaddrwir, 



dJchcUnr ydynt ; and yr acUoS Iddynt ! 1 
17* y btm.—ajv. Oitam, WD (cf, Sttj, 188) 

AcUud, -ion, em. [of. ymachlud] a covert, cover. 
or concealment. — P. 

Cant H dan y'n^Tsa yWhrair acAltut 

Cnud ■ cbniid A fud ymdaAadud. — l^waleAmaii If. A- 107. 
Printed a chlud in the following extract, if 
the same word is intended : 



Achludo, V. [cf. ymarhlud, ymaekludo: L. 
ocfludol to cover with darkness ; to obscure or 
conoeaL— P. 
A (Jiymixl Cymn 1 rwyr Dulyn 
Giryddyl Iwerddou Moo 1. Fhij-dyn 
Camyw achiudw^t m oynnwyH gaihyn. 

GnltAUn! ILA. i. IK. 

1[ The reading as well as the meaning is 
doubtful ; and a Chladieyt (=and the people 
on the Clud or Clyde) has with consiocrHblc 



Achludol, a. concealing; obscuring; darkening. 

Tn tMi taaa Ufni birynil yn Mtyn 
Ba bedyn itcUiidoi 
Drofly diunOH uiddBWl, 
A btyii, a dyffrya, a dAl. — /. Q. Ottrien^/dd: G«ir. Al. 

Achludd, -ion, na. 1. that which is hidden or 
concealed ; concealment ; obscuration, occul- 
tation. 

Dynrydet y yeirt nnv achlut Einnmi. 

(7»WiWkp7iLa. 1. 138 [of. W7. 2S8|. 
Cyf HT a da«aT dygnfd ei tuMudd 
Am Hnffydd di^dd deivr hyd arffed. 

Dafldd BnfFa4: M^. i. SM (cf. Sll]. 
Trymfryd byd bod yn athludd 
•KawB mswi Usdawg mab Gn*ndd, 

Mnitm Vim: H.A, i. SS4. 
Betrawd (m daerawd pab dearut prydna 
Frydenmyn achlul, 

UgtearchiiiLliitcrlyn: 1I.A, 1.897. 

2. obstruction, impediment, hindrance, stop- 
page; — ■-^--- 



Bae n«nant jrelyn kyUund. 

AcMudd, ) 1^. 1. [a-|-cluddo, cluddio] to hide, 
Achluddo, j conceel, or obscure. — D, 
2. [ach-(-lluddio] to obstruct, impede, or hinder; 
to retard. 

Oibd Daw . . . yn cbwni 

Eu nylvi, Hot. i Uwr i edrych ar 

At dmu nW, ac o watwaru eo 
Tafodau doda fuaryw_y«pryd w 
Sili'U cu hiattb gyneai.— V. o. p^fh/ : C.Q. ilL M. 

Achluddol, a. 1. hiding, concealing, obscuring. 
2. obstructive, impedimental. 
Achluddiwr, wyr, am. 1. a concealer or faider. 
2. one that obstructs or hinders; an obstructer. 
Achluat, am. a hearing ; a whisper, indmation, 
or inkling. 

Tt wyT wedi dyred rbyv aeJUuf a> hanea. — Bnttwa, 
Achlwm, c. [clwm, cwlwm] to tie; to knot. 

ArMwm yt tdaf, to tie the thread. 
AcUwyr, a. [Uwyr] complete; total; entire. 

Ei]g«tTann achlaa a chldd goeludn 

Eivon oA Gwfvn -■ M.A. sn. 

Achlyd, a. [dyd] sheltered; warm; comfort- 
able— O.K. 

Achljranr, -on, -au, *m. [clysur? cf. goglt/tur} 
occasion ; inddential cftuse ; opportunity, sea- 
son ; motive. 



Emwyth y*yd yn *Hnr ( 
Yd endBwia oiau yn oeJUi 

Cymmeryd achlygur, 1 



OMtlc*>u>*.* M.A. L les. 
. take occasion.— flAu/. 



A hyn a ta yn oeMf or i dwyllo'r byd.— DorU. i 
A'r cydlHDBcb a fydd rhynaom . . ■ ■ rrdd i 
toddion ao iidUirninu. 1 ddial £ Uid ar en nlydd. 
Zona Tomai: Bucfa. Q 
Mot tynyeh sg j ayllaf ai arhl^mntu y rhyfel. 
OarHAMOnawt: Han. 

AchlTaurind, -au, «m. 



Crybvrllir yn fynych am yr amgylebiad, and ni mdir 
bytb gymr am ei acUywriad. 

CantAuHdiDC .- Han. Cym. 78S- 

AcUyauro, v. to occasion; to cause incident- 
ally ; to get or make an occasion ; to cause. 

YgIali>anrMfld,ynainKr Pllnlu, yn effdtUd i oel- 
IgtHntur Uwywliant I'r hwn a'i gwaati, 

Car^i.ama^: Han. Cym. as. 

Acblyaurol, a. occasional; incidentaL 
Yn aehlgiurol, occasionally ; at times. 



Acbljraurwr, wyr, am. 1 



B who occasions; an 



Achlyw, em. [clyw] 1. a hearing. 2. the sense 

of feelmg anything. — Bht/« Qoth ab Shicert. 
Achlyw, a. that is heard ; audible. 
Oair achlyw, an audible word or exproBsion. 
Ar air achlyw, by word of mouth ; viva voce. 
- — Beirdd Mnrgamog. 



Acho^4dia«tli, -an, «/. th« sdenoe of re- 
cording genealogies; heraldry (bo tar oa it 
regards pedigrees). 

Kid yw ci hrwiud . , . ja dangug itr* l>«s a jt- 
tvythd^ ftwaikyddal : ond y qua jt ofA^/yti^etA, dvc Jn 

Achol^ddol, a. relating to the art, nnctice, or 
•dosoe of recording genealogiea ; neraldio. 

Achog, a. bsTing a pedigree or lineage ; having 
many relatirea. 

To bjir ar ffruDrdd rinmg ei ffcnd, 

O Lwytfa boiuddigkaii acliof OAhflL— iWfp Ttmttu^ 

AaIioI, a. genealogical. 

A hnjiit-hiiy, 1 al ohiriUo yn llTftH ochniil Crnini, 
t ddrdkweUmnt gyda ohy^n nobiAd o fonedd Henri, 

AchoU, -ion, *n>. [coll] a loss ; waste. 
Jfjnud ar acholl, to be lost — Meddygon Mydd- 
fai, iL 680. 

Achon, am. pomp; a \)fiag lifted np. — P. 
Fonnd. once only, in a Te^ obwnire and cor- 
inpt poem in the Book of Aneurin. It may 
be an adj. denoting high or uplifted. 

I>7wDd tnah tn muwa. 
Duelvirnar u kn^m tel <vA«m. 

aartJm MaMtrw: A.B. U. K. 
The 'Hyr. Arch.' (L 61) reads 'talachon.' 
Acfaor, a. [cdr] endrded, aarronnded; ohoraL 



Zl^tKff FimU: M.A. i. S 



Vf diablaf or atf ynr » 
BugetbjT gadw Oadiiu hkti 

[Ueinid Kenn) 
Afi bailcdiwBWT n bVT TO deiwiilt 
Ae balchBor bBb oator tcfaunlmt 
A* baloli iJiarnt ae luff flinant. 

CfKidtHi: 1L.JL. L >M (of. lOG). 

■OorchaiiMaalderw'(J.£. U.98; X.A.i.i\) 
has ' talachor,' without Tariauta : 
Oixdfblsa CDSlt HJadhar. 

f Danes derives the word from aeh and ft-, 
and ftiigilga it ngnifies small and slender. 



meaning, if not in the 
origin, there seems to be a fumon of txcatio, 
eauaa, caatu, and tuxvto. Cf. AcJiun/t. O. Ir. 
oecuM, accttia] 1. a caiue; that which pto- 
dnces an effect. 

HfAcgl jwnc Idaw yr wkmn yd oed i 



JcAo* ac efaith, eanse and effeot. 
AiocAm, whatoauae; for what cause or reason; 
why (rdatiTely) ; why (interrogatiTely).^ 
Mabiwgion, i 289 ; iL 391. 
Fy «A«H tyby^mU- yb«i wall nudn Twcrrdon. no mdii 
Tin Piyddn pas doynt y ^ymhel] kensdyl Imidoii y 
yniad yn so hnbyn o ocAim y keni; hynny. 

Fa ^^H« TjUDn a byd amat ty oryn OraCyan ! 



2. a case; matter; occasion; circumstance; op- 
portunity ; reason ; that which one haa to do 
with another ; account ; sake, 
liawer trjhof tywylL ab yr angel, ay rbwng y tri pben 
eyfmy^rjf hyn a'u gilydd.— jEIm »>■■.- BaTddCw«,K. 



Ar yr athoi, on the oocaaian ; for the purpose. 
Sr qaa rwn or ba ocAof yr yatirytbvyd y weddl, 

am. Owdi, mt. 
Br acho», for the purpose of ; for the sake of. 

Efe a roddaa Ddoiparth Tudnr Alsd. a, dretnvyd gan y 
bardd rbagoml bwnir, ir <ic*Mtm Eiileddtod syDUl Owe 
wv^—loh Xertantci (Cyfr. y Belrdd, UhagdiCT). 



3. a eauso, case, charge, or aocuaation. 

OoaodaMnt hefyd nvoh ei ben tS fi aehaa yn yigiifen- 
Mg.^Mau. iiTtC 87. 
Bte • gafodd mAoiim yn fy erbyn.— ft* itrriii. 10. 

4. (pf. -ion, -iaid) a ease or infleotaon (in giam- 



Fa BWl pelh a ddHmminla ar benw I Cbwe pfaetb ; nld 

tjagaa, aiuawdd. cymhalrikd, eaaedl, rblf, ffagr, ac aiSat. 

FtoA tlt/r CrrMvTiarlh, (8. 

Mo. Peaairl adat ayddl Or. Chmcb . . . ayrttiiad ne 
(Ulmi.—Uniff/M Roitrut Onin. 9B. 

AeJua neu ddii^ynta enir, DMurn loryv ieiOioedd, yw al 
■iUimjidI derf^niad . . . athr yi ■ ■ - - 



ojtbr yn yr iaith Chyioneff . . . 
XI tnry gynnotthwy arddodkdau. 



NI ddylid Unnio aiABtiim newyddltm i nnrhyw Uth, 
at mwyn afelyohn avill a*!! meddant. 

Itaae Joii£i ! Qism. Cym. in. \. 4. 



Oalw AtthDt ar Oyndelic KyfnrHyd. Doa dl yr ncgea 
boim syt ar qnbenrj. a^ltfoBt nyt o«1 wacth kyfarvyd yay 
vUt nj^rywelaeieiryDetDocyay vlat^him. GaJnOwrbyr 
QTraUlawl ledlhoad. »-» >■-" '-"■.—« j— ■ 

Dt nfudd i'm cytniCh.— £iyr "f 
cAof gwenfnn. 
Kliyt Qitck at Bhiarl: lolo Mas. KB. 

Achosedigol, a. causativQ ; effectuating, efFeo- 

Acliosi, t>. to cause; to effect; to produce; to 

oocasion. 
Acbosiad, -an, «nt. the act of cAualng; cauaa- 

Achoeio, v.^Aehoti; the latter being the oom- 
[loner though later form. 

Owelwdi gan byiy rd y dehydd yn lie y peth a ikAw. 
far^ o'r defUydd.— ffnri ArW.- £«■. Fit. IS. JM. zll}. 



Acliosioff, ) a. that is caused or effected; caused, 
Acboaog, ) effected, produced. 



A CHUB 



UnriPrrri: Egl. Ffr. iv. 

Acbosol, a. causal, causative. 

Tri achiunHon pgb pvtb gyntcOgiieth ; sBghoi ; dewii ; 
& ijK'wJid.—llgv, Arch. iii. nt. 

AoluMold«b, «nt. causality; effectiTeness. 
AclioBwr, wjT, I »m. a causer ; be who causes 
Acbosydd, -ion, ) or effects. 

PurwyiUiid, neu ferf, rw pob g«ir ■ »rwyddoc«o 
^wneuuur, bod, mm ddioddef , n un bynDS^ u ijn, peth, 
aeq ryw buuul % fyddo f peirlod, itea yr of An^v*'*'- 

/i. ydiu; Oimm. Cym. in. W, 1. 

Acbrain, a. [crain] prostrate ; groTelling. 

O'r mflt g-loBw y mwr > glrvsot, 
AcMrain wyr, edirynu ir**"* 



'Acbretb, -au, «fn. [creth] t. a trembling, 
I qualdnK, or shivering; a shiver, ti«mor, or 

trepidation. 
Arhivth y cTi/d, a fit o( the ague. 

QuiyB pm jtlprer yn jrr maid f cyfiT* «*r«* u luui. 
yna y cue pluit Duw yn ffo*od yo «u hmyn, mesym i doriV 
gmrm, mtrnM gwWoimld Duw. 

Ao&>M Llwtd- LtwyhT HrToldd, tlO. 

At ucha' bun wwt o diwys. — Simicni Fj/cham. 

2. nature ; disposition ; inclination. 



Achraitb, eithi 

cicatrice. — P. 
Acbre, -on, tf. a covering; 

Bnidd itr4rr / bu oet ddychryo, 
\c wyUtr loHt. ffwcled hya ; 



DaJjlU Bt*icsm, Vt CyflegT. 

>/. a great scar; a scar 01 



<m«i: Oiniilh.71. 
[a-|-cre : cf. dechreu] origin ; begin- 



'-' TJuuTorU*. 



ttfhrtd, he said npon his 



ning 

Acirr, {DlUoia, otiga ; 

Achf A, adv.^Eckre. 

Acbreawdr, rnn. [creawdr] a creator or maker 

Arall aCuyn achrtavdr ooivbiiTdd- 

TVifww.* fa.A. i. M let. A.B. il. 117). 

Achred, -ion. >/. [crod] belief; faith; credi 
bility; oath. 

Ft ddytatdodd ar r 
oath. — -QmcrU. 
Achref, a. [cref-u] suppliant; craving; en- 
treating. 
AflrrUod kvvadrftud krv^divf IndflU 
Clf<lyT wdeu kat voaef 
Ny Oiulyee bad beird K^Kr-f 
Ny tbolyir punt ffuMi ef . 

Cyo^Mv: M.A. I. MO (ef. 227). 
FyKyglln byddio bnd ocAn/ kerdtu 
Korddwya hoel yn tuigiief . 

Achr«fl&d, -au, »w. supplication. — P. 
Achrefol, a. craving, BupplicatiDg, suppliant. 

—P. 
Achi«fU, 11. to crave, to supplicate.— P. 
Achrefnrr, wyr, am. one vrho supplicates or 

craves ; a supplicant. — P. 
Acbres, -au, s/. [ach--f-rhesjaroworr&nk. — P. 
AcbroB, i -au,-i,«/.apedigreeroU;apedigree 
Achraatr, j or lineage. 

llesindemla 

idliDSLUd. 

mvy havdd y piyd hyuy i ddyn ffurflo 
lo ei hun, nag ydyw yn »wr iddo Surlto 

— juvl i dinwdd uu btkU. . . An effeithlod 

nrn ydyw, fod nn y Cymry eto or ^Lawt fwy d . 
tL-l,i., ^ 'ga^ un genedJ .5»U pwj byu 



hyny^w, fi 
tylwiuiol m 



1 pwj bynnag. 

irc; Hu.0-m.7Sa. 

y pedBir Ef engyl. 
z>wq Eduvnl* : Esp. 6. 



Cnawdm- cmTudaiil ei 



Sffii 



doetbion u ddiurebion, 



Acbretor, -ion, «7n. 
pledges or gives I 

Ota diTuner Uythar U«nr 

Otjfd t ctuvTjd yt iulirtiu.r.—Crtidddw: H.A. i. M 

2. a creditor ; one who gives credit. 
Acbr«twr, -wjT, am. a creditor. 

ef [U™l<«on] yo »mrt»d mewn dy1«d ; 






n, duLfonu hvy ymAlth bi 

" 'v. 17). 



Acbiis, -iau, tm. a covering. — P. 

Acbrwni, m. 1 a. [crwm] crooked, bent; bow- 

Achrom, /. j ing ; stooping. 

Twm oihrv™ a glwm ei glos. — Qr^nwg OieoM, 1S7. 

Ma« dliau, ocbTKU aeXrvm, 

Fob muigre, > Us yn llinn.— JIUf. PatBtl: Tym. M. 

Achrwfdd, a. [rhwydd] easj; free; com- 



Achrwya, -au, am. [rhwys: L. occreaeo] in- 
crease; plenty, abundance; fruitfulness. 

'Ovaid-m^: H.A. L Ka. 

Achiyd, -iau, sm. [dyd] the ague; tremor. 

Adiryi iryt, ni obci dir dn.— (?n(ftiH BiratlJtog, 

Achxydial, ) u. to shiver; to tremble; to 
Acbiydian, | quake. 

Acbi^ad, -au, wr. [erjf] a strengthening or 
invigorating; strength. 

Brwydyr &af?i?n bnryK nmn breJH Adef 
BralDborlbrndiicAriuiaitaahief.— CVwUflw; H-A.Llt7. 

Adiu, V. a doubtful fram. See Aeh^. 
Acbub, V. [L. ocr.upo] I. to seLse; to seiie 

upon; to take possession of; to seonre; to 

snatoh ; to intercept. 

Actnbei givuvhatwei Dot. — Ameuriit: Qod. ftH. 

T haHwyd ysyd yn bryaaio a gogofui a adtj/b j dialo 
wonn,— flrul tynlio: M.A.ii.KS. 

Y gogonm hi a dfAut y dreio wen yr boa a arwydoocaa y 
auMn.— Aral 0r. eI> ArOitr (B) 1 H.A. 11. Ml, 

BobeitaaatiihiinlpedwuaiateU . . . BcnvUa adubavi 
PmuTO e hun. — Brvi t T^ytoyion, SS. 



Dfnu ddan ddj^yo bach o'r bjrd iftod yu d oddlwc*, 
KTB scAiAf bvl oddi una. 

JcAud yr mlfg, to seize or embrace the op- 
pettnnit^ ; to redeem the time ; to be in time. 

Achub y blaen, to get foremost; to go before; 
to precede ; to anticipate. 

Ad^iritt ei fluB ef i benditliiofi duonj.— Ai<>ii. xxi. 3. 



2. to occapy. 

Ac ya oiKf oil ChBil] 
^ boll dsFU 



irniBea kt looed. s BoUst rn mJinJ 
Rwinw h^d Tm mrnrd jmdeilli Qri 



Fibrl at!befrjrwy« ywch j ymlAd. n 



3. to rescQo ; to save ; to deliver ; to defend ; to 
invtect. Now the more oenal meaning. 

A-*<amiM ng lln Uhnd.- 
<kdT tj eniiid. ixs •kXbIi 



O bydd De^TT bsffoq y nub ie 



mu y tyddynnen 
, itlilr byim elliiyT 
u. cM^ uuHv (M J dyddyn breuiyiivl «f cyt boet negyf o 
BUmD ta.—Ci/rrUiiaa C^mni. tL em. 

Kjt lioMd aixaa,-jli acluJinm.—TaJiai' : A.B. li. 149. 

Nydyleyr acAr7> ar tyr Icyt kasys pop 11« Adyleyr y ibot 
vitl^ y tri lie xcypyn m derv acbfnic a ray fmiy ny- 
dyljryr a€^rp AmTnt vytb luc td 11b ony byd oe^ef y mayb 
y™f TMIV y Ij? bahytboyt nflffflf n^yfydr achvp mr y- 
dydynbnynyawlet.— Ci!/v«Mu4ii Cfivn, iL ?ro. 

2. anving; salvstioa; deliverance. 
Achabaid, v.^Achub, Aehubo. 

d. AAitbeii vn llof^ea aorric rue ka^el uiuidynt dyo^lvob 
aen undifyn o ' 




Acbubedigol, a. that savesordeUvers; saving, 

delivering. — ■ W. 
Achubiad, -an, on. a saving, rescuing, or de- 

livmng; deliverance; rescne. 

Ftnif Oweddi gyd 1 dloleb . . . ara ddalwyUol adnOlad 
J Bniiin Iigo I. ■ tbab yatld Llowr. 

Uc/r OtotJdi Ol/Jfrtdin. 

Aclnibia4, iaid, *m, one who saves or delivers; 



HvOynoA 






An bwynsynt inr Bledynt bldnted 

Aosorf tcnf toiVo oat^Mod.— fftfa^etavu; U.A. i. ] 

Uodmumim . . . 

JcHMnr po6 rtidd rbat m harrm 
Bclicdiry£t tvg tarryn ni terryiuD. 

OtannOg/Muif: M.A. L 
IMth mysycA obsfth mwyn tulnital. 

Canadfy ; H.A. 1. 



ACHVAKTH 

Acbubifteth, -so, >/. salvation; deliveranoe; 
a saving or securing. 
Achabianlh y byd, the salvation or redemption 

of the world. 
IfeddyliWFb yo lobr un y anlyniod uBWydiu d lod heb 

acitMaetl>.~Iot. Harrit: OveiUL 4S(. 

AchubiedTdd, -ion, tm. one that saves, de- 

livOTS, or rescues ; a saviour.— IT.. 
Aehubo, v.=^Ai:hub, Achvhaid. 



fodd y dyn y ooltwyn. — Dt^fjfdd ab thoHfm^ olxrll. 37. 
Achubol, a. that saves or delivers ; saving, de- 
livering. 
Ffydd achubol, saving faith ; faith that saves. 
Qwybyddwoh van byiiy fod dwy fath o ffydd ; sef, ffydd 
neniduo) as achAal: h ffydd Kyffnidiiiol ao anacbubal.— Y 
sue ffydd aoJl.ie/.-«HB As'Tpf {m»], SO. 

Da fyddai iddynt yatyHed, y ^aJlol a 
aehaboi fod yn rby brin ya nydd y CYtiil. 



Acbubwr, wyr, 
Admbfdd, -ion, 

Bhoddaiat iddynt iCj&irfrH|T, y rbai a*a huAubaaaiit o lav 



Owaeddasant, ond nid oedd aehnbydd. — 8alm, xrliJ. 41. 
BcndigedJg vyt ti, O AcAabur Imel.— 1 Jfw. iT. SO. 
I)&as» iy ryfedd drngueddan. O Aetuiiidil y rtutl ■ 
ymddviedant ynot. — 8nJm. xrii. 7. 
Pan yinddaxigqandd dainu a Aariad Dow edn HathuSier 

Acbubwriaatb, -an, ■/. the office of a saviour ; 

salvation. 
Achudd, -ion, tm. [oudd] a seduded place; 
rotiremout ; privacy, secrecy, seclusion. 

Achudd, enoUiad nea ym^ndd riatg y byd ; meadwyuth 
neu ddldryfaeth.— /^ Jtorganwff. 
Mynachca iryd mewn xtAiuU,—D. lAcfd. 
Yd yiBitfaDD. ba bndd, 
Bi tnchedd ef d1 aehiidd. 

Into Qach, Cyvydd Dirwl Bant. 

Achudd, a. hidden, concealed, secluded. 
Achul, a. [cul] lean; thin; meagre; poorly; 
squalid; narrow, 

Odyoa Icycbwyn aorne Fendor ac ym pell odyno ef a 
jyferuyd marcbogea ac ef. amaich ac*iJ goohwyii y dUncd. 

Uobel Foddaf iryf nhul raddian. 

ar.abMtrrdydd: M.A. I. 45] (of. 4fil). 
Oafaa y eletrlacb ncAul 
I^ nghytrnT p«oh, a'm mardi mnl.— J^aAi^ Stt/nu. 

AcbuT, -iau, ma. [our] a disease ; pain. — P. 
Achwaad, -au am. [aoh-t-gwaed] progeny; 
descent; kindred. 

lodd 

ifdr Firdd : ita Aven, BS. 

Achwaan, adv. [chwaen] presenily, anon; by 

chance, perhaps. 
Achwaetb, »m. [chwaeth] sourness, tartneat; 

gtaleuess, insipidity. 



,)glc 



AOBWAIR S 

AcbwtUn, einiati, if. [chwaen : of. damvxtin, 
aiackwaen, dMmmin\ acddent, inciclent ; oon- 
tingenoy. 

Smdl cut ^nnot ■ diadernTd gwlr u hrnr, dod«d 
unrot drefna dofpuCluu dAkmiu uvUd KObanHLuu 
(of % pwybodmu, so v bab arXaaii aeaiAnA.—Iolt Mti. to. 
AchwUnt f aI A^ 7 bo cytlwrw yr Tnudrodd vn frofroi 
faJ, Tiijf ngherdded celfr^drd UICIl, j daugodr pob ocAwof* 
71k 7 Ua cjmwn drffwyadudol, — Uaiutvw Ma, 46. 

AdiwanefT, a. [ohwaueg] more ; gre«ter (in 

JuantiW, quality, degree, or number); ad- 
itioiuu. 

Dpndwyt WTthur ut oad r^ 7 m kTToet ae «f on 

n 3 I gjt « **. IB thsulu ooUmmc J on gur 

il. IBS <cf. »>, aia). 

ia ClutrUi, ooL on. 



Owimdeirch ohwi melDt ti«h& nrdty , 
Tmi trwT T UyUiTr. in oMhuc diAoiiiiiirmt T eeoiikt. 

f^mi/taii Cliiriymafn, \ 90. 
Fn acAuiiiTieir i, in addition to ; more thuk. 

mething added 
aaoiuon. 
Adlwanegitid, -au, »m. addition; augmenta- 

tioQ ; a supplement. 
Achwanegol, a. additional, additive; aug- 
mentative; supplemental. 

to add; to augment; to 
o multipfy. 
Lo WTth brnny jd adtwavtMir Aj env di waitblon. 



Beiat Antia m dywett am eoelteii 7 ni metrw 7 bat a 
■ffben byt dyd br&wt ftui athteanrixait udunt jt hynik h 
gymenint megyB 7 bo teUwR udont.— Ainliin Padri}. )S. 

A pba gedcnyt ■ ryd 7iiten. u > iic*ii>ima:a yw ym- 
adraa70D- — Camp^u C^nniTfuuun, t84. 

Aohwaoeg'WT, w^, ) •>». one who adds, ang- 
Acliwtuiegydd, -ion, j menta, or inoreaaea ; an 

angmenter. 
Achwaat, -aa, «m. [chvant] avidity; strong 

deaire; longing. — Llanourr M». 
Aohwadl, 1 -au, tf-m. [chwedl] a story, tale, 
Aoltweddl, f or report. 

At bad Gniffut cot con diuiod angbflo 
Yng adiaxddtl 7 glybod. 

OlecUjri Far4i: M.A. I. BTl. 
t«tliro gn a glrbn fflod, 
Hvyn ofAuMQ am lim uohod. 

A*- fanM.- HO Amo, IV7. 

Achwadd,' -au, »/. [ach-l-gwedd] a d«eoent, 

pedigree, or lineage ; kindred. 

Kyuetacb Uoru^ OAwnit onudul 

Or a.:Ai«i oreu dpyniet 

Nenm bu oe a^ad mvjmdyad met 

Ny bn OBrfliwd belrt oe ^ynet. 

GVa/jnM oi OnvaMB .- U.A. I. 3T1. 
Kb diytatttncih na« adamid. 

D. Lht^ahU. <a Ongfid. 
Actnnadait mawrwycb oeddynt 
Yn 7 Bewpoi hoBV-bur hynt, 

L«tU HoptUi 1IB1-O»(od, US. 

Achwedd, I. the same aa Ethwydd (q.v.), the 
evening. In ' Barddaa,* i, 420, both fonus 



AoHwmn, 



occur a* d«aotin£ different parts of the natnni 
day, this being Uie fifth, and that the seventh 
of the eight divisions; hut at p. 422 it ia 
equated with rth taydd, and is stated to signi^ 
the last of the four parta into which the day 
ia there divided, comprising the six houn 
next preceding the morning, 
ftdwar riiao dydd: Bon, aet y dimdi-ainr erntat; 

AulBrth. TT afl Amob-aiR ; Naini,7B7d*ddeliindi-awr; 

as 7D bsdwerydd, yr ArJuordd (Ecbvydd) 711 aatys bTd y 

bo».-^flo«WM, 1. 433 (ef. «0). 



B, dw7 qcitiev' y lydd mi. C. tAir adaeet 7 aydd a 
D, itn ocjUkI a lU^ aniL— Uwwr Mt. W. 
Llj/thyren achurei, a mutable letter. 

O, ll7lb7Tai acllKitl 7*.— UojUHT M: U. 

AclLweliad, -ao, tm. 1. change, mntation. 

Bonier bellacb am 7 c7dadiiiaid a'n liatlivdiadaa. 

2, {pi. iaid) a mutable or mntate letter. 



Adiweliodol, a. relatiug to mutation; mutable; 



Cydatiniaid achwdiadol, mutable conaouanta. 
: jng i^faintal 

Achwelyd, (I. to retnm; to revert; tochan^; 
to decline. 

I«b7d i gleb nid ae»ml.—Diartt. 

Ym mbob gair midll, amgsi ydc^-aill byn, yn, 7ng. Tm, 
711 fyddatKin, IM'dd oedd 711 7r miaill yn eglunau). 



Ach.werig', a. [d ehiearian, chwareu] alow, 
dilatory. — Henri Saiabury. 

A^KVrlg, hwyr; anhattiH,— gtWu^y* I^- Oy a nat. 

Achwaryd, *m. diversion, amnaement. — P. 



1[ The raadinjg of the ' Myv. Arch.' (i, 216) in 
thia paasage is echivg^^ahumg. 
Acbwir, a. [gwir] true ; truthful. 

Y dTlwet (<M_wt 

Dyrllydin] i winwt 

Kyn bydim i mniL—PkfUp BrytltH: M.A. L STT. 



Lcnvlwm, a. « 
perplexed. — i>. 



a. entangled; knotted; intricate; 



Jm V_.(,K)t;iL" 



AdHWS S 

f There is evidently b mispriiit ; bnt wliether 
we sliaiild read ' ao achwmwl ' or ' a ohvmwl ' 
is not apparent The so-called reprint of 
1821 here, Ba frequently in other passages, 
doM not faithfully reproduce the original edi- 
tion of 1588. 



Bjdded galennl, hrtal Saw, a ahnl 
MwTfnwl mwl, ; Uoei o WIad, Wr 
,d y dwfEL mo odd 
;fiDdalthuw trwT 



»1,7 — 

Ednjivd taiddu odd y di 
Ei diTTT ernhoild i jniSa 
Avrmrl dndd decbnuai, 



AcliWT, -wjr, am. one sldlled in pedigrees 
genealogies ; a genealogist ; a herald, 
^ydyddioa, odnBifT, a Ihiuiwtt oedd vbalrdd. 



AchvTaIn, c 
stilling F 



(2 HyD.) quieting, sappressing, 



Arwydd u elwir td elam 
Aidddmim brddgant on 

OnUod Dl Urinid rn m» 
Vrth oTwr ulwy mriw 



Lteyrudd. 

UiroHfiL FarM: ILA. L »6. 

Achwre, -an, «m. [i-q. ocA/re] ^ shelter, fence, 
screen, or goard. In tiie Welsh Laws, an 
encloanre of wattles or thorns surrounding 
a boilding at sach a distance as to prevent 
catUe reAching and daoiaging it. 

Artoj 



I AdHYSDUXTB 

Achwynedigolid. oomplaining; expostulatory. 
Aohwyngar, a. (n-g) given to complaining; 

apt to complain ; queroloos ; complaining. 
"Stix uiiuddH g-mKis : bod jn Bhmdlnwu ; bod jn 

OdtKrifcB-; mbodrak^TDdsu.— JTrx. JkA.111.U0. 

Achwyng^rwoh, «m. qnendoasneM ; dispon- 
taon to oomplain. 



Athwymadaa, complaints. 
Achwynimetli, -au, «/. a com^aint or aconsa- 

BwT ■ f eddrilMiat jn kddu I Tniirelea k Sibatai. nn 
InieTa «i haekvrnio^ 1 uiarjw o'r luddffwon ar d ddyfbd- 
tad at.— IT. £»».' I>W7 Dkftb, ISS. 

Nam si ST rmddlheuni oddl mth irw fml uufu u 
■ ' dr KUXodieion 



■Uui o rjw aibTdrvrdd. 



T betAQ yn J marra JB bydtui me hulflWT 

T niBe BuHUit STberr ran j oat Bnn nhl oc* 

T mme €hnrai ¥cnih Eoua j mme Uedm m IJ] 



'H.I. 



T> brcbcn it hMlewT. 
■- ' . tBTcii Hem 

Achwyddo, v. [cwyddo] to fall; to fail 

A GFlmmcmn me wtwTi nr glmi uynrt 
DwTtelsod imctilil omvd nj ackagl. 

Qwr^r^ BridtrMof .- If. A. L ITl. 
Achiryn, -ion, rat. [cwyn] a oomplaint ; an 
accusation i a plaint. 
Adwjpt gwn til hrwrn brenhlnedd. 



AAwi m main-, odtin'ymoddl— Oro. Oiimm, «. 
Anmn o rennn j gwalmf fl mnTon canhmnir, beb hTipym 
IwfTd rr octoviriBa m frddo jrn al obrn et.— jIM. xet. ST. 



AcbWTII, I 






Ai'ani. (H.A. UL Itf.) 
Hid oeiUiriw tt*iq« mi r ChpehrrirRliTir Ewb, 

Yr Tcli llcg id fedr oaheim. — JfiT. ^fcA. I. U. 
Rhmg tad aaoowlal ji a£ib«p|ih j plmnt. — Ec^ ^L T. 

Achwynsdigaath, -an, «/. the act of complain- 
ing or aocnsing ; aooasatioo ; expostulation. 



■jJoi. itajd.- Uirybr Hytfonid, IBS. 
Achwyno, v.^jlcAtryn. 
Adiwynog, i. full of complaint ; complaining. 

Tr oehtogTutg, tiie oomplainant or pJtuntiff, 
Achvynol, a. complaining; plaintive. 
Achwynwr, wjrr, ) »m, a oomplainant, a com- 
Acbwynydd, -ion, j plainer ; a plaintiff. 

Oer jir^m nmd (nan m ohlin aekvt*ydd. 

Korgan ChT^ftM. 

Aohwynyddea, -an, »/. a female complainant 

or putintiff. — Newyddiaduri/n. 
Aehwya, -on, *ni.=LjlcAo<. 

OdwT^t ai NaHOn 

iwiwDi,- A.B. U8 (ef. lOB. 18^ SOS). 
Nl ha wyf lawca o law aobBWm 

O QcS»,Kn pn^a.—Uri^ti FarM .- M.A. I. SH. 
A ffw«dj tae vedylyaw or eawb jn fynnll j udvf «™ ef 
heb lodi manr al bliaiT T oedl aomc. 

Brvi g TrvtKfiB^ loe. 

T drrdedd uf THrdd . . . td UaVD o bmnrdd dmmnn- 
edlc ac*miiittim perigJorjoa. m ywyiTfon.— /j>i*i«, 1 8. 

Aohwyaol, a. causal, causative; incentive. — 
Dr. I. h. Bhyt: Oram. 108. 

Wfth petb yn atAwjitatti a cnuyimmAt odineb neo mnnt- 
irrirdA.— rntfK* yr .ffiuid, ) B. 

Adtydd, -ion, *m. a genealogist ; one ddUed in 
pedigrees ; a herald! 

Oenweh adioedd drwy help aiwrdifedldd ag scAf iMioi. 
Dr. I. D. Rhpi. 
aa hystfried 
Oirmal, L M. 

Achyddiaetti, -an, »/. the knowledge or science 
of genealogy; genealogy; heraldry (so far as 
it treats of genealogy). 

Ommeth Llywelfii Sloii iTfT m enirodd et 'Adgoflon Owr- > 
bodmn JT bcD Qjmrr : met eyhnrvddyd »r BtmyddlaMh, 
AdiasUtaili. Oiaedyddimeth. HeddyBinlaeth, TteRiiTdd- 
iaetb, DeddiyddlaetL CelfyddiiKitb, a HanllUaeth, yr ban 
Gyiory.' — 3vti Braifford : Cyfr. y fieiidd^ Rluigdd. \i, 
T riieawnk, f el y ou^lmf , na soolr am dano. rw. Iddo f anr 
ant, ac feUy na bnenJ arybiryll i 
o ddibaa yr bmneeydd santKiud ] 



7T acJij/ddiaetA yn y CrooicL — loKph H 



A rwfr o eamn mfl rwaetb 
AdiKT^dmlyfractyiCUKM.— TVfM.- Ghraith, 184. 



ACBXBDOL S 

Achyddol, a. relating to genealogies or pedi- 
grees; goneologicol ; heraldic. 

OweUii iMIrer a d^eoi adi^Mat o nith BtniuDin 
Beaium.~lTa<iI, C.C, ixvi. 306. 

Achys, a. cruel, unfeeling ; desperate. — H. 

Salftbury. 

AcXj^tf difaol. oreulon, djtetbgti.—Odriii/r)n W- CutneaJ. 

AxUxyarvryiA, #m. cmelty, ferocity, savagenMa. 

Yr oadd efe td byv mr yi rqwl % ^fmnwrvit odd! ar 

J uwl H g^ducWnt i'r Brfnin OTturuv ftc AT gkreAif- 

rwydd y wtad ■ ddremt Iddo 711 Khlymumwl, Uij oient 

le gou vJi^arvj/ddi j rfaAKfrminoAdd. Hf drhinud t Cefu^ 

gam, — lote Morganwff {Brrthon. iii, 100}, 

Ad-, pz. [tat : Ir. ad, ath. aith ; C. at, ai ; Br. 
ad, as, az], a prefix or inseparable partide de- 
noting, 1. again, anew, back, repetition, re- 
iteration, restoration, having much the same 
force aa Lat. re-. Commonly followed by 
the soft sound, bat before t, generally before 
d, which is assimilated to it, and sometimes 
in otber positions, ad assumes the form at. 
In some worda it is nearly equivalent to dad- 
(q.T.). 

2, As what is not first or primary may not only 
be second or secondary, bnt seoond-rate or 
inferior, ad has in some words a depreciatiTe 
meaning, and in others it implies a transition 
into a more or less opposite state. Cf. L. re- 
in rtprobo, retriKlo, revdo. 

f As thisprefixcan, like r*- in English, be set 
before most verbs, and noons formed from 
them, it is hardly necessan to give all the 
words which are found with it, especially in 
modem writers. 



2. a pinioD, a wing. 



„ „__. llwyt. 

Ani<diel j ada/ 

Bidio un gic B garni.— Llgioarck Htn : A.B. IL tB*. 

Ad&£aal, -au, ttn. [gafael] an attaduncut; a 
distraining; eeisure. 

Dtth ffWftWT dKim U»vT ll«aB 
Mcut fH-m.—Or. all Mtrtifid: U.A. L 4M. 

Ada&elu' I '*■ ** **'**'' > **> s^'i'o ; to distrain. 
Adafedd, im.=^EiUi/edd. 

Ac o penn Tdwygva ath 
apheia ball meLyD am 7 ] 
adaufd gUfl. Adhlfdyf eaidm 



+Ad,con. [=od, os]if; 

Ad oefl neb djddanwch jng Nghriit. 



ethat. 



f.Stkibrrr! Fhfl. li.1. 

LliUiT«nt adamla [d <la>] am sdimiioBf. 

OBrtkaM JfMMtn. .- A.B. IL lOT (of. MA. i. SB). 

Adaddav, v. to promise again or anew. 
Adadeiladu, v. to rebuild, to build anew. 

Adaddawiad, -au, tm. a promising again. 
Adaddef, v. to re-acknowledge; to confess anew. 

El grmhwyl njntaf oedd . . . mTna ada4dtf si hamduf- 
iaelh M pen rr eKlw]r>.~fi. natxrU: Dmu. Ml. 

Adsddewid, -ion, «/. a promise made subse- 
quently to another promise ; a second promise. 

Adaertrch., am. [taer] entreaty ; importonity. — 
E. Lhwyd : Arch. Brit. 213. 

Ad&f, pi. eAyi, adafau, »f. [tataf] 1. a hand. 

H*l brwyn yt ^wydjnt rae j tulaf.^AntitTiK : Ood. fiOS- 
F7 ngirely a, wnaft mown gio a thiiTmo t; Jrrj abrf. 

UoHt OatvaUawn ar Davr 

Ueidyat ado./ ja adwT.— Utv'iirc* Bm : A.B. 178. 

Uiv tniTiinblrc fweaje e 

A4a/ hit yn herwyt e 

lAtfoarcIt ah Umf^if* ' H.A. i. 
Ue'r adaf ft nt o syrn. 



XlyuurvA ah Llyvrlgi, : ILA, L 



JJoBrijtgtiWttiigjrB.—Oiaf. Owiia, i OrUell Ooed. 



iLMl. 

Adafeddog, »/.=:Eda/eddog. 

t^m^ri ( "■ to re-open; to open again or 

Adaiorjid, i *°^- 

Adagoriact, -an, nn. a re-opening. 
Adagiynad addoidy, the re-opcoing of a place 
of worship. 

AdaU, eiliau, »/. [totaiV, Oif. Gl. ii. 42 (ZeuM. 
G.C. 1059): ad+ail, eilio : cf. L. oerfw] a build- 
ing, cdifioe, or structure ; a bouse. ' Its primary 
signification wag wattling rods, to wattle the 
roofs of houses ; and it is stUl used in that 

Flethaiiod 

FtrwTDft adaii dj ttrotmL-. 

MadefBiPitniit: ILA. L tfB. 
Mawi adail oTimail eniDTdd ffarrll. 

P^fd fimoa.- U.A. L ttl. 
Gawn nodi, men win adaO, 
Ovyrtli Duw mevn rhagomiUi dul. 

OrvtttBt OvaiM,%l, 
rr odaU elsd And ja rliwydd. 

Z,. JHff*!.- Oidd. Taol. lU. 

Adail, v.^-dcfn'^o, ^r{n7a(Ju 

Y Bmin SaJmncai b wkiliulodd i'r Aiglwydd 7 d«ml • 
Mim Ct3'.- IHff. tL 10. 
Ha« UawQT yn oilaif muriau, yn codl CDli>fiian evlirya- 
ydd.-£». la-ma: Ham, U. 138 |d[. 136). 

Nid nodd adeilad y eylfredin, yn wir, ddim and bythan, 
nni bleth o wiail vedl d oAaU. 

Tim. Bimu: D.P.O. L B. (18J). 

Adain, pi. adeinydd, adeinedd, adeiniau, ■/. 
[cf. s.v. Adar] 1. a wing, a pinion. 
Qoddfl avrych dymbi hir d Andau. 

T^iii^i: M.A. i. «S [cf. es, 651). 
At ediywwi ei"n ywy T" T" «(oi». 

C^mAMv.' 1C.A. i. ML 
QlwTi o *dn glaa ci aJniji, 
Ceiljog bronrmtli, mwyi^alOi mnU. 

Mh ni*in w bob a<lai>i bol, 

MAn pwynion, fal mturi gweniwl. 

ffiiqni OiMsi.- O.B.C. no. 

Ymaerli&i ulyt t pbedwU' mini,, gwilliynL . . Tnue 
Im^undra rhai pryfed yn rhyfedd iawn, ac flto y maq poll 
rhim yntjiynt ag lydd yu rheldiol i f yviuUon | megys pen, 
ymonydd, ll^H-id, Hneo. <*r11a. oolnddkm, uaJoD. trvd, 
adfin^dd, gewynHU, llnth ^wood, neu ryw fatb ntdd yn 
-- *- /Jfl/. i.«iD^f .- Oolvg. u ■ 



Coalea 



'^.[H. 



B-) 



Dan adain hyn a'r Uall, under pretence of this 
or that ; under this or that pretest.— Owent, 



Jm V_.(,K)t;iL" 



Adalw 2 

Wgtttb a gyTrlhiBt/neb yr aHain, both Bidea or 
pages of the leaf. — lAanovrr Ms. i. 
Adain byddin, the wing of an army. 

Fvi iralodd j rhai oeild yn tt adain IUW7 fod 7 rhai 0^ 
dds» ddebea wedi eix dryUio, hwy h trajOynABUit ut lada« 
a'i -*r.-l Xatc. a. 18 (rf. li, 15). 
Jdain y llew, honeyware (Alaria). — Meddugon 
Mydd/ai, 281. 
2. the fin (of a fish). 



^WTttrmac ,^. 

*« Or. ak ArH«T (B) : M-A. fj. SM. 
Ei bcTtluwK nrriK adalwai jna Hedd. 

If. O. flv*«.-p»l. », 

Adalwad, -au, «in. a caUing back or again ; re- 

Tocation ; a recall. 
Adammeg, -ion, a/, 1. a sajing; a maxim or 

axiom ; a motto. 

Hodolcs, B duwin ieffj 

End ha'T'ti iadaiaatg.—P. at Gmlym, hit. 11. 

HbiMh dee t>»* adammlf 

Nl I7dd air aenli i'm CTfumercQi. 



NId drwg a ddwg a fo'n dda- — i 



Se^.—Edw. ab lO-nt MaOnT. 



^dair cadair irrtli ^r^idd dafawd r n^dd jiw NghrnLm ; 
Did amffoi ; Cadair Dehenbortli, aH hafiav,mi:gy Cuon wriji 
gaku :' Csdair HoT^aawg, a elwid ^jtA Cuair ^i^llwff, 
a^Chadah- Qwent . . . ac adamuwa j gsdair bou, *Duw a 
ijooh daEoTu;^ trrdydd yv GBdair Bowyo, a'l ftadavimtg, 'A 
laddD, a Icddir;' ppdmtydd, Oulair Uwrnedd, a'i *adiin- 
i^, 'Ion.'— BortMu. (»>.) 

2. s riddle or enigma. — D. 

Adan, pi. edyn, adanedd, adenydd, tf, [fatan ; 
cf. amir, eden, tdn] 1. a, wing, a pinion. 
OaTbedacoJaiHdrdcliettyii.— raliEno; A.B. IL 16S. 
Arwry dwy jafwrto*"!.— .Imiiriii.- God. 1» [of. IBB). 
Adajttdd paviyn, peacock's feathers, 

Ae BMitlieii as en pelydTT oaqpira monill. gweij eohaa- 
frihi as adaatf d d ivwiii. — Jfobiac^iffn, 1. A. 
GanbTddin, o werinindd, 
A djn dan si adanedd. — M. ah lAjfvdj^. 
Ktwdawdd, n ehedavdd ftf Kt adaiitdd j gwjut, 

llKfr OvtdM GtffrtdiK 1587 (Salin. iriii. 10). 
I bkant dynion da fawD yw bod 
Tug Dghysgod fly adaneii. 

Sdm. Prwt: Balm, xixvl, T. 
DodH T Ovyddrl F&ihtl din wrth adaitald yr adar 
gWTlIlioD yn y gvgtedd.— /i>Ia «w. W. 

2. a fin. 

Adan pyigodgn, the fin of a fifih. 

3. the spoke or ray of a wheel. 

Tn yr olwya )- mae trl phetli; both, 8a adanedd, a 
Hal^mgi Carifniani {Sam Qaatet, It. ne), 
.iiJiutaiif adeitad, the wings of a building. 
tAdan — a dan, o dan, tan d. A^b. 
Adanadl, -au, na. a second breath ; a respirinjf 
or bTcathing again. 

I. to rebreathe; to breathe or re- 



Adanedig&«th, -aa, if.-:=Adeaedigadk. 
Adamfcm, v. to send again; to re-send. 



t Adab 

Adumarch, 1 v. to resalute, to regreet ; to 
Adannerchu, | salute or greet anew. 
Adannaroh, 'ion, tm. resalutation, regreet. 
Adannarchiad, -au, tm, resalutation. 
Adannerchol, a. resaluting. 
Adanog, a. [aAKr{\^Adeiniog, Adenog. 
Aianadan {gl. alligfrja ; ie. aliRerJ), 

CHoH. L<ixmh. (ZeuH, O.C. 10«4.) 

Adar, {«g. aderyn, ederyn; /. adaren), i.pl. [cf. 
tufain. adan, adrvi] birds ; fowls ; fowl. 
Maws llalar adar mygyr hyar bin. 

OvKilclmai: H.A. i. 193. 
ClTir«d dn adar mio UsL 
Mewn dall a, a'l doluriai. 

Da/i/dd ab OteHifm, ^^-rwi^ 10. 
Adar cywed o'r Hwdydd, 
Cyfrataird au gwawd mawn swjdd.— £«ta Bnrnnttyt. 

Adar atgellcg, feathered fowls. — Salm. Ixxviii. 

27. 
Adar yr aieyr, the birds or fowls of the air. 



Adar y bili, the small fish oaUed miller's 
thumb.^PujAe, b.v. 'Gwroohen.' 
Adar brat yr yd, buntings. 
Adar y Wn, bitterns. 
Adar c^n, singing birdsj warblers. 
Adar daf ' ' '^^'"^ birds; domoatic fowls; 

Adar y dntdwy, starlings. 
Adardyf,^ Jwater-fowl. 

T mae ereiU, fm ympiTdioDt, a twrtlat bob adar dn/r- 
oeddojattl^libjaeoa-^'Sd. lama: Horn. iL \&i. 

Adar yr eglwy», church birds; but it is not 
obvious ^riiat ^mrticular birds the name is in- 
tended to designate. 

Adar j/r agtiBsg, rwnsawo ynt. adar y drrdw kTmedrol 
jmt.— H»v»rt ih. m. 

Adar yr eira, snow-birds; a name given to 
the starlings when they ap|>eaT in flocks about 
the beginning of winter, being oonaidered p«- 
oursors of snow and severe weather. The 
name is also, for a pjin i l ftr reason, sometimes 
applied to the fieldfares. 

Adar y /dttith, accursed birds; a cant ex- 
pression for dishonest lawyers. 

Adar gwylltion, wild birds, wild fowl. 
Cydfolant hon adar awyUii^it. 

Bhi/i God ab Bhktrt: lolo Urn. US [ct. USD). . 

Adar gwyrain (q.v.), bamaclea. 

Adar lliveh gwin, birds of the wine lake; some 
mythological birds of prey, three in number, 
supposed by Daries, Pughe, and others to 
be vultures ; but as they belong exclusively 
to the domain of legend, and are unknown to 
ornithology, it is useless to enquire what 
birds are int«nded. 

Dratms ab Trepbin 
UwfA ifKim ; a hwynt a 



jM.v_.(,K)t;ie 



DuMr iddynt. Acleoto^wjimM/mtbinigAiibarmDm- 
^rt^ AC Di chai ntb ddjtad !> nuefl end dwt eOI daa ; A 
Bjrit ei »dar a miReUi DrutWM, ■ drmdyd, Uaddwch t 
CTnUf a dd.-l i'r mui. Ac fsl yr u ArUmr i-i mui, e 
ddseth chvHer Dmiirafl, gold urdderch f Arthur, u * 
Icsteiri^idd Arthur i'r niii«*, er caiiAd i bob un o hoonit. 
Ac o'r divedd fe dduth Dratwu I'r tomim, gui dybio Ibdd 
o'r ■dar Arthur ; ■ca'icipioddTTidu'er.Ka'iUMdiUHt. 
Tn ?Dtrrch awyr rd adTubod « a wnaetiiuit, a din^^yii i*r 
UawT drwj oeriad doBtnria'ri T hjd, mn U4d Dnitwia, en 
mdstT' Ac 7 Hue Chniad ^(Mr JAuk^ rTvia ar darmau a 
irnaed yr amaor hwnw 1 gaff iii hjav; ae d hnf y calodd 
Uywanh Heb y teatOD i Kana'i englyn caolyiul : 

DraCwaa ab Trephta trln dlnmavd 
Uui dtallaird a gorddln, 
AdwT a wnaeth ryHeflo^ 
J<lar a-i Uaddodd liKdi fwin.—Iott Xa. 199. 

Pwy TV ttdar gwii Bwtk pn* t 

Adar bflD iTda'r bimin ; 

Adar dFwnoiL drwy darav, 

Adai y diia, bob dH, dnv. 

L. O. CeM. II. T. 1 (of. T. It. M). 

Adary ntf, \ the birdB of heaven; thebirdf 

Adar y tu/oedd, f or fowls of the air. 

Adar y not, l.mgh.t\aid». 2. benighted peraonH, 

or people tliat ttlways airive or return late. 

3. night walkers. 
Adar paraduryt, 1. (Bupposed) tarda of paradise 

or heaven ; celestial tords. 

Sa benoerid y loew-gsidd luri, 
Pur. o tJarparadtor'- 

D. ai a^BBgrn, -T-ri. n (of. «exiZ. M}. 
ti adar gwlad Mnulwjrt, 
Iwl noD ddail alcUon slwyal 

Z>. <>» &«Vk, OEtxli. S» (sf. odU. U). 
2. birds of paradise (AtFodiwii}. 
T mac 7T hoL h aM^o p vydd gflDym am iblar pi 
yn btavf o't dnedd ban 1 owd dytaii ar 1«d yn Ua | 



Adar y to, Bparrows. 

AsdotUmAii'f Ic— /wBffttUii a.B.C. IM. 
Adar to (m. aderyn to) is also used, especially 
in the ooUoquial langoage. 

Bho'tli rywmliiTWTdd dH ar wailh 
I ladd re <k'<^ W *fa difa'r yd 
Cyn llwyr addf edu ar y ffrwytUawn tM*. 

fVnMAlisH. 
Adar yiglyfa^h, I birds of prey; rapacious 
Adar yiglyfaethv*, ] birds. 

A*r rbai a laddwyd ar irrueb y maa, a adavrd yuo yn 
enwiaD diair ao yma, nafll ai i wyfedB a dnwL neu fod 
yn burUdaiit i'r nma'r bladdiaid, ao oAir w'l/'aMI. 

TktB. Ctou.' D.P.O, L 4 (103). 
Cyvrion adar [ag, oyw aderjn}, young birds. 
CaDiadan cfnAm adar.—D. ai Oteilrn, mA n. 
OywalA adlaia odlati cynnar 
Guau odiaeth egnfioH adar.- 

Ckaria B^atm: Cyfr. y Bdrdd, W. 

Adar Morganuig, the birds of Qlomorgan; a 
sportive name sometamea given by their neigh- 
M>iiiB to natives of Olamorganshire. 

[^d«, -a vise ' adar, 'bllda,' 
•In SkT.pai, 'to By,' Or. Him, 

m'n'eiihran.si.l 
A(Ur«, V. to fowl; to oatoh or Ull birds 
wild fowls ; to bird. 
Mytud i adara, to go to fowL 
Rhwyd adara, a birdiug-n«t. 
Dryll adara, a fowling- or birding-pieoe. 



at pal, iA 
.—Kkgi: ] 



Co odon^, ooed biKg.—OtftimacIt f BarU, WB. 



i AsABOBAFPtAS 

2. a gamekeeper's hut on a mountain, or in some 

lonely place, from which he can watch the 

birds. — (/went. 
Ad&rdd«lw, ) v. to reassert; to claim or as- 
Adarddelwi, } sert anew; to reclaim. 
Ad&rddelwad, -an, im. reassertion; a waxrant- 

ingagain. 
Ad&ren, -od, «/. a female or hen bird. Bee 

Adtryn. 
AdArCa, -oedd, f eydd, if. a place for the keeping 

of birds or fowls; an omithon; a pooltry- 

Marohnad yr adar (t ieir, yr bwyaid, T pwyddaa, a'T 
oyffalyb adar KWH^.dd(dOD) ; yr Mrta, yr miar/a.~ Waiurt, 

Ad&rgi, adar^wn, *m. a setting-dog; a setter; 

any dog tramed to set and start birds : aloe 
called ci adar, 

Bryb nm yn oorddi bnildk adals tU 

£?^^^^.-/^«?U>^ : M Jk.. L HT. 

TnutsFyl yma a ddanfoovrd i mi WUd yr Baf. 

CfirmaUli DiMn (ed. 18H). ES. 

As («Uy i^wddwyd IT 
ftn. . . . Eilhr Bid yw T dalargi, T b] 
and yr uu zbyv o pwn. — QwjfiiKdirdA, t. 

Adaxgoel, -ion, «m. angary, divination by 
means of birds. 
Celfyddyd dewjniwitli intli adai, dawlndabaotli adat, 

Ad&rgoelna, a. depending on or relating to 

augury ; given to omithomancy. 
AdargoeliOgV. to i»K!tise augury; toaugunte. 
Adargop, \ -an, tm. [A.8. dMorooppe, dtorcoppa; 
Adyrgop, / O.E. attercoppe, oUiramK, attertop, 
Adyrgob, >atlyreoppe, addurcop; N.E. atteraip, 
Adrgop, ( atiercob. Bee ADttmer, i. 1 38 ; Bos- 
Adr^, J worth's A.8. Diet (ed. Toller), 59, 

60; and Promptorium Parvulorum, 16. With 

the latter element cf. W. cob, oop, copa, and 

(pryf) copyn] a spider. - 
lit 
*- 

X. Lteyd.- Arch. Bitt. US. 

re adrgitp, tftiw toijp (frwyth, 

ran dalar Owyn a'l dylwyth.— iV- <^ ffKOrrn, Ut. B1. 



an^TvUrt y ^anthust vy J 

Y gylionai ffynt oedd n ohede^ dao giuiu 
mur, a hi a ar^aofu yr airap yn a loobm yn 
a dywadyd a oiug witho st, Kl ellir dim k tfayi 
unyi ml a diedwn yr on dyAd mwy 



— , . ,. d mwy DOB a nrddlt ti yn r 

dee diwnuwd ; a miimaa al oynnaliatr h»D hithaa. Dl- 
dthr hyn, beb yradnv.- ni a yfwn y rwln ysBTiitafi ao 
<>edi,yTDBaiooUooboiuiin,t*leddn«&. AUd%Uy,M> 

y fylioiwn. Aiooiift hsbyrmitoji; miawnafpntynyiyn 

aidderoha*B I'n lylch. . . Ovna dlthau, heb yhl. Ac yna 

-^ufl el we a onig yr adrtp, , , A damd a wruxfll UtbaB ; 

yn gynlod ae y CTTOhawdd i'r ire, alynn a 




-i1 badoiyilJ ynddo. . . Ao yna y dyvawd y 

^lionoi, O, melltagedig a f a T rtiyv nrtynyi bvn, oan 
dI ailaf H fyntd o homi Aa y dymwd yr airop, Yn «1t 
nld ei di oddi yna byth yn fyv.— ^laiHHfwa (T Gnal, am). 

AdATgopwe, -oedd, »f. a spider's web. 

Fal ffwdlgi, yn llonrt pob Da.— D. ■» (hiiljFii, nxix. n. 
Adaxgraff, -au, -ion, ^-m. a reprint. 
Ad&rgraf&ad, -au, sm. a re-impresaian, a re- 



OaHvn rAirane^ fr uiglinilK k mUr jrn fTDTEh r 

maint u sTTnciridudBD ■ diwrgiadiia ja cul m ffWHyd 
gui TtmiiiiFdwTT.— niniAiiaiHm.' HuL Crm. 3T0. 



AdariAethol, a. ornithological — QwylUAudd, 

ii. 235. 
Adarmea, kq, «/. an ill omen ; a misfoitone. 

Ac jmpctm tolym djirodaC rn lie ^wir heb hi nuwr 

AdAire, i. [adar-|-rbe ?] a flight or flock of 

OwiaE BWysdnl (nryeil Bret ndom [uJ. a dun] 
Kewl adiwD eoMn coed nfud bttre. 

Ur^ni it UrKtf : u.A. i. set. 
i birds.— A 



Adarwr, wyr, *n). a fowler, a birder, a tord- 
man ; a bird-catcher. 

.4ifarwiidiTlcli>TBmeUuu)(iso«d; yrodiinn-igTSrlon, 
**r cylfihirr i ^rmkiiU ffyn cylchan.— /0I0 Jfjr. Ifi6. 

Gn^^ntliDT ftl y bydd jr adtf yn g^meutfaar t geUo 
ggdiel miglan tt mdarter. 

Dr. Join Datta: Ujb J B«. n. liL CS. 

Adorwriaeth, -an, a/, the art or practice of 
fowling ; the trade of bird-catching. 

Adarydd, -ion, am. I. a fowler or birder. 

!. an omithologiBt. 

AdcuyddiaAth, -an, a/, ornitbologr. 

Adaiyddol, a. omitbologicaL 

AdAteb, V. to rejuin; to answer to a reply; 
to answer » reply. 

T U^ a .idiachBid, Tr wyf yn atolirg I U ... el 
ddanfnn f4 i A^ tr olbid - . . Abraham a adaubtjdd, Onl 
i fe'r pTDphwydi, lu ddaibwyllid hwyat 

— liamt: hi. Byw. (Lm xtL W, W.) 
Adatab, -ion, *m. a rejoinder. 
Adaw, v.^Oadaui (q.v.]; to leave, quit) or re- 
linquish ; a form of comparatiTely frequent 
occnrrenoe in M.W. 
AdMm Ffrcdno aonagaat. a Bwr^win. arAlmaen. a Oroeo- 

Aif^K y dtfrf a wiu«1hant. ac 711 y herbyn j dfi«th Brad- 
IQwnd. — Smth o Hamtvm, J 10, 
Ap angfil adoeth att Badrlc. ac adywavt irrthaw, Adaw 

buattoi aonio Fodric yndav b hon nt oAta y Urn hwnqw. 
SnOtdd J>nn.- C. B. Saint*, IM. 
EioKtA J llDg BT hynt.— IFdtn f andn, 1 38. 
Aa odyna IvdaA dyiAednaeUtau ar milaiiiaiif er Bor- 
nuvyr y* crgryuedyo pomrl hoono afl Afaw ganthunt 
dyikBdTBBethau . . . y vnentliiu- anan. 

»M (fr. al .Iftfu-.' ILA. iL aw. 

Adbaith, beithian, am. a purview. — P, 
Adterth, -au, rm. a sab-district. 

XubynllilUi. bwrddsdref mieddoL trefgordd, plwyf, 



yi^iraitlit pe oodai oi 



S ADBLBimntBmDtAD 

AdbftWT, borion, am. 1. a second chewing; a 
chewing of the cud ; a leaving. 
Adborion, leavings. 
2. latter-grass, lattermatb^-ddwent. — O. V. 

ATthiwndli^iatf^ adar a^enot 

A[thiiflndi^Tiiflt«j aupaur a djca.— Jfir^r. Arth. I. Rli. 

Adbaniad, au, am. [{>en] a reassignment. 
Adbeoawd, odau, am. a head or division; a 
Bubdivicdon. 






A hai bv&c gnrchMt oedd. 11« bal mai 

-'laddoufa- - "-•-— 

c^wjnai 



w«dda A deufan uniid] a /t 
gWElwatol,' yr a&niiUI . 



y pennOl. di- 
11 gyfunodi Vt ddeuian gTUtaf. 
y dechn'Old. Ue oekld cywirdeb 



retrospective 



Adbeithiad, -au, tm. retrospei^on. 
Adbeithig, a. rotrospoctive ; in view. 
Adbeithio, v. to take a retrospect ; to retrospect. 
Adbeithiog, 
AdbeiUuol, 

3 reappoint ; to ri 



Adbenu (e), v. 

AdbeTch«nog, -ion (t), am. one that repos- 

aesses ; a next proprietor. 
Adberchenogaath, -an, a/, repossession. 
A4berch«no^, v, to repossess. 
Idbigi^^' j "*"■ *™- * reF«'*™8 ; a repricWng. 
Adbigo, V. to re-pick ; to pick again or anew ; 

to prick again. 
Adblan, n». a second planting or settiitg. 
Adblan, a, replanted; transplanted. 
Adblanad, -au (a), »/. a secondary planet, a 

satellite. 

Heb law yr vjtb brif biased, a'r pedair ar bymtlwe 
adblnnMnu. Ufluadan, nen ortorddinii . . . y map ryrH erefl] 
yn pertliyn i Dduepartli yr Haul, a dwit wr gwib. 

Eifliiia Strj/rfJjiMl*, xxiy. 

Adblaniad, -an, am. replantation ; transplanta- 

Prin didumadwy yw i'r saw] a welsaat syut «i offvedd 



AdblAnu (d), V. to replant; to transplant. 

t'r Thai gwyrddioD iV 



4 



Adblunrr, wyr, «m. a transplanter ; one who 

plants again. 
Adblentynaidd, a. like a second childhood ; 

nhilHi'flh again. 

Adblentjmeiddiad, -au, >m. the coming to a 
second childhood; a becoming childish the 
second time. 



Ai>sLENm(En>iJ 10 



AdblvK, -ion, ttn. a fold turned back; that 

whi<£ is recurved ; a fold. 
Adblyg, a. reduplicated, redoubled. 
Adblyeredd, sm. recurvity; rodupliotttion. 
AdbIy^iad,-au,sm.aced'oiibliiig; recurvation; 

reduijication. 
Adblyeol, a. reduplicative, recurving, re- 

doubung ; reduplicate. 
Adbly^, V. to refold ; to bend or fold back ; 

to ^double ; to recurve ; to unfold. 
Adboethi, v. to beat again or anew. 
Adborion, t.pl. [adbawr] leavings ; refuse ; 

remnant; scraps. 
Atwrion frdd Brytbon pui ddyorpliyn. 

0<4inUan.*IC.A.LlG8. 

fffud odfa trofa timfn cuiirl«ld beiiddiaii 
Kead atborion MCm mau gyfumedd. 

Grifj/iU oi JfcmltHU .- If >&. L 4S>. 

amii'a bwrw jn adbtvimm, 

Oarw-fyd gynt, gorfod a ^wo. — D^ JJwffd. 

Adbrawf, brofion, im. a second taato ; a second 
or renewed proof ; a review. 
Mi a'i ^mloifl ef ru yr adbravf. — Waiti^rt. 

Adbrofl, V. to retaate ; to revise, to review 

prove anew.— IF. 
Adbrofl&d, -au, em. a retasting; a revision; a 



Adbrynol, a. redeeming, redemptive. 
Adbrynedigaetb, -au, s/. redemption ; a repur- 

Adbrynedigol, a. rodemptory, redeeming ; re- 
purchasing. 

Adbryniad, -au, am. a redeeming or ransoming ; 
a repurchase, a buying bock. 

Adbrynu, v. to repurchase; to redeem, to 
ransom. 

Tna godamd ei hadbrynit hL — Ect^ nJ. 8. 
Bydded 1 ni ymdncba o hyn bllan i ndhrynn yr voter a 
adtaugoddoddiMnom.— Si™'"«'J''^Saw.- Giraith, ii 306. 

Adbrynwr, wyr, «m. a rcpurchaaer ; aredeemer. 

Adchwa, -on, -oodd, »/. a blast or puff. 

Adchwaetb, -au, sm. disreliah ; an ill taste. 

Adcbwanegiad, -au, am. re -augmentation ; ad- 
dition, augmentation ; a sup^ement. 

Adchwanegol, a. additional; augmentative; 
subjoining. 

Adchwanegn, v. to re-augment; to add to; 
to add or augment. 

Adchwedl, -au, am-/, a report, a rumour; a 



tale. 
Adchvedledd, em. a rumour 

Tm adwyd yd baithnjd berthed 
Berth worthw anreg aniTded 
Aa dygaf ys dygyn itti:kK'Alid.—C!/Kddi 
Pell yd ctmygir y atductdlal. 



report ; a tale. 



, -ion, tf. a return ; retrogressioa. 

a Bwyll ai chwel ac aJcAml dio. 



Adchwelawl, a. returning. 



AdchuHiol iawndet ei 



\ackwcU: C^n. Ainu, ISO. 

II, rnn. a returning ; a revolutaoD ; 



>;t<.'Fal. 21. 

etumable; apt to 



Adcbvelog, a. returning 

Nid adchKttaiX!) giii.—Diartli. [U.A. iiL I«B.) 
Adohwelyd, t v. to return; to come back; to 
Adchwelu, ) revert. 

Attor or ^ynhoQ Baeam aybyd 

AldliiitlKitlWydflBTeabamji.—aol^idm: A.B. laS. 
A pha hyd hyn ein byvrd, piry a *yr, 
Nai mwy tu> hyn, mai Uindi njni, be mal 
Adfhiottu yno heb fod mwy ay raid I 

IV. O. Pii^'it: CO. a.awlof.Tl. «S). 
Adclavrla, maiiaao, heddwdiyiidynidd.— C«>:^l)aivA. 

Adchwibaniad, -au, am. a hissing or whistling 

Adchwibanol, a. whistling or hissing again. 
Adchwil, -ion, am. a research ; a review. 

AdchuHlion, researches ; investigations. 
Yr Adchwil Seirniadol, tbe Critical Eeview 

(the magazine so oalled}.^ir. 
AdchwU&i faocdd, fgydd, am. a research; » 

Yr AichwU/a fiirniaiM, tli« Critiijal Heview.— If. 
Adchwiliad, -au, am. a research ; a revision. 
Uae'T Uythyiauu cytdrladol a ircUr va y llyfl . . . jn 
tydiuliaetlio ei addiwiliadau UeD-IeiiniadoI, 

Tal^i„ ^ Mo (Cjfr. J Beudd, Rhaffdd. 9). 
Nid ydyw yn gynnwyBedig nwwB meddyHadan newydd- 

Adcbwiliadol, a. researching; investigating'; 

revisional, revisory. 
Adchwilio, V. to revise, to review; to re. 

search; to investigato; to 



to 



Uawer tacT ymnia a vnacthpiTTd at d lanaaf fawrt^jdi, 
am gad adchu-irio'T llyfr dyvcdpdUF. 

/.Jjyv fliwrfdi Oyffndia (Rhagymadpodd). 
d adehwHio gan Eiaion ae 



Adohwiliwr, wyr, a 

Adchwyl, -ion, -iau, if. a revolution, a cir- 



Nfa peidlai, oi 



■.-c.a. Ti 



pl,3Up Bn/dgdd: U.A. i. 37S. 



AdcbwyUa, faoedd, fSydd, a/, a revolving 
place or state; a revolution; rotation; a 

return. 

A thra mac (ymfqorau v dwyddyn yn (Ael en tacglnro 
gan nUciuyl/ii/iiJ y itoniclinlioD f^doMd. nia arallwa Ui 
na rhyf t^du axdilenhowwydA rwaith gogouedaaa y Cr&* 
awdwi,— BoJ. BotrrU: Daaaryddiaeth, Rhag. 7. 



Adchwjli^t -au, im. a revolation ; a return. 

Ond ud ydpi JT nn diffr^a yn pubsa yn matadol 
rr^ eglnr oddj imh fod t cy^v yn cdllo odd! irrth y nod 
ddeutu IS mimod bob aiicAmgt^ad^ 

Jtobm Sobrru .• Beryddiiuth, SI. 
Adchwylog, a, rcrvolvcd; conaiBtiug of revola- 

ticms or rotatkons. 
Ad-dalu, V. to repay ; to pay back or agam. 
Fft ddiolcfa s sUwa iii td ad-dalu 1 DdaTua duioch chwi T 

Ad-ddTchweliiul, -au, *tn. a rerolutioii; a 
retimi ; restoration. 

Ni a gaweom odd! u uiueT yr .^il-ild|[<*cwltail gym- 
..-..,.^1 .-Bieryshir 

Ad-ddyn, -ion, tm. [^:adyn] a wretch; a 
reprobate. 

Ond ea bod gvedj mjnednad-idgiata ac ynwrthodedlg. 

Si. lima: Horn. iii. M. 

At ol hyn nuc cyfran gveAi el bamodi Vr cyfryv ffij- 

ddifoieit KwuueoEKddnr ym mblitb dmfrithwyr ac au- 

«jdaj«i6id.-la. s»»ii«i: Aihr. )T E^i. M (cf. as). 
Ad-ddjrwodyd, v. to repeat; to rehearse. 

Bdiyd, B IjHd pan od-dJyi«ter yr un gair yn neehrou 
llavf o beniullioD. — FuinLtvfr CtrddurriaeiA, 114. 

[Fcff other words sometiiuea spelled Ad-d^ 
and Ad-dd-, see .^tt-.] 
Adeb, -au, -ion, «m. [ad-feb, ebu] a reply, 
answer, or replication. 

Awdl yr sdiiav.— i)«n ICro .' Bl. Art. 114. 

Adebriad, -au, tm, [ebru] resuscitation; re- 
gressicoi. 

fiyt adgbrgai Ini bwyf yth ni tut ^onhardcon. 
Geni dooyd djduo perohtn lleg eBrlyun. 

r respond; to 

- -^-- ^- --- - — , ,-^_ dAO bietyllocdd 

Bbaiadr y Bvn^log a bami oclwl n, ac mai ia aain fain 
fwynaidd y iii«iaj yn adtbn, neu adueinics oedd yr byn a 
I^Jyvw. — Gui^lifAyddy t. H. 
Dyba'n fwyo, aditai'n fyr.-DflM B'lm; Bl. Arf. IH. 
Adef, J)/, edyf, adafan, «/. [=;addef, haddef : ol. 
li. aede»\ an abode, dwelling, mansion, or 
habitation ; a home, 
Ya adrf toDsdef <»11i(. 
Jcfe/ led bDoat l«v endyd mlL 

OnrcAaa jMiicn .* A.B, ii. H. 
A dyfo mab Cyosa . . . 
Un nndavd 1>diidavd drwy rybochfd 
Ou glaia rIotw aie/ [aJ. addsTl yn nef dntred. 

Umr: M.A. LIM. 
^ In these instances we ought probably to 
read adfhf, the d, as usual, standing for i^. 
Seren Bjriawl a bedodd j'« Ao^/dia^vyddairl. 

IMoji^-ar, It. Se». 

Adeg;, -aa, «/. 1. seasonable, fit, or conTeniont 
time ; opportunity ; a season ; a time. 
Ar yr iawn adeg. at the right time or season ; 

in the nick of time. 
Achub ^ adeg: see e.\. Achub 1. 
Ar adtgaii, at curtain times ; at times. 
Mvyuedd caiQ adwedd a^ hirddydd. 

JIA. Gailiob Bhictri: I(da Mag, ilS. 
Tydi yr Hat . . . 
Qmagar hyd dii daiar d^ 
On nodan dj gain adegl—D. at GurOf^ cclx. 76. 

Adfg y Uoer, the wane or decrease of the moon. 



7 Adeiladiai) 

Adaigci CF] 

I'an vn yn lynel gat ohvel chwerwUt 

y ^ne aiy piigilp BtvI^t ilJL.lmi. 

1[ The passage is probably corrupt, the word 
not being found elsewhere. 
Adegin, -an, t.d. serms, shoots, or sprouts Uiat 

spring up after Uie first. 
Adeginad, -au, sm. regermination ; a second 



Adegino, v. to regerminate; to bud, sprout, or 

shoot again. 
Adegol, a. opportune; timely; seasonable. 
Adeilad, -an, sm. I. the act of building or 

ooustructing ; a building up ; construction ; 

as, adeitad iy, adeilad cglvfyt, 
2. «/. a building, edifice, or structure. 

Ac pwpdy bynny {Llnd] a CFTchmynn*™ yr kywdawd- 
wyr a3e^'lnt t*y endy mtgya na bey toy MymaMOed ym poll 

yn y cbjlnh yn nn ilynaa adcslruitu na they kymryt ae tey 



'blion a ddaeUuuit ato, i ddangoa iddo od 



y deml.^^di 

1. edification (in a moral sense). 



4. a solecism. 

Soledanioa, Adtitail. a lydd itay* osodiad 

Adeiliad, j ' 

Thfi afnm yn AJTritA 






Boma. — Taliaiit: M.A 
lloacedigyon 



Ae galT 7 wyrfs sgp,. ao o getunndeb pawb y goandn 
Friafygapla nehun ^arehMcobysKBerEfrawO-acypBria 

^™B1 : iZa. U. 811 (ef. IJS). 



Und . . , aoiuhymynnnys yt 



" Viim 



^ ill. 396. 

Yna 7 kadamavd ef yn ffyd Orut. ao yd enbia adeilat 
eglwysKU- — Y Grog'UJt, j IS. 

Bn uarw Omflud nab Bya . . . gwedy adeilal Uawsr a 
eglvjAau yny amser.— .Brut f Tywyoitglon, 160. 

Ham tloigi ti na'i adnluid.-~/ofa Vii. 3SS. 

Adeiladaeth, -au, </, 1. a building, edifice, or 
structure. 

Belh yw enwan y gwji a adeQadant yroiWtaJMi* yma ! 



(in a moral 



Ovneler pob petb sr aikUiidaii!i.-~l Cir. xJt, M. 

Daw odB^aSa*^ i enald y Criation drwrV dnatdau. 

CAarfMfii™n*i.- £Un.yRydd,ai 
. architecture. 



Adeiladaidd, a, of the nature of a building; 

appertaining to building ; edificiol ; edifying. 

Adeiladiad, -au, nn. the act of building or 

constructing; fabrication. 
Hevn dvtn fyfyrdod yog nvbyldi adKIddlcuf y beddTeJoi 
-bjtcj.—Gto^iBi^, T. SSO. 



Admladlwytu 



Adailadl-wyth, -au, g.cl. those on the founda- 
tion of a i;<>l]ege or a siinilar institution ; the 
capitular body of a cathedral. 
Bod ar yr lioU ddounnu . - . OAnoniaid. flceruld, ul^uum- 
imid, CBntorion^ it pbawb ociU oV lui'^adlinj^th, dderbrn 7 
CymiQuu bedaiT fwaith o l«ul bob blvyddfo- 

Adeiladol, a. 1. cdifjdng; edificatory. 

Freydh adeilailol, an edifying discourse. 

M-wy adeiladnt Vr dulleoTdd . . . frddsl ftdvoffa iddo. jn 
ddifmol, fawT fficiddiad a brrntj y j>«chod o feddvdod. 

2. architectural. 

Adeiladu, f. 1. to biuld; to frame; to con- 
struct. Now the more usual form of the in- 
finitive, but later than a rifiTui/. adeiiiad, atUiiio, 
or adeilo. 
Adeil'idii (y. to build a house. 

Ydd ft a.i'i'n.iiint J dord, nld o fath y ^yvtaf . , » ao 
yn ol hyny y dyohwriant n b..h man u'u mrlliiwed. ar a 
aJrtl»,l.„I fenualnu yn onrhydeddus, a IhSDduwa arff ilnrff r 
ynddl B% adeiiod ffogodeddiu. — Tolii lir, 5. 

2. to edify ; to build (in a moral sense). 

Ae a^MlrdiccA bob <in deh gOydd.— I Thrti. v. 11. 
AdeiladwT, wyr, ) «m. a builder; on archi- 
Adeiladydd, -ion, ] tect. 

it^f/ultcf/r oodd Tedi gwrt^ynu ei gUddyf ar ei 



Adeiladyddiaeth, -au, tf, architecture, 
ffwycbdat cyflawoiad peaoelfydd men'u niUilidj/dftio'lh. 

Adeilaidd, a. pertaining to building'; reaem- 

bliug an edifice, 
Adeilawdr, ) odron. am. a builder or archi- 
Adeiliawdr, \ tcct. 



Wynt a adeilaa 



ant Tso ddinavnld lavsr. IQwdwn, uj 
Bn-Milit dr. ab '.'fiuii.' M.A. ii. «< 



Adeildy, dai, snt. a building or edifice. 
MonacLlog Haichogion Malta, a'lfi'if'i t^ iavn. 

W.l^.ns: Dwy DaJtb. «S. 

Adeiledigaeth,-au,s/. edification, construction. 

T Uys Y prewwyla yn ardden^hojfTwydd ni ynddi, a 
miafthpwTt HJ- nn^HUdd a cbytri'lybni'rl.l y llyi a urddus- 
B.wdd Thomas E1.»W1 y Wyndoff.inw h-™!.!,. ^ T~iin 



•ddThomar 
le yapuydeu at 



1 obytfilybr 
Wyndoffot _ _ _ 

ligmlh.^ ynbo11a«] ky«r1y1> yi> iddi. 



AdeilfowT, a. having large or fine buildings ; 
finely built. 
Dwy Ian Owy byd Fyniry f awr, 

AdelLhau, v. to build; to erect. 

Dnenawc pwrthrwro o aualen a a^'tt*M boimo o newyd. 

Adeiliad, -au, em. and s/.=:Adeilad. 
Trwy dy boelyaw draetadwylawdiutadnlviF, 

Do0tb UafrOQB VTflAhfa jr eQ veltb I Von. ao a Trloavd 
oiliim.J-irprtnn.— J»™i*&iMoii,- M,A.ii. 638. 

Adeiliogr, ) <i. -wattled (?); well biiOt, formed, 
Adeilog, j or fashioned. 



■rdwylaw 



Fill delv 



^.~ln,a« nifdgid Sir */- 



Adeilio i "■ l-**t"i3d; toconstmct; toedify. 

T danapciwd ho „, 

ac ynbraff . — Mabmoj/itm, ii 

Adaliai d$ fty ar trjn,~D. ab Omljim, IxnriL 1. 

Onid vi Airiwydd a luMIiii y tt- 

DaStidDdu HtraUi^: UJi- I. 67* 

lUr goTchirTl ndam Tayi Frydain : codi Uasi Cetla ; 
odeUiaK Qinjtfi &ajrn : a thnm Oudair Gyfrwunm. 

AifUvvd bfldd rrodd fnriwder 

Penaid I'Oi Kylch a tynor 

Adalaudd cot dy alar.-<Tr. at Mfrrds^: U.A. t. 4M. 

,Jd«lui^yt> olod lo.— ^. D. at lea*. 

2. to lay or treasure up. 

Qitbeu [Meir] pan y pwdas a rynedawd. ae a adrSaiBd 
bynny yny challoD yn gmtwcdlc. — BurJudd Jtair, |31. 
Adeilwr, wyr [adeilo] ) rm, a builder ; a oon- 
AdeiliWT, wyr [adeilio] ) stnictor, 

Cefyndeor a ddyly atmn tir eithyr na gymit neb y dy- 
j — . t^A „ ^jj — „ n^t ,4^1 J Tannu 

ion CVwrn, iL S§a. 
Oferfydd llafnp yr nrfnViryr a ffweoory. 

Bn/j.W ll,l« »ir,uld«!,: XJt. L S70. 

Adeilwydd, a.pl. & d. 1, timber for building; 
tuubt^ofahouse; rafters: «$. adeilwyddcn,/. 

Ue Dowydd ajUHtejfdd da. — Z>. db On.-il'jm, tIe. 33. 
Myqain^ myoydd. mynra meusydd, 
Mum adidwDdd, a daU dolydd. 

lih. Uoci ai Rhii-rt ; lolo Haa. Me. 
2. figuratively, a family or clan ; Idndred. 

Y do'i u ryw^blodau'r iaith.— 



^jr^^ddy-a, 



Cteflrodorl ^aal a Uawe 



Er pigoTiodda yr Adrilj/dd huhit. 

If. <». Fufht: CO. iiL Tfll. 
Adeilyddiaeth, -an, »/. archif^ctiire. 

a ddefnydilir yn^ nifivaiiuthuniid eKlvyni a chrefydd-daj. 
tiirri'/doHtadur Ountif, L AS. 

Adeilyddol, a. architectural. 

golygittd nJ-tf.pjiMo/p nid pt [Bglwya gadniiol 

Adeinfwsogl, am. wing-moss {ftemgcmiuTo). — 

Hitgh Davits: Welsh Bot. 105, 
Adeini&d, -au, tm. a furnishing with wings; 

empJoynient of wings. 
Adeiniaidd, a. like or resembling wings ; wing- 
like; fin-like. 
Adeinio, v. 1. to wing; to set on or furnish 
with wings. 
Am hyn derchafi^d pcraidd gfin, 
Ym mhiird(>b hardd cydwybbd i^il, 
Adjrinij^ bou el tLaJth. 



CriKt fl'j rfl^ll a*i hadHnia 



*%. I'H^rd.'c. J C. cliiY. *3 (cf, InriK. 9). 

AdBinjoes, s/. a second or new life ; a renewal 



Adeiniog, 

feathered. 

Adriniog edn byvioff t 
Wyd imi, main jwa'i 



iddo'n bardd.— Z'VV'^ meala: 

winged, wingy; 



'tmacb,— il. ah Owilym, alxir. W. 



jM.v^.(,K)t;ie 



Atgdl adeiniog, a feathered wing. 

Enr ■ . , i't hwn vr ydoedd deuddena hueetl adiMoa, 
■ UmplwB.--2JiW.il.l. 
Son aileiiiiog, winged fame. 

Bod virtawff, heda dithaa 

Dm* r moiwdd n'r mynTddiui. 

B*jn IViehird ; C. J C dxlT. IS. 

Oetriau adeiniog, winged words (a traualatioii 
of the Homeiio 'nrta mtpottrra). — Nicander. 

'"'' Or, at Miriisad: M.A. I. *ei. 

Adeiniog, -ion, -od, k. a winged animal ; a 
bird, a fowL 
Kkrw yHjd yno nrhynebrwydet jn or adcvtffttvoc kyntof 
%o TtBsam yfayd ju y dill- — Mahiwtffioot 1. S08. 

Ni brdd u dirwT na chomli 
drcFT liedrwl, namini tola flf wer 



cyfnitfa l*r percboiAinr, 
,m,y.9(lor 

pinions; 



Adeiniol, n. relating to wings 
winged ; like a wing. 

OndEtalaoiigdboll 
a4riitiinei hyn oedd pfU 
O. PH^hr: C,0. T. 818. 

Adeinredyn, a.d. and pl.Ug. -en, /.) brakes 
(/•(ms).— //uffA Daviu : Welsh Bot. 99, 153. 
Adeinredyn eri/Taidd, ooniinon brakes [PterU 

aquilitia].—liagh Dame*: Welsh Bot. 99. 
Adeinredyn y chwardaa, curled stone-tern, 
rock -brakes ^Pteri» critpa). — Hugh Daviel: 
Welsh Bot 153. 
Adeiriad, -au, »m. tautologj' ; repetition. 
Adeiriado], a. tantologicali repeating the same 

OiFeddl hirtalth, aMrialel, ly ffiaidd gaa Ddnw. 

Adeiriog, a. Aontaining tantologj or repetition ; 

tautological. 
Aden, pi. adeurdd, ed^ «/. [C. aifen, a leaf : 
cf. s.T. Adain] 1. a wmg, a pinion, 
Bat«nr dyiiyt diTchlod cJodryt rihlt aJtm. 

Cinbd^i.-ILA.!. ISf. 
AJlui o'l adfnv^ vt y trfodd adfnyttd oedl jn y gmtb- 
«7iub, a'l* Am! hyny cieda adtnfdd bfohftin A v&d. 

Dan d' rdg' ymgyigodaf.— £Uin. i^i; aUm. ML 1. 

Dyrclw'D ucbel ei bflynt, 

A pwln Adnjrdd y giniit] — Oronwf Ovam, 9S. 

2. a fin. 

J (/en pyagodyn, the fin of a fi^. 

3. the spoke or radios of a whed. 

QmiJUi yr alwyolDB hBTyd oedd Id (nniUi olwynkn 
moi; «u KdiolHU, a'a bothau, a*ii cunfgau, a'u Aadnydd, 
oedd dJI yn doddedig. — 1 Brvn. vii. 33. 

Adenedig, a. bom again or anew ; regeneoate. 

OoOn fad y Thai a ddaliaot adenedigaeth bedydd grtUt 
yn MOD am y rwu Orutiaa jn nnlg f d un adtnediff. 

Tr Adenedigion, the regenerate. 
Adenedigaeth, -au, sf, the new or second 
birth; regeneration. 
Trwr olohiad yr ad^iudigaetA, ao adnewyddlad yr Tipryd 
OUn.— r>l. iii. 5. 
Kid eyfrana cynn^dfau urwydd yw rtdettf^igrttih. 

Oto, Lcuiit .- Diydi TigT. 890, 
Adenedigol, a, regenerative, regenerating. 
Adeni, v. [geni] to be born again or anew; 



Bghorff tglwys Otilt.— 



AdenniU, ) t>. 1. to regain; to gain anew or 
Adynnill, ) afresh ; to repossess ; to recover. 

Omdi adfwnU <d dinK^d te wnaath Onffydd ab Bhys 
iriedd BBTbydeddiu yn Yatnd Tywi. 

2. to regenerate ; to reprodnt 



Adenog, a. {e) 1. winged; pinioned. 
¥ grlcbwy (Un y gymiry bn adataae. 



beb fwyd.— /Vj™" '•'•fa'- GoIwb.v 

Adenw, -au, »m. a seoond name ; 
an adikoon. 

Adenwi, V. to name again or anew; to re- 
nominate. 

Adepilio, t'. to repeople. 

Dwyfu a EHnhdi, a ddiajusnnt mnrn Hang fod, ta 
o honynt hwy ydd it4^Uiwg<t Ynyi Prydain. 

Aderbyn, n. to receive back or agtun. 

C^n ya y pMhadniiaJd a fenthycant t^r pechadnriald, or 
adtrbyn y cyifrjw.— IT. Saiabury: Luc >i. 34. 

Ad«rgynu, V. [cynn, cwuu] to reasoend. 

Ardori gvawT ypnmnifld dydd. 1 nef 
Tr fitrg^Mo Do^d. idd (d arii. 

W, 0, IHight : Ceinion AmD, 14T. 

Aderyn, pi. adar, «m. a bird, a fowl. See 
Adar ; and cf. Edrryn, the more common 
medieval form. The pL adtrynod is local and 

QieeU aderyn mewn Haw no, dau yn y llwyn, a 
bird in hand ia worth two in tlie bush. — 
Diartb. 

Hannerhnn jr aderjfn 

A gyagar, a himaf hyn l—D. ab amlgnt. "'" 5. 

IJe macer yr ad^iynf 

TuD trig ; natur yr hyn.^Z>no ab Imam Dm. 
Tr aderyn adeitigoch, the redwing. 
AiUryn bach, a little or small 1:ard; a joung 

A^ryn brat yr yd, j ^ bunting. 

Aderyn hnu y ddrutan, ( "•^"•^B- 

Aderyn brith yr oged, the pied wagtail; so 
called from its habit of following the plough 
and harrow : also called, for the same reason, 
tin*igl y gioyt. 

Aderyn brith g /urhei^Aderyn brith yr oged. 

Adtryny bunt, I the bittern: called also tomp 

Aderyn g burmp, J y gort. 

Aderyn y bum Ihiaf, the little bittern. 

Aderyn y cnau, the nutcracker or nntbreaker. 

Aderyn y corff, \ the corpse-bird ; a noctomal 

Adervt^y cyrff, j bird of iU omen supposed to 
be nuttenng and chirping about the door of 
a house or the windows of a room in which a 
person is about to die. 

In Jjeo. xi. 17, and Devt. xiv. 16, the Heb. 
coa, 'the Uttle owl' of the EngUsh A.V., ia 
rendered in the later editions of the Welsh 
A.V. 'aderyn y cyrph.' Bp. Morgan (IdSS) 
has in both passages 'aderyn y corph,' which 
Bp, Parry, followed by the subsequent edi- 
tions of the 17th and IBth oentiuiea, most 



ASETHOL 30 

Btrsngely cbangod into the unuauBl plural 
'adcryn y rorphau,' and which in the more 
modem editions appears as ' aderjn y tyrph. ' 
The same word is translated ' dyljuan in 
Ps. di. <t. The popular name ia ' aderyu y 
rirrff,' as given by Morgan. Adrryn y eorff is 
Bometimeg translated or explained by ' ecreech- 
owl,' the supposition being that it is that 
bird which hovers about in the dark ; and 
' lich-owl ' appears to owe its origin to a be- 
lief similar to that expressed by the Welsh 

. luTdd; ■ 

DluUil- 

Tr adtryn ryfinu'n. 1 the just orrighteous bird; 

¥r edrryn ryjiaum, ] a name given to the storh 
in the Prayor-Book venrfon of the Psalms 
published in 1567, and probably intended as 
equivalent to ai-lt pi'a of the Romans, The 
' ' 'lb retain the Lat. form riVontn, 



. OElf... 






Aderyit doetkimtb, the bird of wisdom. 

Y Gixwfriud pvybodua . , , s banhoit 7 ddflluAU, gan 
ei chyMf jn ' adervn dotUiiBfK' 

QwalUtr WuAiin .- OniUi, ij. G03. 

Aderutt do/, a tame bird or fowl; a domestic 



Aderyu y droell, the wheel-bird or goat-eucker 

^(!apnma!gu$). 
Aderyn du, 1. a black bird or fowl; any bird 

with black plumage. 

Ond yaadtri/fi du yi netbrra iV yip>1, HyDgigCmiddD, 
fel y gveli di, y doeuiym i adief , 

JforvU Livid : TrI Ad. 7. 

2. the blackbird (Turdue merula). 

CWeiri* KW Tfora 

Tdvymin dag. nferj/n du. — D. ab OtpUj/m, cX' 33. 

3. one whose absence is preferred to his pre- 
sence ; an intruder ; the black sheep (of a 
family, circle, or company); an outcast. 

Aderyn (or Edm) Owyn ah Nud/t, ft name 
given by Dafydd ab Gwilym (cluxiv, 40 : cf. 
clxzxiii. 25) to the owl. 

Aderyn grifft,'i'Aa griffon or griffin (in he- 

Aderyn grtff, j raldiy). 

Adrryn Uioyd y to, the sparrow. — Mid-Wala. 

it^lSg,',';^,,,. j«..l.e^-.P«ro,. 

Adfryn pen/elyn, the yellow hammer, the yel- 
low bunting. 

Adcryn pica du, a sort of children's game, in 
which one of the number, covered over with 
a dark cloak, a portion of which is made to 
resemble a long beak (henue the name), repre- 
sents a bird of prey attempting to attack and 
carry off chickens, generally personated by 
the smaller children, while another acts as 
the mother-bird, whoso duty it is strenuoualy 
to defend them. The play is caUed Ohware 
adfrryn pica du. 

Aderyn Sant Martin^Edn Sanl Martin, q.v. 



Aderyn 8atU SHin, the hen-harrier or riugtaiL 



Aderyn y to, the sparrow, the house sparrow. 
Ovyliui, u! ydwyt fel odtr^ jf to, onjg ar beD j tf'. 



Lie. mpwii ffrnidwydd, plwys-wydd glyii, 
Mm tfr oi-i-s^. (™ir»*ir.— £a«. I^r: Si 

yn, to lodge witl 
under a hedge. 
refuse; what is rejected; 



Bod yn Uetly yr aderyn, to lodge with the bird 
to spend the night under a hedge. 



Adethbl, -i< 
leavings, 

A'di gudjLcl cbwithan jn cdrAol oewidwrr ft llafnrwyr. 



r-) 



Adetbol, a. that is rejected or outcast ; worth* 



Adethol, V. to rechoose, te re-elect. 
Adfhch, -au, sm. [bach] a barb; the beard of a 
dart or hook. 

Ersydia si bioell uto t'i ludl rym . . . tniddia y dun 
lulani drwy 7 cnat t^^w, ae ymwtJiiM ym mhi^HNi lu^ 
ad/acA yo f oDftwd- — CyleAfiraien, i. Sea. 

Aii/ach angor, the fluke of an anchor, 
Ad&ch, feichiau, »m. [moch] counter-security. 
Ad&cb^aeiddio, v. to become a child or boy 

again. 
Ad&chiad, -an, rat. a barbing; a hooking 

Adfochog, a. barbed, bearded; hooked; hooky. 
Ad&cliu, V. to barb anew ; to re-hook. 
Ad&i, feiau, am. a great or double fault. — P. 
OmJloaTftd uiftv uioeth iJhK. 

Cgndddv: HA. L *90. 
Ad&il, v7.adfeiliau, adfeilion,«7?i. decay; ruin; 
the fall of a building; debris. 
Ar ad/ail, decaying ; falling int« decay or into 

ruins ; ready to run to ruin. 
Ad/eilion adnit, the ruins of a building. 

Arm ad/nil hU Aleiander. 

G'. a» .V'lrdj/dd: H.A. i MO Icf. M7). 
Prydtertb heb neb rbyir ad/aii.—Gnmag Ohi', IS. 
Ad&in, foiniaid, «in. [^. advena]:^ Ad/an.— D. 
Ad&l, tm.-=Adfil, Adfelydd. 
Adfiui, pi. edfyn, sm. [L. advena^ a stranger, a 
new comer ; a foreigner. 

Gwr gmtoAim am n'tnnn atW7ii. — Cinddtlw: H.A. 9S7. 

AdCaur -au, », [man] a station ; a retreat. 



ToRynt tomdTynt uch U% iflniii. 

.. [ban] a secondary point, stage, 
an advanced division or por- 



'8" 



Adfanau Ueufid, the quadratures of the mcx 
the baiiau, aa compared with the ad/an 
being the syzygiea. 



Tri bendiUi ni ad/a 



sidiUi DJ ad/asi dra dhc i neinii nac i naothnj : 

ci borifflawT ; benditli u^lwyda priodAiWr ; h ben- 

■ai lioollngerdd.— Jf^. Ardi. iii. use. 

, -au, mn. [maut} a harelip. — P. 

Ad&nt, fannau, em. [bant?] apparently the 

same as ad/an (q.T. and cf. Ad/aiiog) ; but aa 

the word is known to occur but once, it is not 

easy to ascertiuD the sense intended. The 

signification is not very apparent ; 1 translator of ' Barddas ' gives ' that is restored 



Dyddiau rtu^rsedrl a rha«ad&Lr ydynt ddyddba bao 
Umad 1 aef j c^luf , dydd newid Uf nod. b. elvir <>iiteAii j 
Oeijwl; 4^ ail y^dydd haiuier cyimjAA y UeoBA, a^lvir 

f fjam lloDBid : a'r pedwcrydd yw"r nd/an ciL lef humet 
at y Ueiud : ac ar t dyddiau ban oc id/an UeaaA b JD J moe 
cfmul ihH^uTBSdd a rhaocajlair. — lolo Xss. r^. 

Q-waedd uwch adfan, an eipresHion which occurs 
in 'Barddas,' and diaapud uiech adfan is found 
in the Welsh !Laws, in which latter it appears 
to be OTnonymous with gwaedd uaicA ajneu, 
which likewise occurs in ' Sarddas ' and in close 
connection with the preceding phrase. The 
jirecise signification is not very apparent; 
but it seems to ijeuote a cry or proclwnatioii 
for icturuing to primitive or earher usage and 
tradition, and has been sometimes translated 
'a cry of re-arrangement.' Adfan (aduan) 
and adiktM (adnau) in the Welsh Laws may be 
rimply a diBeient reading of the same word. 
Tsfr grmedd (an linrdd Yaya Prydam j aydd : 6medd 

tv^tdd wd\ od/an, drag a wueler ys aunefod a an^ien 
■maer ac achoa, OK^yii cynnal {Adair a ^oreedd jn amuv- 
parthui o ]« ac auuer, mal pai yn auams^ ban hatd a 
Dniad, Den Us Has byddo yn wyncb haul a Ujgad golsoni, 
a bypy gan raid fto anghen ; acniiigellircyfalli^aTawiKleT 
gan tcaoti <Bcrh ad/an fny ddelo 'd ddotodawl gan onedd 

ovtw a rhybodd anffhoi a gorfod ynjr bo anuDlw^ ai aohoa 
VTuT laid gwlad acheiudl. — BarAdasy 11.46. 
Tail dla^iad uweb ad/as [of, adneul y aydd. 

Ad&nach, -od, feneich, *ni. [manaoh] a recluse, 
a monk [probably with some depreciation]. 



I Adfestds 

Ad£uit, fannau, im. a return or retrogression. 
Tn Aber Oubwc aweu a gsniuit : 
Tan^nnf goo TTmbryt : 

Afl klglea naa olyw heuyt. — Lij/varth Item A.B. 11. 306. 
Adfref ad/nni cof dy rygodl 
Enlacsdiuuydigom.— J/n'Jtr.' M.A.i. ISI (d. 2M). 

it G<ralchatai: M.A. i. S30. 
I, advmliui\ to return ; 



Ooh Duw vynt a ad<ia<it,—Cgf- 
Qolut byt eyt dybyd. 
Atvaed chvsut oiunni ribyd . 



■ daw ay vnehyd.— 



Ad&nie, -au, - 
(in mumc). 

Y moa gofaAW «ybyd a dau ad/a 
daa g^slanig.— &rTii Gatner, xx. 20 



[min, bin] a ininim 

ad/tmiff cybyd a 

Vr^ J doflen hoD. fe vetlr Tod on baniff yn cynnvya 
dcD odJat^.—JchK MiOi: Gram. C^rdd. iT^ 

AiHanog, -ion (i), a. prominent or conajacuous 
in a secondary or inferior degree. 
Banogion, ad/anogion, ac ammanogion, points, 
features, or characteristics that are prominent, 
less prominent, and non-prominent. 

" Ba^dda^^u (of. M.A. iU. B4). 

t.. [adfan] a stranger or pil- 



Tiliuii.' A.B. U. 1S3 (of. M.A. i. M£). 
Ad&nt, a. strange, wonderful. 
Bydii»rrwi<(>»>al 
no ■yitbyiidhunt,--IUiuin.- M.A. i-K. 



Dbn yw'r mwyai a^r anfelditil ai bdb difaat, 
Daw yw'r mwyaf a'r anf pldrol ar bob cymmaDt 
[At. ad/aal^-aranunt— «lfaul^-elfyddiaiitL 

Ad&on, a.pl. [moon] the populace, the a 
people. 

Hat Tydla yagav y Qw yi] a^wm adufum 
' -' Tj (ebedawc Da mordwy alon. 



MA. i SOI. 

Ad&Tcli, feiroh, «m. [march] 1. a gelding.— P. 

Cyital y march a'i a^/iirct-wertb.— Marr». (M.A. ill. IB 
RbaliBVdy 



ai ladlaon medod. 

2. a horse imperfectly castrat«d. — S. 
Adfkrn, -au, if, reversed judgment, verdict, 



179. 



Nead ad/am CAdarD codawl Berthedd. 

Or. ah Mtrtdi/dd : M.A. L 489. 
Heb ad/am dy lam. Fab Duw, 



afydd.— 



Ad&miad, -au, »n, 

a repealing. 
Adfornu, v. to rejudge; to repeal or reverse a 
judgment or decree. 
Kid adfan, cettau old gau daOTawd. 

Mcilir: M.A. 1. 1B8. 
Cawsant gmnyd fam old nduemjtl fylh. 

JfwlDji at OKalUer.- M.A. 1. 404. 

Ad&mwT, w^, 1 im. onethatreverseaajudg- 

Ad&mydd, -ion, j ment ; a repealer. 

Adfiath, -au, »m. a reooinage. — P. 

A^lfatihUj V. to recoin ; to coin anew. 

Adfawl, gm. responsive praise. 
Maiel ac adfawl, doxology. — Llanover Ma. 4. 

Ad&wn, <.d. (ig. -en,/.)&8m. [ma wn] cut peat 
or turf loft on the turbary over winter ; poat 
of the previouB year's cutting. — Meiriott. 

Adfedydd, -iau, sm. anabaptism, rebaptiam. 



„Ct>oi^le 



Adfkdtddio 

Adfed7ddio, r. 
baptize again 

Adfadyddiwr, wyr, *m. an anabaptist. 
Yr Adfrdyiidwyr, the AAabaptists. 

Adfeddalh&d, <m. a re-softening, & re-molli- 
fying. 

AdJEisddftLhan, i'. to re-mollify, to re-soften. 

Adfeddalu, v. to re-molli£y; to be ro-molMed 
or re-Boftenod. 

Adfeddianniad, ) -au, »m. a rei>ossesaing, re- 

Adfeddiannad, ) poBsesgion. 

Adfeddiannol, a. repossessing. 

Adfeddianuu, v. to repossess ; to possess again 

Ond er. f a1 io&p achm afiii, ni att/f^dinnnw^d ond ychydj^ 

o*i aurhiiith, da fu*r Uwydd i achub rhyirfauit a'i ^afuK. 

Mo Slorganw) (Cjtr. y BeWd, Bhlgdd, M). 

l"dSS^k,Toi, ) •»■ • »!»"•«'■ 
Adfflddiont, isunan, mn. reposseBedon. 

Adfrddiani (hui/n/a. Paradise Regained (Mil- 
ton's poem BO called). 

Mf miLTiJ fw run Adjniiiuint Oieyu/a y bTddaT jn fudd- 
iav], a ph? ffcllid rael i^yiukDrtlLWT rliai o bleidiau trefydd. 
y bydd&l b^yd et ennill. 

W. 0. F^ahr (arm Oomer, n. IBS). 
Trbrr iawn y buniBi'in hanwyl Imim ir«di cyfleitha hotl 
Ad/r/l/iuinl Htcrf"/" lyo 6i fu-voUiith, oni biiomi tod crm- 
mnint Q'i uniier yn cael ei jymxDPryd i fjny i ddfB^ iutb- 
afdd.— tot, Uarnn : CoBant leuan Ddn, SB. 
Gwjw tfwthus Pi frrft^itbad. 
A'n urwlodd D«ld tn iaith ein ffiriad, 
MrddrSDt; Jil'rd<fuix(6i>''I.nyafad; Ovrnfa 
Miltm, grinfa^tli ganlad.— JV^.- Gvaltli, m. 

Adfeddn, v. to repossess; to regain. 

Felly cnmant Hywd a Hrredydd n^nfilu tywytogaetb 
DeheDbutll.— And Abrrpcrfvim: U.A. li. MS. 

Adfeddwl, yliau, tm. a second thought, recol- 



i, «m. recollection, reflection, 
think again ; to recollect ; 



AdfeddyUad, 

AdfeddyUed, „ , 

Adfeddylio, [ to reflect ; to revolve 
Adfeddwl, ) mind. 
Adfeiod, -au, am. rocrimination. 
Adfeiedigol, a. reomninatory. 
Adfeiliad, -au, am. a decaying; a falling to 
ruin ; decay, dedino ; ruin ; Slapidation. 
Nid oeg o'i ol yn awr ond arwyddion Bd/riiind, 

a. UerJiaia: Gwidth, U. 853. 
Nid oedd yr olw gynt^f ar adfeiliadau cnwo^ yr Abatty 
yn at«b fy iiiH^wyEadau. — Cj/lckymwn, I, 'SH. 
Adfeiliant, tm. decay; dilapidation; ruins. 

Adfril^ant. Aiwhof 19 eiddioiTis budd 

Tq oera dwyu ei angcUen lalth.— If. 0. Ihighf: Pal. 1. 

Adfeilig, □. m a stAt« of decay; decayed; de- 
clining. 

Ac yna rbaid [ cbvi ymdol 
Uewnmawd od/tiHu.— IT. O. Puflu: Cein. Awen, ISO. 
Adfeilio, V. to decay ; to fall into ruin ; to de- 
cline ; to fade. 
Adnewydu a oraa J kryryd ■ abK^ljfnt ae adcylat flreyU 



nmid dtVdoll.— Jfnii 



NT dfvf hanllyi atutittdic ac yndl 



2 Adper 

W^/a-forf/ViVtfA'fl.wom-out or tattered clothe*. 
— MuWntjp'oii, ii. 24. 
Adfeiliog, a. decayed; in ruins; ruinous; de- 
caying ; dilapidated ; failing. 

BufttTBilyBuceiiffwirodeu,— T'lVi'*!"; M.A.i.Sl (tf.SSl), 
IXnasoedd ad/eiliog, dilapidated dtios. 
Adfeilliog, a. [mall]=Jt//«V,-03. 

O osgord VynydaiM am dwyf alfrills-xi^. ^^ 

Gall Vynydawc bo ai«iUjro«K en fwirodco. 

tfomla. T»l>nfc*.- A.B. iL M. 

Adfeiriad, -au, «m. [adfar] rcpfclsion. 
Adfsirio, v. to repulse, to repel; to drive or 

beat baii. — ^P. 
2. to blame, upbraid, chide, rebuke, or reprova, 
HaTorwyn brb yr iarllw. nyt bairf jfumyfl dr iWotwht 

di -n bynny. ood dayeit bag™ y miiui™ trmlaw »:wa1h 

A phan adiutbu Hector byny, anffbirifftiaw d wraif a 
ornff, a'i ktii/rirww [multiun ino^mnH Ajidrqanacbaia,, a 
pberi cyrcba ei aifau.— i'^ion Drnid, \ Gi- 
Adfbiua, a. recriminative. 
AdfbiwT, wyr, em. a recriminator. 
Adftl, \am. [mal] personification; charac- 

Adfelydd, ter ; simile, metaphor.— rniu/e<: 
Adfftl, ) Ll^ovei Ms. 

Adfelydd, -au (r), am. a pattern or exemplar ; a 
sample or specimen. 
AdfrltM, eynllon, dolw, tyfritb, mmpL— O.F. 
Adiel, jsl. edfyl, im. a stranger; one come in. 



-P. 



A, adiKd] gDcblywer eo 



Adfelach [?]. Found only once, with variants. 
Ciiat Ie«u a wyliat. 
RirvBC rihyd unnat 
Ad<iiUKA kaffat.-lUi«>i> ; A.B. lis. 

In the ' Myv. Arch.' (i. 88) : 

AdiElaCb caffid [a'. Dm yn dtwOi BdaH mad, yn pm 1& 

Adfelwr, wyr, wn. p>elwT] a recruit.— i*. 
Adfelyddu, v. to re-delineate ; to design anew. 

—Llanwfr M>. 1. 
Adfent, -au, 

Used only a 

Snl yr Adfnt yw bob aioBCr y Sul nesat at Wyl a An- 
toaa, » un bynnait ai cyu ai gwodi. 

Ugfr IJtcrddi Os/rnd.. 
cyntaT o Adf'ai hgb udkt ydyw bi 



f tddo . 



\n Winpfyr, Dcu ar m 



Y Sul cyntuf yn yr Ad/tru, nnu 
Beth yw meddvl y gair Adfinl 



Adfsr, v.=Ad/em, Ad/eryd. 



33 



Adpiasub 



yng Dnrdd Ed«D o Oatm T cirynip, kc jng 
gmndd Duv juni kad/fr ani'hetn. 

Jeuan Bryda-ld Uir: Preg. i. «. 

Adfer, -ion, -au, #m. restoration; renewal; 
recovery ; reatitution ; what is carried back 
ot returned. 

O pop ad.irr f lotot oToder djchlfaeniwt. 

roliun- A.B.ii. ITS. 

Ar adfer, restored; in a restored state or oon- 

Omi. K brth rnvT aid int nr goU ! 

lolo Moraamc): Satm. I. IrxviiL S. 
Dicya or adfer, to restore ; to bring bock. 

Bairdd. ac airdanm, ac aUkrawoa ... a dd^goMant ar 
adftr lawer a't hen femrau eerdd. 

Ct/rifodi » BrinM. S Irf. »). 

Adfersetb, -an, «/. restoration. 

Ad jn ol rtdJmuA j deml oi rhyttwicat hirj loewn 
nioddynrbyd iHcpjd.— iUtmnJ yaiiM.- Horn. li. 89. 
AdfiBr»dig«et]l, -au, i/. restoratioD; restitu- 

Adfaredi^I, o, restoratiTe; recovering; red- 



Adferedigolion, restoratives. — IF. 
Adferh&d, rm. restoration; restitution. 

Yq eurfolMau iddjat hwr owol 
FalduwuD Uf bnmt VbUwcE, a dd/crUd 
Eu Dcrth, ao aid o oddef gsllu mHy. 

W. 0. Paght: CO. i. 3CI». 
Adferhau, u.=J<;/ct-u, Adferyd. 

Ond drvj so- ni oif/A-A/ir, 
TrwT tnni nil codid.— W. O. PueSe : Pll. SB. 
AdAiiad, -au, rm. restoration ; reetitutioii ; a 
restoring. 
Tr hwn sjd3 nfd {"r net d ddobrn byd amsecoedd uf- 
Jrriad pob path. — ^c(. liL 21. 

Jr Adferiad, the Besloratian (of King Charles 
n. in I860). 

T man rhai *to in (pr t% aydd in co8o j- crenlondl* a't 
toalCTa ddiodd«f odd raoi ym mhob man. a mwyn cydwybod, 

At AAJtnad Biarla yr Ail. adferwyd yntan hefrd i'w eti- 
KddiaetL— (7. JfgcAati .- Qnjth, ii. WO. 
Adferiad, iaid, ) tm. a restorationist ; one who 
AdferwT, wyr, J heliovesinafinalrestorationor 

recovery of all men ; a univerBalist GwydtL- 

<miadar Cymreig, i. 66, 
Adftoriant, em. restoration. 

Te^ ab Banm ... a wnaeth dnfn dda ar ddyag a ?wr- 



bodaMli, an a buvdd adfiriani 0*7 hen ddysg a ^1171 
adh oedd vedi myncd ar led^foU.— fo/o Jfn. T. 

Adferol, ) . .. ^ . _ . 

Adftriadol, j "• "storatavo; returning. ^dflagurog, a. budding 

AdfereSiim, restoratives, analeptics. 

Ef«lly, mal ail wreidilyn, ynot tl 
Adfenr 7 eyoials og n frdd 
JdfiMB.i,hebotneb.— IV. 0. PugU; C.Q. iii.317. 
Adferth, *m. [berth] that which is made cheer- 
ful, comfortable, or fair.— P. 
Adforthiad, -au, sm. a cheering ; a matdng fair. 
AdCertliol, a. cheerful; comfortable; rebeanta- 

fying. 
AdArtha, v. to cheer or comfort ; to make fair ; 
to rebeautify. 



AdArthwoh,im. thestatoof being rebeautifled. 

AdArti, 1 IT. [ad- -I- ber=L. /ero; Qr. ^epa>; 

Adferyd, J A.S. tw<n,- O.E. ierc, berf-nj E. bear: 

of. rymmeryd, gvrrthfera, berfa] 1. to restore! 

to return ; to give or carry back ; to reinsti- 

tute; to make restitution. 

T Tlwyd™ rar wyneb yd olnemic^t Owoin a Onifud . . . 
y kjoiirt Penied y Oynan.— fl™l j, Tyas'^sim. 3SS. 
A ddagangwi, n»dad/(T,=Ang™ airyrch, acnidad/T. 
Tna yr adfrra/ i'r bobl wefoa but.— «.jpfl. iil. 9. 
Gafodd Uorgan ei ad/rryd i ptifpddiapth cL bynnflaid. 

D. f'l'--: Uui. Cret. S88. 

2. to determine, t« decide. 

O derTydd i ddyn vnenthur amfod, ac na ryno ei gadv, 
ar Da wafo jt amfod ; jr amlwyda biaa nyaJiell ei gadw, 
fa] ei \a4/rro yr untodwyi.^Legrr Wallic'ar, n. Ti. 4. 

AdArwi, v. to boU again or anew ; to rcboil. 
AdferwT, wyr, $m. 1. a restorer; one who makes 
restitution. 
Ac ett fydd i ti yo ad/fncr eiavxa.—Xuih iv. 15. 
2. one who determines or decides ; a determiner, 
bfidiv faj o 



anil ad 



. otHhU 



Adferydd, -ion, >m. a restorer; that which 

restores. 
Adfeaur, -au, am. a second u 



, to 
AdfesuTO, j anew ; tt 

over again. ^.WaH. vii. 2. 
Adfbsuriad,aa,s>n.aremeasuring; e 

Adflleinio, v. [milain] to become brutal again ; 
to rage again or anew ; to rcbrutolize. 

Qwalth g^rfr Shafain yn byn, gwaitb beilfihion rhyfyg- 



tVyrap flflo/a(» 



Berth tniFsyiDsiiiByD ymdaiugrl ac yn aifitrinit, 
AdfllwT, wyr, tm. a recruit. 
Adfln, -ion, *7n. a back edge. 
Adflrain, a. unadorned, 
dve to tbc sight. 

Orelais en Irychni tnchant cell 



Torfocdd ymaaffryn tarf ymy^raLn. 

CVnAWb.- M.A. i, 

Adflreinwcli, am. unseemliness. 



Adflagur, «.c'. second buds or sprouts. 
Adfla^itriad, -au, em. regcnuination. 
Adflaguro, v. to regerminatc ; to reblossom. 



Adflttg-uryn, mt. a second bud or sprout. 
Adflaa, -au, em. an ill or insipid taste ; distaste, 
disrelisb ; a twang. 

Rboddlad yr emyn gan aiaJl, oedd yn ddiffael yn ereu 
Adflaadod, em. insipidness. 
Adflaau, v. to have an ill taste ; to retaate. 



Adflin, a. fatigued or tired over again. 
Adflinder, -au -on, n». second fatig^ae; irri- 
tation. 

Adflitli, -ion, tm. second milk. 

AdSithiad, sm. a second milking. 

Adflitho, V. ia have or yield second milk. 

Adflodau, s.pl. second blossoms or flowers. 

Adflodenod, -au, am. a. blossoming anew; a 
secondblosBomingor blooming; Kmorescence. 

Adflodeno, v. to reflovuish, to rebloasom. 

Adflodeuog, a. blooming, flourishing, or blos- 
soming anew or afresh ; reflourishiug. 

Adfod,v. [tid--i-bod]l.tobeoreziBtagain; to 
re-exist; to be. 



Adfre*ycli(«<r.adfre8]rclien),«.pl. sprouts, fomig 

coleworts. 
GellTch dynn i fjnf f brarch OTdiJco . . . •'n Aoddl 
niAA fx miryii a^/tt^itck. — CyUhffrttvn, i. 08. 

Adfrjrd, -on, *tn. animadTeraion ; reconsidera' 

Adftydol, 1. animadTerting ; reconsidering. 
Adfiydn, v. to animadvert; to reconsider. 
Adftidd, -ian, am. what is not profitable ; loss ; 



Abigd mwT *x OtmiTT cralii vwtiifviUi rwmluirt. 

IWfcm.- A3. U. 
Tm pwrlkd oewid iwiid adwtf u 



A^fgdd^ BMt mm 
A4/ii geUIgWa 



Dumb. (M^. Ul. 1*6.) 



Ete>wdBddTUrDd,acaadjiaidd7fi>l ic ■ ddylal 

aM, M ■ ddyUj ddufod, ae & ddylu ^ydfol, u ■ ddylat 
od.— /did jf«. lee. 
% Conjugated like bod, and found in several 

of the tenses.' Of. M.A. i. 64, 133, I 

233, 2d8, 278, 294, 299, 325, 333, 464. 
Adfod, -an, tm. a second being 



Tub efe s ddeaJI j peth ■ Id dik . ■ . a pbob nnmod ■ 
phab earphvTa, ■ pbob bod ■ phob uilod, ■ jibob ad/oi a 
pbob OJiilOd, s phob BBUedig a phob uuUbdia. 

Adfodd, -an, »m. a secondary or dependent 
mood; a mood not used to make a direct 
statement. 

Ni wrddai telidd 



m gobeardd.— ffr. ab Ita. at U. f>eladi. 

Aditoel, a. bald again or anew; portly bald. 

Baost ndfo, boat adforl, 

Sfr Or. FgAati, i lAng Le*Ti. 

Adfraenar, -su, <m. a second fallow; land 

twice ploughed. 
Adfraenam, v. to plough a fallow ; to plough 
the second time. 

odiau, »f. a contrary 

sqnent 

judgment, verdict, or dedsion. 
Nrtstnwdadonnsluhnbyan.— rnliuiii: A3.iL140. 
NibyddbiHWdbobeihutAwAJ.— INarek (U.A. ii. IBS.) 
Ad&ef, -au, »f. a reiterated lowing or crying: 



a repeated cry. 
Adfrefli, v. to answer with lowing o 
to reiterate a cry or groan. 

AiiftfJ Bdfaiit oof dr TTEodi.— ifnlir; M.A. 1 



cryingj 



Adfiiddiog, a. unprofitable; profitless; that 
damages, 

Owned m drasd o drin t, gmsdlid kin 
A rwaedkujm aduH^rawv ■ . . 

A gobnur mui n loaliiiiyiiin:. 

U^vktA ab UfKtlfi,: JLA. L SOS. 

Adftiddiol, a. nnprofitiug ; profitless. 
Adfwl, tyliaid, tm. a castrated bulL In some 
parte called btvla. 

Udodd, Hi pheidkidd j Arl, 

Udfft debre i adfiiil.—T)u>mat /Vyt. 

A rtuii*r a^fioit br«bwl briB, 

Wxbodiop.vrtliiibedBa.— JflyiJsHU.' Omith, ise. 

Adfvlch, fylchod, »m. a name of the salmon, 
being the 7th oif the 13 appUed to it, each 
name denoting a oertain stage of growth or 
development. See Eog. 

Adftniod, -au, $rn. a recasting ; a casting out 
again or anew ; a second intention. 

Adfmw, V. to cast or throw again ; t« reoon- 
sidcT ; to sprout or germinate anew, 

Adfwynliftd, (m, re-^oyment. 

Adfnrynhaol, a. re-enjoying, enjoying anew. 

Adfnynhau, v. to re-enjoy. 

Ad^jrd,-au,ini.[ad — |-b^d] adversity; calamity; 
misery ; affliction ; tnbiilation ; distress. 

To nhntnrr ibced nia gellynt Da cbaff»l nit gmled an 
gvybod ar Ddnv; yna'r gwjutjdoUfax a gadnjuit on 
niniawdd drwy gadv Duw a^i ecw ai wltiqmedd ar got, a 
welMaiit dntn yi abred, ae al gBlmnnt aranr j<i</H. 

Aim pob hir drirtwdi.-Z>idn«. (U.A. Ui. IM.) 
Qnaird od/fif td ol bmwiedd. 

Ea^l. Etr» Ifrv^ ■■ U A. L Ui. 
Mwy na> bcU ad/j/dau hyn tw rhyfel. 

tfru/-. (fysH.- Tttyr. I. B («). 

Adfydig, ^d. being in adversity, distress, 

AdfyduB, I trouble, or misery; adverse; ca- 

Adf^diog, ^ lamitoua ; distressed; distreasfnl; 

miserable, wretehod. 

Uairer o iremidcwCan & gedwii to j fsth nflm iaal an 

ad/i/iii^, ffll nai gflUir duevyl dim o^r fub bctb odlU 

wruiyiit.— -ftr. (him, 108 (of. T0|. 



Adtydiol, a. disti«8aing, distressful, calamitons. 
Ad^dwch, tm. adversity ; calami 



Y FnvhwTd Daniel, ffwedi <ddo benwi Ua 
anobvanwodd [anffhwaiwoddl t gciriau hvu. 

kSi i>inj.' DrexdfDB, iO. 

Fa nmr mewn tnBod t aopaamnHddnwwna4>Aackf 

Xot«rt ZJ^/T LlwTbT Hyff. >7B fal. 4«). 



Jm V_.(,K)t;iL" 



Adftbth 



35 



As>mmnoL 



Adfrdyn, nn. one in advemt;, dutiees, or 

calaiiuty ; a poor wretch. 
Adfydd, V. 3rd pars. aiag. fut. of A^od, q.v. 
Adiydd, oilv. perh»pa; poenbly; itnwybe. 
AdfTddin, -oedd, «/. a oorpa of reserve ; a bodf 

of liwips spsrt from Uie main army. 
Adf^ddino, v. to form the line anew ; to array 

or arrange again in the order of battle ; to 

re-embattle. 

A <di«Us« iddd iMbdB, 11am d Hi 
Tt Arfii'ridhni, trwy ■! Berth ai (inll 
Tnirnicdirnui.— Ik. O.f^lm C.G.tLSSS. 

Adiyddinog, a. re-embattled; oTTayed again 
for battle. 

A dhan ynjnlMifi at fll nchderef 
To mitfgMaatct mtsiit oil jn Snan. 

/. D. F/TBid: Coll Qwyiifa, tL MP. _ 
Adfyfyitlod, -an, am. reflectioii ; reoondderation. 
J4fwfwr4aiod ar r trnuBoran. 

(hmUtcr Jr«*iin: OniOl, iL SSt. 
Vt bfddal laid i ohwi ganJin y eorff ?wehr gyda^ od- 
fffurioiau <taierwtBL bra I— «jt/ci<ii>liHi An<v. 19. 
Adfyfyriad, -au, nn. a reflecting ; refleotLon. 
Adfjr^iio, V. to reflect ; to remeditate ; to re- 
consider ; to meditate. 
AdfyfVriolf <i* Tcmeotiiig, refleotiTe \ reflex ; re- 



Adfyfyrion, t.pl. reflections ; meditationa. 
Adtynacli, -od, fyneioh, »m.^^Adfanaoh. 
Adtynegiad, -an, «». repetition ; iteration ; a 

recital; reindication. 
Adfynegol, a. repeating, repetitious ; reindi- 

Adfynegn, j v. to exprera, tell, relate, or de- 
Adiynegi, ) dare anew ; to repeat, to mterate. 
Adfyriad, -au, tm. a recurtailing, a reabridg- 

Adiyra, V. [byrl to recurtail, to reabridge ; to 

ctuiail or abridge anew. 
Adiyw, a, 1. reviTed, reanimated, rerivifled; 

brought to life anew. 



nffantm ben 

odvnt i a dian uumu du hwiiuvu' 

Wa lla>dd TiBCndd hrd f]r«boedd 



enTD JT odef laolber. y 
an haDafa jn adfyxi, UD a 
tQ nsHh aoadl Daw th- 
Id 7 ffypob drn Tioalth i 

~awr mgwrddcodeb. 

HiaoidM: 

2. half-alive, half-dead; barely alive; almost 

dead. 
Nid mo ond adfi/ia, he b but barely alive ; he 

ia afive and no more. — C.8. 
Adfyw, V. to revive, to reanimate. — P. 
Yllwithad/yu>adwy,th.ooTderAlgae(mibe'lia- 

aeaxieytiteia).—Mugkl}avie»; WehihBot. 110. 
Ad^-w, -oedd, tm. fallow ground. 
Ad{yw, tjn. renovation ; an old name for ApriL 

— Ltaitovrr Mi. 
Ad^irhAd, «nt. reanimation, revivification ; re- 



Tti ^latr ertanuiHg bardda* : Fair Ceildinn, aef hynjr, 
iliad ft Taprrd OUoi Viiz Dadsni, Kf hjriy. adfs^Ud o 
fedd ae asgea ; a Phair OffTTfan Oawr, ■« (uriail a char- 



Adfywhsn, V. to rerive, 

revivify ; to recall to life ; to enliven ; to 

Bfdded lawoa gomn aifywluvt ^vetthtawr mdd on 1>d 

Qrw, Tularin, o dr ledd-eell, 
drv. aa adfm'tfl'^ dy briddell I 

Adfywiad, -an, »m. reanimation, rervivifioation ; 
revival; retreehment. 

T mae oiladiad yr haul bob boren ya dwyn rhyir adfipD- 
ud riiyf add bviuuradlol i hoU naturiaeth. 

TA. CItarIa, a.T. 'Adgytodl.' 

J^/V*""*^" t*^fyddU, religion* revivals. 
Ad^r^vlaut, annan, nn. reanimation; revival; 



DiwrHivuh ...Mr dtik 
with bnaeimoldflb yr Anlirydd. 

J. tvibiami: Or. Byr. (AoC ItL le.) 

Adf^wio, V. to revive, to reanimate ; to call to 
life; to refresh; to resuscitate; to become 
revived or refreshed. 

Efe a yfodd, a'i y^ryd a ddyohinlodd, as sf e a a4/)rtB- 
Adfywiocftd, »m. reanimation, revivification. 
Adfywiocaol, a. reviving, reanimatiug, revi- 

vifying. 
Ad^rwiocftn, d. to revive, reanimate, or en- 
liven; to recall to life; to refresh; to attain 
fresh vigour or energy. 

Aa nld Mdd ffvfr doetbkn ya meddni nai petb am- 
mboiibl yw bni ; gaa fod Plalo yn yigillani ddartod ad- 

fgKiodiu on Brii o Aimsnla.— Jav. Samuel: thvtiiu, iL & 

Adfywiog, a. revived, reanimated, resuBoi- 
tated ; refreshed ; full of animation. 

Ad^n^ogi, V. to enliven, animate, or invigorate 
anew ; to gain courage ; to take freah courage. 
Ni ddymdat ddim ychwaiue ; ood nad wyf 6 bjrth yn 
dianyl fftrolfld ein He^lvyfl yn se^dlog. prif Qriffoaoo^ 

lIodeuD yn eln^Ui, byd oaid arfenr y Cynuoun Baootaidd 
yn fynyobaoh.— iaw. Samial; Hyn. Oym. 168. 
Ad^n^ol)". reviving, reanimating; enlivening; 
reviveacent; refreshing; invigorating. 

A*T gwrra adfyviatot wsdi^ deffio oil. — W. SauatUn. 
Ad^ivydaath, -au, «/. restoration to life; re- 
animation, revival ; regusoitation. 
Tri ahyfnod rwyohdig- dya ■■ oattael bywyd, mal oad 
enAld yng iweDAdlgaeui. nau wU^itj/dtvA o levyg. 

BariAu, L IM. 

Adffiwtba, V. to refertilize; to become fertile 
again. 
T piyd byny y fadaim, byd onl bydd nn amnr, ac effaith 
Ti awyr, wedi ndfaelln, an yn bared 1 ddloddef tytftJyb 
drtaiaetb.— .^j»««m Ovfn .- Ajnaetbyddiaatb, 9. 
Adffoi, V. to flee back or again ; to hm anew. 
A doubtful word. 



'. ab MmdyU : H.A. 1. (S9. 
Adffiirflod, -au, nn. a forming anew; a re- 
forming; re-fonuation. 
Adfflirfledigaeth, -au, (/. re-(oimation; re- 

Adfhirflo, V. to form anew or again ; to shape 

anew ; to re-form ; to repair. 
AdAirflol, a. re-forming ; forming or ahaping 

anew; re-formative. 



jM.V_.(,K)t;iL" 



a who re-forms ; a re- 



Adfiyiiiaiit,iaiiiiftu,*ni. areproBpering i aproi- 
pcring anew. . 

Adfiynu (j?), V. to prosper again or anew, 

Adgadamh&d, im. a Btrengthening or fortify- 
ing anew ; the act of reinforcing, 

Adgadamliaol, a. strengtlieiung tmew. 

Adgaidamhau, v. to reinforce; to refortify; 
to strengthen anew ; to reconfirm. 
Yn amacT Murinuk Hen . . . ^wnaethpiryd tfoFn a Ao^ 
puth herwydd B fu eynt gHii yibeaOymrTiagerii datod 
al phertbynKaan , , . er dvyu Hr md^f m'a hndgaJan^au 
dan funi a phwyll, — lolo Ma. tli. 

AdgadamhftwT , hawyr, am. one who reinforces. 

Adgadw, f. to keep again; toreserre; to keep 
back; to retain. 

Adgadwad, -au, am. reservation; the act of 
keeping back. 

Adgadwediga«Ui, -au, if. reservation ; re- 
preservation. 

Adgadwedigol, a. reeervatave. 

Adgae, -au, tm. a second fence or guard. 

Td ^oedgne y pwnaetJi yr hall ddukr, 
O wea-girt binutet hyi Aber IMr| 
Aflif^f f iDQTtffild bu Ed^nramam, 
Adam, Daf ydd 0am ocdd ti rymhar. 

L.a.ColM,,.xyii.il. 
Adgael, v. to recover, to regain, to rcfind. 
C<td or oflfer ac adgad, to have restored and 
recovered. 
Ac brn v cnfwyd ■n ben Oymn« ar adfer at adaaa. 
^oto M„. not {a. SH). 






in adgefaiA ryw ladd o siHuLdflb. dycbvelodd ef at 

I. a second attempt oi 



Adgaia, geisiau, 

deavour. 

Adf (Ha, geimion, a. recurvous, bent backward. 
Adgaa, -an (a), ef. an episode ; an inddental 

description or digression [iu poetry). 
Buaaai lluoio chwrdl, a i^hmi d^vwyddion, dyfetela ai- 
fftnatt, a tleuvi jr holl tiyfansoddiud A thAn A«Eayddia«tb, 
a rhodili am ycvbl wiw ddwtlua a dillyn mmFn rynehon- 
edd, yn onmid peth i grvbwyll luuhyw gnadur dyn^. 

H'. Jotia : Bam a Dart. a. 



Trwy oaod, yma a thiav, luawaobethau a fwriud-wyd yn 

Ciuiai pfir y cerddorion, 
Uucnna feih, nw duwneiai Pon ; . 
A'u A-fiffnn fe] Ibua cydtfoT 
Angjliun mwyn, yng ngbin mdr. 

/. G. Ocinofii/Jd: Oefi-. 80. 

Adganiad, -au. em. 1. description. 

Dylai fardd ymiirfer yn ei i-erdd 'galaraorsL] imwjuber 
laflb, a g^leurwrdd ymadrodd ; A byr ddychymmyir a my- 
fyrdod. . . A pbvyll EWRidd-beUoMDlaeib. accgforsyn- 

2. »/.=Jry3(in. 

Adgftnmawl, v. to praise anew ; to recelebrate ; 



o recommend. 



Adganon, -iaid, am. a minor ca 

A diynkhell yr adgmimiaid, flcBriaid vr, a r 
mm ea bwlwya, i astudjo'r Ye^^rji^yt Lan. 

C«aon-.u Eglicfog, «2 [ef. S4). 

Adganu, V. [cann] 1. to describe. 

2. to form an episode. 

3. to recite ; to rehearse ; to repeat. 

A i:iiaQu*n farddonlaidd ar dnrtnn, f al y bo hawddaf 
d»U a dyauu a fhufiav y Krdd, er addyw a diddaBVcb a'i 
dyago, ac a"! Jiadgano, ac aH eijw,—fiitrddat, ii. m. 

Am Bab Rbufain, er bod ei ngiithwyr yn luli^diiu iddo 
yn WEni^Uiiu y Kiriau byn , , , dywedyd yr ydym, ooi 
phair e( i trydwybodau dynlun ddaroetviig yn yatwyth i 
alrDuw, oad y« ete yn ansyd, oac yn cau. 

u.cgfin: Did. a. e. 

^it^Riii bairddfyd ofoDedaa nych. 

W. O. P^lu: CQ.it.lH. 
Adganwr, wyr, tm. 1. a describer. 
2. a reciter or rehearser. 

Adgaa, a. odious; hateful; disgusting; dia- 
agreeafate; unlucky. 

^opbGlsitih avyd dey adaa ['r^, idaal. 

"vnMn.-HA.I.IW. 



A obao beany c bn tuktis et gan Duw. 



-.• ujl. u. sua. 



adg-u. — Dad. ■ 

jAd^asedd, am.^Adgaarvn/dd, 
AdgaagI, -au,»m. what is gathered or collected 
aftor a previous collection ; a second oollectioQ. 
AdgaagUad, -au, sm. a rogatheting. 
Adgoagln, V. to regather; to ooUeot again or 

Adgacrwydd, am. odiousness; hatefulneas. 

O irir ddial ac adgatrv:/dd. — Oromajf Otoain, 306. 

Adgaau, 1 f. to be hateful or odious; to use 
Adgaaau, j or treat spitefully ; to hate. 

DlUynion cyaaon ni'm aioMgnt, 

Uywrlrt Gndl. U.A. 1. tlS. 

Anian ty lyehao o fwyd.— jidw ftafljia, J Oybydd. 

Adg«idwad, waid, am. a represerver; one that 



Adgeidwada«th, -au, a/, the act of repre- 

sorving; reservation, 
Adgeiniad, laid, am. [adgan] a reciter or re- 
hearser ; a Bubchant<^. 
Djr fflod Iwya oynavye pob al^fiitiitfi. 

Hywel ah Hinina L.i,j1ni>: SI.A. L flia. 
Hal slosh nshd 
Cwynaw y mae'r oJ^riaMirf.— B*. Mad. 



Tri 



ti pbablfdigion beirdd Tnyn Prydain . . . AB yw ad- 
itad^ ac ajtiav y [nae dadganu y^ nffbadair a got««dd, 

Adg«iaiad, iaid, (in. one that makes a second 

attempt ; one that seeks or attempts anew. 
Adgeisio, v. to reseek ; to seek anew or again ; 

to attempt or endeavour again. 
A nlwyd nsb wedi ei ennaedu 1 Nac lufjciniil ddiea- 

Adgemi, am. recurvity ; a flexure backward. 
Adgen, -ocdd, »/. 1. growth; fruit; produce. 
A dyeti y ddaiar, the fruit of the earth. 



,.A^.(,K»t;ie 



Chirychwi J Ttfti a 



AlKISMBDI-ABTa i 

Adgm y jlwyddyn, tbe coiuse or space of the 

w gynlaf yng Nghymrn.— 

2. accent or emphasis.— LlaruxiM- M». 
Adgenedloeth, -au, af. i 



a regeneratmg ; re- 



Adg«n.«dlog, a. regenerate ; bom again. 
Ad^nedln, v. to regenerate; to reproduce. 

Yr hwn n ol ei fawr dmgaredd a*n ttadgaedUdd nJ i 
ohniUi brtrtol.— 1 Frdr i. 3. 

Adgerydd, -on, Mn. a Teprimand, a rebnke. 
Adgeryddiad, -an, rnn. reprehension, reproof; 

Adg«ryddol, a. reprehenaive. 

Ad^ryddwr, wyr, *tn. a recriminator. 

Adgig'lea, o. reheard ; heard or has beard again : 
Srdpere. sinR. peri, of thedefective and obsolete 
Terb ciglfu [l^ audivit) with a prefix. In the 
jvinted editions the prefix is separated from 
the verb in the only passage in which it is 

Am rodea rwrfnuL 
Am ba bard oatoum. 

Al ffialtti Gamlui. 
Atwelir giid uiui. 

Ad^p, -ian, *)». 
a reprisal. 

Ad^piad, -an, mn. a snatching bach or again : 
recaption. 

Adgipio, V. to snatch or seize again; to makt 
a reprisal. 

Adgripioli "■ snatching back or again; re- 
snatching. 

Adglaf, pi. adgloifion, a. in a relapsed state 
not thoTonghly recovered ; ailing from a pre- 

Ni bydd ad^ta/o giMtwr.—Diara. (M.A. iii. IW.) 

Adglef^'chiad, -au, im. a relapeing into sick- 
ness ; a relapse. 

Adglef^chn, V. to relapse into sickness ; to fall 
back from a convalescent state. 

Adglef^d, -au, -on, am. a, second illness; 
rSapse into sickness ; a relapse. 

BhoH bfdderi o ivtfflffyd. crrmner fasti bncb, a Davl 
. fanmau, a mil.— Maldttiit Vyidjai, i. 194. 
Adgload, -au, *m, a conclusion; something 

added at the end. 
Adgloi, r. to unlock ; to unbar. 
Na Idd T bgn. K cffnild 
Ova J cylfwilioD Orian, Srvw a^i^hi 
A bnlir lav onldonu gwiwl. 

W.O.P'is'tc: CO. vl, *( 
Adglmn, g^ymau, nn. a second knot 
Adglwyf, -an, rm. a second disease; a second 

wound ; a now wound. 
Adglwyfiad, -au, im. a becoming 
again ; a woimding afresh. 



Adglwyfb, V. to become sore or diseased again 

anew ; to ralapfc ; to wound anew. 
Adglwyfol, a. recrudesoent. 



Ad^lymol, a. tying again or anew. 
Adglymn, v. to tie again or anew. 
Adgnith, -iau, am. a retouch; a second touch 

Adgnithiad, an, am. a retouching. 
Adgnithio, v. to retouch ; to tooch again ; to 

tap again. 
Adgno, -ion, -au, «ni. 1. a second chewii^f or 

biting ; the chew of the end ; cud. 



Adgno cydioybod, i 
Ad^oad, -an, mn. the ohewing of the cud; 

rumination. 
Adgnofo, teydd, «/. 1. a chewing; cud, chew. 

'.. remorse; compunction. 

Ad^nofa cydvtt/bod, remorse or compunction of 



Adgnoi, V. to chew or Inte again ; to chew the 

cud, to ruminate. 
Adgodawl, a. resurgent, rimng again. 
Adgo^t "■ to raise again ; to rise again. 

o f eirw ... a cban 
^iiahitll ; Lufl li. B. 

Adgodiad, -au, wn. a raising or rising again ; 
resurrection; resuscitation. 
Dsned adiodiad, a diWTBiHdsa.— ZinDi Wff- Bl. Art. 1%. 
Adgof, -ion, tm. remembrance ; recollection. 
Adgofioii, recollections ; reminisc^ices. 
Iheyn or adgnf, to bring, restore, or recall to 
memory.- — lolo Mat. 105, 214. 
T mae hraidd yn adgof genyf, I have some 
slif^t remembrance of it. 
i(, adgof oodd, 
i«n Hvoedd.— <7r 
Uae adao/ weithion yn birasthna ddirrn 
Vnsrgiioi mebyd, lie taira y>gBfn fyd.— r. LUisi Janrt. 

Adgofi^i -All ""■ A call'tig to remembrance ; 

recollection. 

[Dywedai y Derwrddon) tod dru, v^ ddela i Bjflwr 
nwch law dynoUfteth, yji <«] pernith adgofiad o bob dull 
o hanfod.— £), Parr! Han. CrBf. M. 

AdgoQant, iaint, iannan, am. a alight or short 
memoir ; a memoir ; a biographical ootioe or 
sketeh ; recollection, 
yi obeir- 7n aioa vedTn o't boll ^yfui and adgofiant am y 
oyfrjw am^lcb^. — / Q. Oeirvmifdd : <3i^. 363. 



Coflwuh bfo, a byddwdi wfr : adgif/lKth, drosoddwrr. 



Adgoflol, a. reooUsotive, reminding ; memorial. 



&W1/1 adgoffa, oommemomticm feativsL 

Ya VT ■bflTtbui hjaj J Bua ad^JF* peoboda tt bob 

VlyijiAju.—Bd>. z. 8. 
^jfryi hinon luJ . . . oddL «itlir tt nd^fa uq danoi nld 

oea ol ol TO itii* ond uwyddion wlfciliad. 

(haiiUtr JfaaUu,- Ovulth, ii. aes. 

AdgofflU, am. a reminding ; reoollectioii. 

nrrdoBtliyil dudgsnTIl 
lyn ryffredin yn pen i 
.■D)5e.F»rw,UCW. 

Adgofiiu)!, a> reminding ; oonunemontiTe ; : 

moriaL 
Adgoff&n, V. to remind; to put in mind; 



oe* geajiQ «wYlln Tina i*w Add^jf tf n. 

ZJjU^ CfxaUi a^fridi* (BUcTK>>dlDdd). 

AdgoffftwT, awTT, am. one who reminds; n re- 
minder ; a prompter. 
Adgolofii, -an, ■/. a pilMt«r. 

01 ohTlcb TT *d«dd admtofnm tw. 

/ D. Pfr^^ Ogn OwTiib, L 8B1. 

Adgor, -au, edgyr, nn. [oAr] 1. a plou^-teom ; 

Hy Wt aucor bHh V 7 threfted.— Jf^nHin.- A3. IL U. 

Trlthil Dodst ah»r v hanet 

^ nunh Ifayawv a manh Qtnetliam). 



Cjtu heb odfiran.— JTrr. ^ra). Hi. B 

. cattle (oxen bdng form< 

hamesaed to the ^ongh). 
Benditk Duw or yr adgor ! the blesaing of Qod 

be on the cattle ! — Qweni. 
Adgordd, -an, «/. [cordd] a reserve bod;, troop, 

or corps ; a body of reeerre ; a mibdiTision of 

a clan or tribe. 

Nu otu m. Ml gwrda ^wpi. 
Ma laeUi med admrdd. Da aalui, yd Watcjn ; 
Ka defod Ttraiuud, db dyfyn. na umia; 
Na Dng o'r OaUis, ui dag«r b«Itii. 

L. a. C«*i, I. TTll. tf (ef. M). 

Adgor&, -oedd, ^f. a place to which persons 
may resort or repair ; resort, aasemUy, meet- 



TaiTadpor/agryftiedinyaydd: cyn^bdrddyacBSondd 
a ^ychi^d L cyrch dyKyumll ^wlad ao arlwrddwruiimith 
a tiijtnlUi \ a ch^lcfa arudraeth. . . . T&ir oAgwfA mbao- 
Tvd J lydd, t bTvmt i fcnyw ynddyat ; nid junnn { helm- 
iuTm; milwiiAflth; a oLyugt^d oyiuul. — AinUH, iL 78. 

Adgori (o), V. 1. to return; to turn back; to 
comeback. 

Bac psbyll Uadami pan lOcarfri 
Namen on ^wr a gant any dem«j. 

Jmria: Ood. 18 (ct. SS^ TSS). 
Hanyn p«d«ar nid oieormi.— cMvdtfn.- H.A. L UT. 
I^ychim a thrychaot bn nyt atarrMaiu, 

(Jim*™ MoMtna: A.B. IB (1*. ICK, 106). 
UvynTawT o gazobaiawr a gyrohanant . - - 
Nnid oet godiwya pawb pan aicorntnt. 

0. CK/tilvf: It-A. L SW |Bf. »«)). 
2. to [nvpare the t«iam. 
Adgoriad, -au, wn. a returning; a return. 



AdgTsad, -an, »m. a creating anew, a re- 
creation, 
¥ ma* ttydadd wyrth yn Mg:hairt»tdfad . - , jx boo rr 

dyohveliad neo ottffrtad j bara. 

jarOHtosM yr Si/Iwft, It. S (1«). 

Adgroeai, ". to recross ; to cross bati or again. 
Tmadmvodd rhaji o*w lluoedd oyfonol o VrntiM, I adaroa^ 
Bhin.— .«»*■ Oimer |1S11), L rfa. IT. 

Adgrybwyll, -ion, tm. recapitulation; repeti- 
tion ; a remark. 



Bna<a: Haol. C.C. tUL lit. 

Adgrychyn, -an, nn. a semiquavOT (in musio). 

On mfdiya TD CTiuiwya dau odmictn^ao im a^nvtiM 
TnoynnwyidaDgoiBcrdira.— /. JKUi: OnaLOerdd-B. 

AdgT7fh&d, tm. a refortifying ; a restrengthan 

ing ; a recovering of strength or vigour. 
Adgryfhaol, a. reinvigorating ; recruitiag. 

WA dmrlu, dnrr «a iadart/^atil nertb. 

/. D. F/n,id: CWl Owynta, L MS. 

AdgTTfhau, V. to reinvigorate ; to reoovra 

strength ; to recruit. 
Adgryfli&WT, hawyr »m. one that fortifies or 

Btraigthens anew. 
Adgrymadd, -au, sm. reonrvity, inourvily ; in- 
curvation. 
Adgrymisd, -au, »m. recurvation. 
Adgrymol, a, recurvous ; incurvatang. 
Adgrymu, v. to recurve ; to bend back ; to in 

curvate, to bend in. 
Adgrynoad, -au, «m. a collecting or gathering 

together again ; recapitulation ; a summary. 
Adgrynoawl, a. reoollective ; recapitulatoi;, 

recapitulating; gathering again. 
Adgr^oi, V. to recollect ; to ooUeot or gathv 

again ; to recapitulate, to summarize. 
Adgudd, -ion, «n». that whitdi is reooncealed. 
Adguddiod, -au, rat. a reooncealing ; a hiding 

anew or again. 
Adguddio, v. to reoonceal ; to conceal or hide 

again. 
OwrCli oedd Iwrth ol lalth nl oigitM 
Onitb oedd futh ymy j olndd. 

Dn/tMBf\fr^- ICA. L 311. 

Adguddiol, a. reconcoaling. 

Adgur, -ion, tm. a rebut, a repulse. 

Adgniiod, -Bu, tm. repercnsdon. 

Adguro, tj. to rebut ; to repel or repulse. 

AdguToI, I a. repdlent, repelling ; repa- 

Adpiredigol, J cussive. 

Adgwnu, V, [cwnuj to rise again ; to reascend ; 



AdgW7ddo, V. to fall back or again ; to relapse. 
Adgwyddiod, -au, im. a relapsing ; a relapse. 
Adgwyddol, a. relapsing ; falling again. 
Adgivymp, -au, »m. a relapse. 
Adgwympiad, -an, tm. a relapsing. 
Adgwympo, v. to relapse ; to fall again ; to 

fallbaok. 
Adg'wympol, n. rdapsing. 



w'^.(,)l.H;iL" 



Adg^d, -ion, -tan, *m. a joiniu 

Adgydiad, -au, nn. a rejoining; 
Adgjrdio, V. to rejoin, to retmite. 
Adgydiol, a. rejoining, reuniting. 
AdgyfiBAiod, -an, »m. a making whole, entire, 

or perfect again ; reintegration. 
Ajdgyfluuairdd, soddion, »m. deoompodtion ; 

that which is deoomponnded. 



AdgTfanaoddavl, a. deoompoimdmg. 
Adgy&iwoddi, v. to decompound ; to set to- 
gether again. 
Adgyfiuwoddiod, -an, tin. recomposition. 

OufodrcjniytAiiammffjlBbjiiant (ftndAliTBl, telnvol. 
p adfp/tnxiUiaiiaii d nl 0*1 hTlilOCdd KwrtluHiduil ■ 
bertfaynvit l^r awyrv^loh vi hon, gnllvn dybied J dlehoD j 
eyffel jb adrrfiauoddiada* gTmnieryfl lie yo unrETli^ Jli^ 
tmwt mc Kbrvji^l TT IhoI. bIUU' ETds ija o waliuiiutti, 
fod yr adfx/anitnldiadiiit o hylifoeSd grwrthnefdiol yr tutol 
taan olei^iiur, k ■ nnlynir gun rnulduniiidHi 3I»- 
glacT. trwj ivddi on (Twdiu nl. — Lltttad gr Oa, iL 80. 

AdgyDuin (il), t>. to make whole or complete 
again; toreintograte; to recruit. 

Aigytaxch, V. io resalate, to regreet ; to greet 
or salute anew ; to retain a nlutation. 

Bte ■ grtudua iddi, t, htthan I'l hadft/anlia yatan. 

AdgyfU'Ch, -an, tm. a saluting or greeting 
anew ; a return or exchange of Balutatitm. 

Adgy&rchiad, -an, am. resalotation. 

Adgyfarchol, a. greeting agtun, reeoluting; 
retoming a compument. 

AdgyfhAd, «m. a making whole, entire, or pra* 
feet again ; reintegration. 

AdgTfbool, a. tending to be whole again ; re- 
integratanig 1 recruiting. 

Adgyfliaa, c to maira whole again; to recmit. 

Adgyflawnol, ) a. replenishing, filling, 

Ad^flenvol, jpleluig; su^ying; snpple- 
ro**nta1. 

Adgyflawnn, ) c. to complete again ; to All 

Adgyflawni, ) anew; toreplenish; tosnpply; 
to supplement ; to recmit. 

Adgyflenwad, -au, (m. a replenishing ; com- 
pletion; arecruiting; asupply; aaupplementi 

■mdda tdd bedydd to adsg. 



Adothhsnol 



Tfilerthiftd, -au, ant. a reinforcing, rein- 

roement. 
Adgyfnerthol, a. reinforcing ; strengthening 

'th new force, asaiatance, or support. 
Adgyfherthu, v. to reinforce. 
Adgyfoerthwr, wjr, ant. one that gives aid or 

assistance ; an aui^iary ; a supporter. 
Adgjrfbd, -au, »m. a rising again ; recovery. 

fl yoK f rauuHeynt dlTa hoU Kymra byt da bei a&pmvt 

nt tn^ywyd.— finu g Saaim : U.A. U. HI. 

Ad^Tfbdodigaeth, -au, */. leBnirection ; the 

ict of rising or raising again. 

Mu/nuu bep et u pniSVydi s nualyirediMnr or dlodet 

Enn . . . u om BffevuMfedwtvJA inbea. 

Lli/r a-Kgn imtidmli. 

Adgyfbdi, vn. 1. to rise again. 

A"! trydydd dydd efa s '^gfgi.—M'Ut. xx. IB. 
Ao o ctaddwyd ai 
Wyiyf ddoeth dd 

Yn yiplennydd hyftyd.— W. Wgiot: De». a«i. IB. 
2. wi. to raise again. 

Hyfl |1 liaAgg/aiaf at yn y dydd dlweddaf . 

Adgyfodawl, a. rising again, resurgent; rais- 
ing again. 

Adgyfbdiad, -au, n». resurrection; a lisiug 
again. 
Adgyfodiad y meirw, the resurrection of the 
deu. — 1 Cor. xv. 

Adgyfodiad y cnawd, the resumotion of the 
flesh; the resurrection of tlie body. — LI. G. 
Oyffrtdin (Credo yr Apostolion). 

AdgTfbtio, V. to refill to the Inim; to fill 

Bfoiy adgg/wia flullw d« 

A bra no ddsQfwy nna oynbeiB. 

W. O. iVfV; Budd, 111. t. 
AdfyfEKMid, -au, am. resuscitation. 
AdgyfCroawI, a. resuscitatiTe ; exdting anew. 
AdgjrAroi, V. to resuscitate ; to exdte or move 



Adgyhoeddi, v. to republish. 



frdd 



rr oeddynt wi 



>(*rr^l>iyi,iD.4(l(tt). 

Adffyflead, -an, ant. the act o^ rejda«ing; re- 

jdacement; reinstatemeut. 
Adgyfleol, a. refdacing. 
AdgyflAo, V. to replace ; to reinstate. 
Adgyflunio, v. to remodel ; to reorganize. 
Adgrfilertltf -oedd, -ion, nn. reinforcement; 

adaitional force. 

VtadtgfmtTik bii a ddaw, M m«tha hi. 

W.O.I\,,ht: CO. 1. 307. 



, tm. republication. 



Adgyhoeddlkd, -a 

TnueyddADhyn . 
o'r mrgnfflsd njinflll —LtgfrfUiatlh ) 
Adgylchiad, -an, am. revolution. 

Yt wyf fl yn fodlon 1 dyan ganbndd drug y dyddlaa 
oyraylos hyny, A dyfod i wuvd mewD Uawenydd ftt yrunaeT 
Bg jdyi yn Jw Amta yr Adgi/lchiad, neo'r Ad-ddyobvel- 
tsd, > ddygwyd oddl amgyloh tu ddugd dywyriu yr u- 
farwul Frsnio WUI»in.— /er™i Otm, V. 

AdKrllaetli, -ao, am. a desire; longing. See 

EdgyUaeth. 
Adgymharlad, -an, am. oompaiisMi. 

TA a da jfmitariad umvdd y vydd : oynt&f yw unheoed ; 

Adgrmbeniad, -an, am. a trimming or tidying 

anew ; a patting in order ; a being fltppant, 

pert, or talkatiTe. 
Adgymhenol f£), a. trinuning, tidying, putting 

in order ; usmg pertness of la 

talkative. 



f langusge ; over- 



,.A^.(,K»t;ie 



ADQTUHKMr i 

Adgymh^nu, v. to trim or tidy anew; to put 

in ordor again ; to be over-pert in talking. 
AiigyiriTTmlii^ 0. to Tejoint; to reunito joints. 
rAuiFKU (.'iorlu, i.i. 'Adgyweiiio.' 

Adgymmeredigaeth, -au, «/. rosiunption. 

Adgymmeredigol, q. reassumptiTe, resuming. 

AdffTmmeriad, -au, am. 1. reaBmimption. 

2. Anadiplosis ; a rhetorical figure ooueistin^ in 
the repetition of the last word or words in a 
clauBo of a sentence in the beginning of the 
following. 

^rfjj/mm-nnd yw iddnmflg, pan adroddir jr unrhr""*!!! 
yn Divnld y frxvdda^ flA^'auravg ac yn a«hreu tt uttetii 
aaajTlol.— /frnri PtrA: E^i. Fft. hit. (irf. iit.} 

In ' Pum Llyfr Cerddwriaeth,' it is used for 
Epanalepeis (probably for odyTngymmeriad), 
the Aili/mgifrch of ' Egluryn Plraethineb,' the 
two figures being similar. 
EpVjAlcpiqfl, AtlffiffunbTwd (hrd r dyvaid T><nut) frdd 
put fo yr un g»ir yn dmhten bc yn gorphen ymndnXla. 
Puni U<ifT CrrrM. llfi (ef. 114). 

Adgymmerol, a. resuming, resumptiTe. 
Adgymmerjrd, v. to retake; to 
tiuce back or again. 

Gwelwoh iutffvmjivryd J nir Flut, yr 
Ji UMjtIi & gwa ti a n iiod, i doedireu j llall 






1 oibeaodd 
lyn. 

rhyfel rhyngdtU A 



IioeBr.r 



Adgymmod, -au, wn. teconciliatiou. 

Adgynunodawl.a.recondliatory; propitiatoiy. 

Ad^ymmodiad, 'au, «m. reconciliation; reoon- 
cuement; propitiation. 
Awdl ar ad^jmiwdiaii Bali a Brtn.— F Taliain, L 18S. 

Adgymmodwr, wyr, tm. a reconciler; a pro- 
pitiator. 

AdgrTinmoni (5), c. to set or put in order again ; 
to render compact or complet« again; to re- 
arrauge. 

Adg^rnneddf, -au, »/. secondary, subordinate, 
or inferior quality ; secondary qualificstjon. 
Tri pliriT gTnnedd'an g^ladoldeb radan 
y tflirdd pob oyimeildTau oreDl b- -'-'-■■•-'■ 
^yimeddTau uis geltir ad^smwddt 



' wIadDld«b ; a cbyn pnT- 
Cii/rtiAuui Cgmm. U. 4S0. 
A. obyD prif-^yimeddfaa nil golllr adffvnfieddfim. 



Pwybyuui] a adavho tan jmjvm odyn Tcnifyoc adynot 
Bfall y aiffgfitttu y taa aUofld yr odyn hwynt oUdni ae tal- 
h&nt yndeulianiier drosU y ryngthnnt y berdiaiiiuira yr 
o^jo^—CRfrtitSiiiH O^mru, L 414. 

Adgynneuad, -au, tm. a rekindling, a reigni- 

Adgynneuol, a, rokindliug; inflaming anew. 

Adgynnrych, -au, -ion, am. a second presence ; 
likeness ; a second copy, sample, or specimen. 

Adgynnrychiad, -au, im. a representing ; re- 
presentation ; ^chibition. 



Abotbcht 



t^ES^^^?^' '"■ representative, re- 

PsritaitJi drtfTwodlun By. nan f q yr areithiitr mal pei p 
dwyn i menTi, ar aratlJi, gwbl o ymHrfrawdd dyniHwd nrall ; 
DeuynCe«yddf9diyn^ff4v'ixv'v^'''<tf^>Di^^^l>^T™^^^^l*^'° 
rhjn belt aniU.— //-uri i:rri.- EkI. Ffr. umvii. a. 

Adgynmychedigaetli, -au, >/. representation. 
Adgymuycliioldeb, ) am. representativeness; 
Ad^TUuycholdeb, ) representation. 

FwT bynna^ o byn allao a ha^m, oad yw Senedd gy^ 
aefrtt^ig y drymafl hon, ymiTyTmuUcdis yn env Ciist, a 
tlrwy Bwdnrdod y hnsun. yn wit Epiwy' Loi^ trxj mt- 



T dni oedd «'r [ 



tfoedd o' 
li tMun 
'r tragyirydduli] 



_„„ „_a— 

Siis iMiM: Dnxehoa, TO. 
Adgymuycltioli, v. to r^tresent ; to boar the 
form or act the part of (another) ; to per- 

Adgynnrychiolwr, wyr, 1 «m. a represonta- 
Adgynmychiolydd, •ion, j dve; a substitute. 
Adgynnrychu, v. to represent. 
Adgynnull, ) v. to collect or gather again ; 
Adgytmullo, j to re-collect; to put together 
anew ; to reassemble. 
Ac tv byiiny eygeyoea ny pheydyws ^mtn oamyD aOtfw 
nuOAW «ylw«yth y Tydynoed a£ torroed attaw. 

^ ' ' Bn,t Or, n6 ArA,r: M.A. a SIT. 

Adgynnull iad , -au, tm. a reassembling; re- 



Adgynnyrch, -ion, im. seoou 
growth ; what is reproduced. 
Budigonodd o bob adg^nnrci.—Dnei TFjih.- BL Ari. IS. 

AdgynnyTcbiad, -au, am. a producing or in- 
creasing again ; reproduction. 

AdgTmiTTCliiol, a. reproductive; reincreaeing. 

Adgynnyrchioldeb, am. the state of being re- 
produced; reproduction. 

AdgynmyTcluoli, v. to be or become productive 
again ; to reproduce. 

AdgTnnyrchn, v. to reproduce. 

Anuoherffftlth yw [dynsawdw^d], sef pan a^ynnyrcAir 
ymadiawdd rhyinui anil yn lled-yoffa^ ao fp UM-t^in. 



-■ ^1. 



Sr"i; 



Adgyrch, -an, am. a recourse ; a n 


ew attack 


AdgyrdiBiU, v. te resort or repair 


to haver 


course to ; to resort to ; to recur 





Y toimau tanllyd hyn, a gfuphwi-aawn, 

Os ^Dfpbwys yno sydd, ac adgyreJulu 

Bin Uua«dd u-ychion- — ^^ O, fvght; CO. i. aoi.' 

AdgTTchiad, -au, am. the having recourse ; re- 

cuTMon, recurrency. 
AdgyrcMol, j a, recurrent, recurring ; reoi- 
Adgyrchol, j procal ; reflective, reflexive. 

iotfpartb o benryddii 
aittgytate^ 



iali'se 



tdggrcAM, aif ydynt yn perffaith gytateb i'r perwydd- 
ebraeg a dreigUr yn HUhpUiel. 

Samurl floiertj.- Oweilli. S8S. 

Adgyrchioldeb, ) am. recurrence; reflective- 
Adgyrcholdeb, ) noas. 

Adgyrcha, v. to resort; to have recourse; to 
recur; to reattack, te reassail. 
rr_ dlben gea hyny_ p orthrechu y cyfryw anbawwlOT, 
'rii.' Snrildinetli, 4«. 



,.A^.(,K»t;ie 



Adqyuohwb 

AdgyrohwT, wyr, wn, one that resorts or fre- 
quents ; ft resorter. 

Adgysswllt, vlltaa, *m. thatwhich is subjoined ; 
what is added or joinod to another ; an ' 

Adgysaylltsdig, I. pp. 2. a. sabjunctiTe ; 
juncti-ve, adjunct. 
Trawtenvi yr adgyut/llttdig, the metonymy of 
the adjunct. 
Ta ot tEQ«U jnudndd a dirir TVwkiw kr odggHgOudig. 
.. Ua BiA«> luieddfi mdi s roBd n lie TT ndnufUi- 
«<«.-/»-. Own, Jl, II. 

Aiigyasylltiad, -ao, am. a subjoining, sub- 

jnnetioD; rejunction; adjunction. 
Adg^asylltn, v. to subjoin; to rejcnn; to re- 

Tb Tt fawn lybwll o Inndlgutli, oKot marwoIuUi, 
■UaidT nlu, 7 gadiwn t dnMUm* umbeOn^ ni pTdra 

Emiamd Vaaf)tm : Tmufa- Snvioldeli (ISTB), 47. 
Adgywaiu, ti. to boar or carry bade 
Ad^yw&ir, pi. adgyweiriau, *m. 1. repair, resto^ 
t«tion ; a repairing again \ a, repntting in order. 
Oentat fkidd Olu . . . ■ rododd ndnir adggvalr witb 
gttdd, ra TJ.nJ.f — jTj^fr J, AsinM, Bhagdd. 10. 

2. Epanorthosia (in rbetorio); the same as Ail- 

^wair. — LUmover Ma. 
Adgywairdeb, tn. a repaired or restored stat« ; 

restoration. 

Ifr brdd ol^tMInl^.— Snil Or. ai Artliur. 

Adgyweir&, feydd, »m. a refectory. 

Adf^wfir/a. bwydfa, ymboHhftt, rhuidj bwrtL ntef^ 
twTta.— IfWlen, LT. 'BefeMorr.' 






jdrwBT trrndiff « metli 



Tocdd rr Adgiftptiriad gvrUffwin/A fdyv bod jn espoD- 
fkdoL— Svirddindiliiiir Cfmrcif, L Jt. 

AdgT^reiiio, v. to repair; to refit; to correct; 



Tdt Tl«7d^ honoo rd aifg 
1^ OanBrcn. — Brvt p Tyvj/to 

Ao TU y BbnMnfi'Id . . . s muuBuaiit y Brrtaniald I ml- 
tgiBciriB bylclwi u adwyaii Onl Safer. 

Thai. EvoHt : D.P.O. i a (80). 
Oa d>v galmd am id] ugnOad, Da to bpr yr awdur, 
«f ■ oCimr am adgjvtiria hyn. 

i>r. IF'. Sifjbmlt.' OalriiduT, B, & 
Adgfwetritrck J cyftTV ua mewn yapTTd addtwndsr. 

Adgyweiriol, a. reparatiTe, restoratiTe. 
Adgt/weirolion, restoratiTss. 
Adg^walriadwrea, -an, «/. a female that re- 
pairs or restores ; a repairer or restorer. 

Y DUKDt yn dji^ fod anum «W«a ttt tu w rt ettOS heb 
law Criat 1 atjii tnMDm . . . y dylem veddlfi amjiit nHgya 
vfnitaithwTwyt, oeidiraid, aa ankddiffynwyr eCo haiM^bai- 
andlaa ; jn aowadlg jr Arglwyddea EUr, yr hon t maenC 
JD ri galv .AdfiFucirwIwKi as laahawdwrea enaid anobeith- 
lul, ■ iliodda rvrydd laa. 

BofuUDarii.- FroT. TrYipryd.S4. 
AdgywreiniAd, -an, sm. a refitting; refine- 
ment, re-embeDishment. 
Adgywrainio, «. to re-embellish ; to refit. 
AdgTwrsiniol, a. re-arranging ; refitting ; re- 
enibellislijng. 



, )w 



. a repairer; 






Adliaer, -iau, am. reassertion. 
Adliaeriad, -au, *m. a reasBerting, reassertiou. 
Adhaerol, o. reasserting ; repaoifying. 
Adbaeru, v. to reassert, to assert again. 
Adhawl, -iau, hoUon, */. a seoond daim; a 

second accusation. 
Adheddjrchol, a. reconciliatory. 
Adbedd7Chu, t>. to repadfy; to recondle. 
Adheddychwr, wyr, am. one that repadfies. 
Adholi, V. to re-examine ; to reclaim ; to claim 

Adholiad, -au, im. a re-examination. 
AdliolWT, wyr, «in. a re-examiner; one that 

r*lftiitia anew. 
Adhoniad, -an, «m. reassertion, reaffirmation. 
Adhonnavl, a. reasserting, reaffirmi n g. 
Adhoani, v. to reassert, to reaffirm. 
Adhonnwr, liouwyr, tm. one that reasserts or 



lU, am. restoration, recovery, r 



reaffirms. 
Adhrbiod, 

Drmdir i VI boneddig . . . gTboaddi Urfryn yo obyn yt 

Aiatbiad.—attaIIUT MecSain : Ovsitb, iL «80. 
.JcUvMA^Hnuflaetbaii Frydcdnddd. 

OKoilicr Mtcluti* : OmiUi, il. US. 
Adia, -oedd, am. a stranger; one fleeing from 

one place to another. — P. 
Adiad, iaid, te. a widow or a vidower f 
Owraig adiad, a widow ? 

BaltliDM pechawt mamwl rw godioeb. sef yw bjimy 
^mitbret Wyt onawl. mra ewjUyi ar weithrsdn. a choiiteu 
jr pecbawt bwD nw ynt kyt cnawt rwg gTir m jwrric odieithyr 

dawt. tttamw gwr^c—Baiili PtrAaml Marvavl, | 6. 

With the preceding extract compare the fol- 
lowing from the ' Homiliau ' (i. 78) : 

Nb imewch oiiaeh, umivelrdeb, noc un oflflndld, mewn 
meddwl naa mewn fn^tbred, gyda ^wralg gwi juaU, syda 
BWBddw, na cbjda mBrch. 
Adiad, iaid, -au, am. a drake; a mallard. 
Adiaith, idthoedd, «/. a dialect ; a patois. 
Adian, pi. adienoedd (e), e/. a progeny or off- 
spring; posterity. 

Aidwymf bset o hlr Omtad 

adiam Cynan Cmawrdiawn ad. 

OteahAiaai: M.A. i. 107. 
Byntaprflawnbira 
Dy uohlad bellwli, & ofrnai pa 
Fodd y d«cbi«uai j byd awa a nedd 
Dofnyddlon, a cbyn cof 1 tt pa beth 
A voeLid o ddnbiwad, gaiyt ti 
Pkl y ywybyddal adiai.— W. O. Fxghe .- CO. vii. T18. 

Adian /renijtawl, royal progeny. — D. 
Ldill, -ion, a/, an ugly, poor, wretched, or ab- 
ject one; an iU-favoured hag. 

Hen adill, Dl urnodnl 

1 wiaig wyl nn gwi a gal.— i). LlKud OorUdi. 

Adill, a. poor; paltry; mean; of little value. 

Uwell rw aobnb oyn achaa DawBd«r, no tbrawader pan 

' "^-"^ ' —'lb; as uboiddalpKEland y rban 

mynjcb. dim yn y byd- 

~o» Camr^fs (Y Oroal 107). 



tisis, 



Jm V^.tltH^IL" 



nfU: 0#t. 140. 



Drrfi'i UH, mewn diifavr ard'- 
Adl, -SD, ». See J./yI. 
Adlodd, -so, «in. fbe second crop of hay, after- 
math, lattermatli, lattergraaa. 
Olu frdd aj'ivld tei fiurlh. 

A-;l. f.ry MffU: X.A. L MS. 
W«te ef th ffniflo ceiUand rtiK^ii, pui ddHhnwdcl p 
aJfodd godii »c mk, ai/^iJd wedi U*dd ^vmir J tvfiiiik 

AdUdd, f. 1. to km sgun. 

Hdd o Dcf frr. bcawmf ndd, 

Hun o'm hoedl, baun'm lad£dd<l.-0. >t Griifm. oL tt. 
2. to detract; to libel; to detract or derogate 

OvnMtb OaRO* iprr mIcw 

GrflAtun uiltfd^bw 

A 1^ nril^ bn lir^.—C^iMtl*: ILA. i. IW. 

Hu HibL u Hid lU. rn l^Mii, 

EJuu'n edliw. ■ riiai'n aHaa.—Da/. UirjuJ Corfn-*. 

Adlaas, -iou, a. trailing; daggling; droopiiig. 

Dao ffiwdlwrn, diniig adlttf. — />. ab Gteilym, cxiiL II. 
Adlafar, -an, rm. repetition ; echo, reaomance. — 

I'llo Qlottary. 
Adia&ru, V. to repcAt what haa been spoken or 

uttered ; to T«peat ; \o redte ; to recapitulate. 

Gu aiU/an mw Dnv u iidfain ;i«laln!l pasidd- 
Uis J Ilabr.— fofo ««. 4C 

Adlais, leisian, *m. 1. the resounding of a voice; 
echo ; resonance ; reverberation. 



PwlwrTTjd u 



> (UonTwh, ■ 



EryrPnukffi 

Eidjc ua fif^- — /•JywMrrA ^n .- A 
Am llw be ilh lleiUId o gmir U«nu 
Vn fyir os'Ui wslid edliS odioii-. 



Ujmui « 



ic nr drwsduit wrUi ntb 



a rTh gTyw «a kaUeu, 

bA^tO' DUDfa lawedADO yot nu . 

UKfr Cn-ya Blifdirrck. 
Och [ siRiib bron gl*'. ^ ai dmrddif ol cbmldan. 

Da/fdd o'r .Vmil (Cjfr. )■ Bcitdd, 90;. 
Odka Hlntyv ndlauhon.— O. Vorkrin; Omitli, 1. 87. 
2. a response, answer, or replj. 

Ns sdiwer i un tad bedj-dd am tun fedrdd mi nn stfb 
uo adbili aniU,— Cuufua Kilwfrit. t». 

Adlaith, a. re-moistened ; made or become 

damp or moist again.^Owent. 
Adlaith, v.=Ad]t>thio. 

Adlaiilt, didm, dadlalth, laabioU.— O.F. 

Adlam, -an. »m-/. 1. a step, bound, leap, or 

spring backwards ; a resilient bound or leap. 

2. a retreat ; a fixed abode ; a home or hahita- 



Oiin adlam DOMb a thUwd. 

Or. ab Mtredgdd.- M.A. i. US (rf. ««). 

Yn n adlam, at his homo or abode ; at homo. 

Tefrgwsitb T mM i'r mach iMiMH y taldwdr jn ei aiHoH 
cyn dwrn ei tlu^^—Lfftt Waiiii-iu, 11. iv. 37. 

O'r lie ]r bo ei ladliiiii y lelii a tumobi. 

I>fo WaiHait, II. 1. 83. 

Td oed [Heir] e bmwik dnuiuwt yn wyljkw 1 
yr Algliryd ijwn 7 toMm. UKluif ugi!! nuiu 
u o hoiULW ehnn ; lenoer rn Buyll ru r brann. 



'h^wjn broHt. n r4ind«yn ^juJi , m gvtlUd fe brunt aj 
jf iidrVtf, yn dri iiKflQr *r hnj^un ; ju ni vyddya un ■'■> 
df^'my^wdd y menjtmD IifvyddJilB. — Llamoprr JHa. 1. 

Adl^miad, -an, *tn. a reboonding ; the act of 
Imping or springing back; resilitian, re- 
silience ; a reooiling. 
Adlamol, a. resilient, rebounding; leapug or 

springing backwards; recoiling. 
Adlanm, r. to rebound ; to leap or spring hodc- 
wards ; to start back ; to recoil. 
MMt fj meddvl yn adljrmu ih^ yr yfltyriartli D*it tznni. 
Mf/ft^admm Hrrrtf, TH. 

AdlamwT, wyr, aiN. 1. one tiiat st^M or qvinga 
back; a reooiler. 

2. one retunuitg from abroad ; a aojonmer. 

3. in theWeIahlAWB,»^a^>pvietorwho, for some 
cause, entered the service of another pn>prietor 
without agreement ; if he left him after the 
expiration of a year and a daf, be was liaUe 
to the payment of thirty pence to his pateok. 
—Cyfrtithiau Cgmru, ii. 1109. 







Adlan, -BU, >/. 1. a baU or palaoe.— P. 

2. [glan] a bank, shore, or shelter ; a Utile nook. 

Nm rhaifl •tiilin yr]iwmneK, 
K. ddM i dir. ddnwiw df» ; 
Na cti^mh bAfmedd eyhoeddtu, 

Adlanwad, -ao, nn. a replenishing; completjon. 

A tlirwy ddyi^ ac atbrawinrtliKU ymnfs BlegrwTyd 
Atlinv r crefnvrd y riiai hyiiy» ac a*a doded wrUi fam y 
dniTnui^ oni chaed gannynl egluifald, a ndltd. ac lut 
hnuindaryrtuuhyny.— Bni(.4»nTViyn: k.A-ILWS. 

Adlaa, pi. adleiaion, a. renewedly green or ver- 
dont : green afresh. 
Mia Ebrill wybraidd BorUiir, 
Uudd«dig ycb, adta^ tix,—Engtrmicn § Mi»>rdd. 

Adlftw, -laid, »m. [Bd-+llaw: cf . canilaw, rAo^- 
law'j 1. one of mean or low rank or order ; one 
of the rabble ; a plebeian. 

dil/mr Intan giran a ptia.— AtiwH Awcl.- Tym. SO. 
2. anrthing that is secondary, inferior, or sab- 
or<tnat« to another; an auxiliary; a sulior- 
dinat«. Ilenoe the compound or secondary 
metres in Welsh Tereification are called A<1- 
lawiaid, being derived from the primitive 
metres, or (forehanau. 
AiOannaidjgflwajpBainUon nen'r mHorao eymbleth. 
CjlfriMC* f Btirdd, 71 (cf. 7S}. 
0*r Qaw rjmt Au pnlofb, a^ bymtiivg adiariaid, T ^TDCir 
pedmir uuswdd u banjn ai hourau «rdd daTod, hcnrydd 
meaur a mydryddiaeth. 

Cgfrviach g Btirdd, 76 (c(. W— 171). 

Mfturau adiaun'nid, saoondarr or compound 

metres.— Cx/WnafA y Seirdd, 50. 
Lltfthyreitau adlaw, secondary or derivBti-ve 

lettCTS. 
A Cbemiat I^rdd Ola* a ddonmrtLn ngain llytlnm ■ 
phcdair, tal y mae yr awr bon, a'r pedair yn wJImngM. 



Su ryv trOoi f ndd, aef Brmetla tc aJImn. . . T ejt- 
■ pfln in id a fuat oh dechreuad, & chvodi hynr y meddfl- 
frrd ^ ad^maid; fftl v b^ddal ffadartiKen u bAlyAoh 
liug fli oham ddeall &'i diua lAfani. — Liojwvtr Ms. ^- 
Dodi yn adlaw, to let (out of one's own hand) 
to another ; to deposit ; to let. 

Doi ja dfUoir dy dinvdd OAthjddyp j feibian taHoa ad' 
hanmd tjB8ed%.— Calo Cj™*™* (T OtwJ, 1*6|. 
^dlaio CVu(, the vicar of Christ. 

A Ajttuaamnt mewn cvminiHirit fcwr o mddl ft am 
oil'ucCnsti'TFBb.— AdI. £ti«rrU: Suu. 111. 

3. an alien or atronger ; as alien by descent. 

Cjalmt o*! DBir go nm i jii rw nub lillt ; let yw nub millt, 
fMnm ]rn wr dAnadwDg Kwiul ui mi^wydd ; ui uUt rj^Jav 
ft^ Bvdwir. . . Pnnunea goragjTi, niab a iuut o't briodu 
lumOj Bef *TT i'r adiiw. . . Seixhled ifutfH^^Ta, mab a aner 
o"! b&cdBs honno, mo onryr yr of^ur, . . Kawfed gor- 
■- ._!-_■. *--v agoresKynjxJd yr ift- 



Adlsw, a. Hubordinate, Becondory; inferior; : 
derivataTe ; ignoble ; plebeian ; homble. I 

Car adlaia, * relative in law. i 

Ctr adlaw {pi. sdreint adlawj, ctr g du gin neu du 
gm%.— ZJiUDHr Ml. 
hr ra gotewysv gyd atb iamt mUoio. 

D. Vd' /lin-ddii: M.A. L GSS. 

Cnlo/n adlaw, a secondary or derivative metre. 
Ac relly rbwn^ y naw gDrchau, a^r pymtbw coro/t adlaw, 
J mae pedvar aii^wdd ar bngain ar ifBTdd Qjmraeg. 

Adlavaidd, d. ignoble; plebeian; ruatio; mean; 

Adlawd, sm. land nnder grass or hay ; lea. 

T\r aJAmf, tir Mo dan waii.-Llaiioter Ml. 

Adlawiftd, Said, «7n. a secondary or subordinate 
tiling or pereon ; a compound metre. 

Adlawio, B. to put or plaoe in another band; 
to deposit; to let, 

Adioima dy byflgodlnun o lawn 1 looaid hyd yr adeg ; ao 
Caia Cgfrarg (Y Orwl, IW). 
AXLtA, a.=Hadledi 



Adledd, ) -an, tm. local or dialectal varianta of 
Adlodd, ) Adladd, q.T. 

Di^vnl ail dvya nm mdd 

Yi cAmlMW ar rt aditdd.—iy. Midltln: &lm. ImU. fl. 
Adlef, -an, >/. an echo, resound, reverberation. 

A chan yr adJr/ yr bolt nffemoedd yn uu vaedi! fawr 

9an <KfI'/ y doMain 

oai fer al gleoydd (bin. — W. O.Pught: Baidd, il. 1. 
Adlafain, v. to echo, to resound, to reverberate ; 
to re-ocho. 

Dm na tlion na dalar ni thau, Uefodd, 
Jitk/oU-nea nryKodd lata y cnwian 1 

OmMlirMcclait: Ovalth, L 37. 

U dybrnn a tod yn odbAH <> '«ld i '«^- 

Jft/jinfodua fimv^, 11. 
UiMiknt mdi oAf/i hynln tB*l. 

If. O.Pighi: Pal. SB. 
Adle&Ir, 1 «ni. an echo or reverberation ; re- 
Adl«br, ) verberat«d sound. — QweiU. 
Adlefiur, I ir. to echo, resound, or rcvcrbcrato. 
Adlehr, ) —Quiatt. 

Adle&riad, -an. iin. a rovorbcration or rc- 
XKmdiug. 



Adlefkru, ) v. to repeat what has been said or 
Adlaforu, ) spoken; to repeat; to recite; to 
recapitiUato. 
Tma aUa/rr^dd awen cud echwydd 



Oan adlafani enw Dnw . , . pan adlt/air Dnw ei enir. 

Wo Km. 16. 

Adlehftd, hadau, em. a reposition, replacemant. 
Adlebau, v. to replace ; to place anew. 
AdleioiAd, -au, «m, a resounding. 
Adleiuo, v. to resound, re-echo, or reverberate. 
Adleisiog, a. fuU of resonance ; resounding. 
Adleioiol; a. reaonnding, resonant, echoing 

r become moist; to 

Adlenwi, v. to refill ; to replenish. 

AdlsB, -an, gm. what is not a benefit ; what is 

no profit. 
Adlesin, am. springing verdure. — Llajtover Mi. 

43. 
Adieu, V. to replace; to place again; to re- 
establish. 
Bsio HO Ma adleo owyuuid awymrat. 

tloreiM Maildtrw: 4.B. if. lOS. 

Adlewin, tm. reflected light; reflection. 

AdlmdH, UsBfer ar y pared oddl ar betb gloew, bl oddi 
ar gledd noo wydion.— ti.K. 

Adlevlno, v. to relume; to brighten; to illu- 
minato or hght again ; to dear up ; to grow 
lighter.— Z/aHouer M: 

Adlewyob, 1 -ion, -an, tm. reflected light ; re- 

Adlewyrch, | flection; reflex. 

Y owmwl eooo^ yn y nan, 

A'i adUvjrfcJtu>^ V^TO. — TWtfMJMWi, W- 

,. laint a frltlk adlpv.,..-- ., 

I liyn ai gof yn ' 8ul y Owrjiiion.' 

y«*i Sianrd, 97. 

Adlewycliiad, t -au, tm. reflection of light ; 
Adlewyrchiod, ) reflection. 



Adlfwgrthind yw drcliiMlad pelydran y »1euni odd] ar 

inaai gorfl i'r Uaif; adtnciiriliind pileunl yr haul w y 
euad sydd yn peri iddj ymddanvoa i ddaiaraUaq. 

Sob. Hxitru.- SeryddiaeUi, ee. 

Adlewychot, )a. reflecting, refleotive; relu- 
AdlewyTChol, j cent. 



Adlewychu, | v. to reflect ; to throw bock 
Adlewyrchu, ] light, rays, or beams. 

Ceibydau. Uaflinld eirf . a tbanbaid f dnA, 



Yn adimffthu Uuoh ax luoh-— 



'. O.Puglu.' C.a. Ti. 1 



Hawdd ^(diymmyBn gyda pba tatb lawoiydd y ow 
fyddaj r tojtbiwr blin a ayob«dip lyn o ddwfr n't flaen, a' 
wyncb di«U<.T yn idl'tciiirhu lluniau y patmwydd. 

L-^lcVrom, i. sot 
., tm. [adlaw] a secoudaiy c 



,>glc 



A nhui ddaecli adUioadd J ban, ete ft veUt gaitdl nuirr 
■r ulb brro uclwL a dUtBTa Ayfcdd u- do mulddydd y 
caatcU, 11« nil fimUd iddo u rnelod lu nlui. 

Adlewydd, *?». refleotion ? 

Tri Ayv gTfediTd lirrMth) t aydd: duuncs; >il- 

''H1^U,- nJbjIaiuajl.— TnorM laUk, 

Adli1>r7ii, j -oedd. -au. »m. [Uibryn, llipryn, 
Adlibyn, | Uibyn], a fribble ; a poor weak- 
ling ; a weak or poor remnant. 

Tds j bu ddb t'r a.Kit>TnMM o'r Ftrddiilaid gilisw i 
TmyUu fr rnyi Ciu C%rinm.— Sru <Jr. at -Ifrtor. (P.) 

Ao with hjmnir kOhwri oW^Wn y BrrtuyslC ;cdit1« yr 
ynyB y Gymry ft Cbonyw. 

rf^l Or. ai AnAur (B) : M.A. U. 381. 

Adlif, -au, im. a r«diu ; the ebb. 

£r dy «nw « digoffpynt 
Y toDiwD (od eo Krym, k cliiriliaw nn 
lorddonen o^i/ ftm a hyvrych dftrdd. 

W. O.Pitsltt-Fil.lS. 

*, the fiux and reflux of the 



it Uuwi 



Hi/ acadli/yn 



, «/. i«itorated pang or agony ; 



4^ dolor; befyd dalur ftdffof' — O.V 



Byn tIM tla tad edltw, Ef a nid 



W. O. Paglie: CO. X. 10 



Adlifbtrio, V. to reflow, to flow back ; to ebb. 
Adlifeiriol, a. refluent, flowing baclc. 
Adliflaut, iannau, na. a reflux, refluctnation. 
Adlifa, IT. to reflow, to flow back ; to ebb. 
Adlifol, a. reflowing, refluent, flowing back 
ebbing. 



Y dire i'n Uwyd o'r nn Uiw,— W. Cr-naU. 
Adlithrad, ) -au, ant. a falling or eUding back . 
Adlithriad, ) a backsliding; a relapee; apos- 

Adlithro, v. to slide or slip back ; to backsUde ; 

to relapeo ; to apostatize. 
Adliw, -iau, am. a varnish; a tint. 
Adliwio, V. I. to varnish, to retint. 

2. the same as EiUiui'o, q.v. 

Adlo, -au, am. [adlaw P] 1. chafe, sore, fret. 
Or bvydha hogeu n ndh henUwvyr alboiri y croen ftr 
gcuen hyt y kio vyth gefamftwc kyfKith fttoj. 

Cuftitluaii Ctani, i. 671 

3. ill feehng, anger, animosit;, hatred. 

Arglvyd beb y msb, nft diLly alio ftm hynny. 

aura o Uanlvm, \1 
A phvybyniu^ ft ddyretto «1«Tdd 
ftr hyt y byd marw. og ny delfiii nito ; 

Adlodd, 






=Adiadd, Adledd. 
Adloddi, I*, [adlodd] to spring up after cutting 
or mowing ; to grow as aftermath. 
Y mae'r lir yn adloddi yn dda, the aftormath 
comes on or grows well. 



Adloew, a. 1. having lost ite brightness. 
2. brightening again. 

Kyredwoguit sf ftn dydoo H du odlorH. 

AiuMri.: Oad.ai7. 

Adloew&d, -au, tm. a bright«Ding or polishing; 
again. 

Adloewi, v. to brighten c 
beoome bri^t or clear ag 

Adlog, -an, nn. compound interest. 

Adlogi, V. to rehire, to re-engage; to re- 
covenant ; to borrow at compound interest. 

Adlogiad, -au, nn. a rehiring; a borrowing 
at compound interest. 

Adlonawl (a), a, recreative ; entertaining. 

A ydyw difjrfon a^lanril yn ftnbehsnnit i lechyd ■ diyii- 
nydd corffuTDl n mflddyliol dyu, yn ddeiUlo] ft m««ol f 

r TWtoin, 1. tia. 
Adloni {S), V. to cheer again; to refresh, to 

recreate. 
Adlouiad, -au, nn. a ceoheeriug, a recreating, 
a refreshing; refection. 
S'd yr Adlwiad, BefecHon Sunday {Dvminioa 
re/erf.onM)=the 4th Sunday in Lent. 
bechBdmriiiid , 



I: Bylmdfto, 68. 

:. recreative; refreshing; enter- 



Adloniadol, 
taining. 

Cy/ar/od adl(miaii/J, a recreative meeting ; a 
meeting; for ent«rttiinment or recreation. 
Adloniant, iannau, gm. recreation; refresh- 
ment: amusement, diversion. 
Nid jw gmitb dyn, beth bynnag to, yn adiamiant iddo. 
r Tmiain, i. Ml, 
Adlonyddu, v, to calm, quiet, assuage, or tran- 
quilliKe again. 

Adlon^i, ( *■ ** re-emhark. to embark agwn. 
Adlongiad, -au, am. re-embarkation. 
Adloag, -au, nn. a burning again ; a scorching. 
Adlosgi 
pai 

.lii^ 1^° I*",'"l" y trrn dmrydftw keinair kynhn 
ftllw Bornc le olynyon H ItymeriS ftr Tlften girewyr, ac yn 



D«Bi, V. to bum again ; to scorch : to bum 
irtly. 



Adlosgiad, 

ignition. 
Adlucho, V. to reflect 

Hyn wedd, gan aoddi yn y bptflir lit. 
Fan ado Haul gwllewin Syriaiu In, 
Adlucianl wftwT bom el belydron lliilh 



burning again; re- 



Adnabodub 



Adluniad, -an, tm. a re-formme ; a copying 
of a form or object; exemplificstion ; re- 
semblance ; a copf. 

JMniaJ tenf a d; Nmf, 
Brvialioii vut ti & tfUtM oH- 

W. O. Pitgtl; CO.il GH. 

Adlnnio, v, to fonu again, to re-fonn ; to copy ; 

to rep«eent tlie image of an object. 
Adlnago, r. to diag, drav, or poll back. 



Adli^,ljgon,*m.aretroBpeot; anewofgome- 
ttiingpaBt. 
Bwrwadlwg.tolook'bttic^; to take a retrospect; 

Mrneffweb 1 mt adlmf jr pe(b « ddnntmech cbwi 1 ml i'w 
vnmtlnii, 1*1 t tjtwjt jit gaduiudi Bewn BjM. 

SioM Tre/rrdyn. 

AdlWT, ) *m. [llwrw] that nUch belongs or 
AdhfTW, ) appeniains to something else; ap- 

pertainineiit, appiut«iuuu)e. — loh Qlonary. 
AdlWT, ) a. belonging, pertaining, appnrte- 
Adlwrw, ) nant. — laio Qloaaary, 
AdlTTw, V. to belong, to appertain. 
T naUl yn adlwrto I'r llaiU the one belonging 
to the other. — Ido Qlouary. 



AiU'wrwiieUi,«m.appertainment, appurtenance. 
Mae rhyw adlwrwaeth rhyngddynt, they in some 

degree (or in sooke wBy) belong to each other. 

— lolo Glouanf, 
AMychweiA, -au, tm. the incinerated stote of 

atiimttl bodies. — P. 
Adljrdiweddiad, -au, »m. indneration. 
AdlychweddUjV.toindnerate; tobnmtoaahes. 
Adlybih&d, tm. a smooUiing aneir; a re- 

pcuiahing. 
Adlyflihaa, v. to make smooth again; to re- 

Adlyfn, v. to lick over again. 

Adlygiad, -an, «m. retrospection ; a reviewing. 

Adljrg^l, a. retrospectiTe ; reflectiTe; looking 

back to an object ; objectiTe. 
Adl;^, V. to ratnwpect ; to reflect. 
iSjSlSr- i.to-Porapple.g.to. 
Adlyncn, v. to swaUov again. 
Ad^thyr, -au, -on, tm. a rescript; an answer 

to a letter. 

>. a regent; a deputy; a sub- 



Adlywi&etb, -au, ■/. regency. 

Atnt Inrj orarian, adlywtarHaii gwrii 
Senphion, TerTiiadd. a aorgBddi.n. yn 
Bu btewl urddu.-^. 0. F<4tlu : C.a. i. en. 

Adlywiol, a. regent; exerdiBing vicarious, 
deputed, or subordinate authority. 

Admant, *ni. [L. adamantem: cf. O.E. lufmimf] 



Dfoar hfib j g^nrutdAWT- nyt dyn a dyirdt yr bwt bonn. 
! nrt oor* dTOmn-l Jw p" aUaif. namyn lu.y»m nea at- 
aitl. oa gwTT % ajmit. — Campiitc C^Tlymafn,lll. 

Adnabod, v. [nabod : Br. axnauoui (Catholioon), 
aznaout, anaovi] I. to know; to recognize; to be 
acquainted Titn ; to perceive ; to recollect or 
reoover the knowledge ot. 
% ConjuKated like bod ; but not used in the 
pres. and imperf. iud., those tenses being 
anpplied by adioaen. In some tensaa of the 
sub], and imper. moods a contraction occa- 
sionally takes place, with b hardened into p ; 
as, adnaper, adnapo, for adnabydder, adna- 

Am adiiapri bot «f fu agna y a^heu- uinrai u- Torpin. 

Etntbud hufn o&t prtdTerth Tt hTimy. 

Bna dr. oi ArViir: M.A. U. 118. 
Hawtt heb 7 PW7II loefl o tumawch ohvi ». tuUuippo j 



Adlyv, -iaid, * 
orainate. 

Gahnete 
Tng BsliTd. nen liiira on I no 
A3huxda adtipt! tano yntaa 71 
4dlyirt.iirl.-H-. o. A,*,.- C 



O oAutod, oJutydd dy him.— iTfii. Jrc*. fiL BO. 

AjJTtmadnabot nana y mm^ buwc doiivc lygiUTd dymawt 
■Dgheiuwl hoDAW. — Mnbitoffion. i. IS. 

Ofarrn ddian o uitnriaeUi rw'r dynion all sydd faeb nd- 
oaiBd Dnw, bab Inim adnabod yr hvB efii, with y peth&a 
d. % valir, ao ul arfvaA-OHf y gwdthydd VTth ystyried y 
gwiith.— »«(*. liil. 1. 

2, to know (oomally).— Gm, iv. 1, 17, 25. 

Ao^mdytUwafrofolioimiref bonno LryuiHyp ■ antit ydaw 
a bonfy.— Snil Or. at JrMur.' H.A. ii. OO. 

Adnabod, -au, on. knowledge ; aoqnaintonoe. 



Adnabod, a. known, recognized. 

Adnataodaeth, -au, «/. knowledge; cognizance; 
acquaintance. 

Adnsbodedigaetb, -au, s/. knowledge; cog- 
nizance; recognition; acquaintance. 

Cknyddeddfyu 



Adnabodawl, a. knowing, recognizlug; per- 

O dilpheth y osir dent] adnntedmri or Ddow b'I swyllya. 



Adnabodua, a. knowing, recognizlug; well- 
known; recognized. More regularly formed, 
but much less " " " "" " ' ' " 



kc yno ^valvn q/fwifrcHfitf In 



,>gle 



ADHASTIlDZItia 

Adnabyddediff, a, known ; acquainted^ 

Ar vrtb hyynr WUhsht bvt «j>H^Ai^|rc jtL d;anHjtJi ty 
yn bDt 117 JD panwt jjii^Ma jth crbyn o chPymf Aj dyvol 
jr yiiy> bonnmegj" yd wuTtyn jogy™il»w dpot ^dy. 

Adnabyddiad, -au, int. a knowing; a recog- 
nizing; recognition. 
Adnabyddiasth, -au, ■/. knowlodgo; acquain- 
tance ; cognizance. 
Td oI ttjA^ eUUIeili)[taB Dnw. u aJuabfidiailh 7 gmr- 
'vniaM.— Til. i. 1. 

Tri adxabyiUiarlli ■ busnt ddwUiiDel] : ftdiubod Duv ; 
■dn^nd cftkn dva ; bi bdubod (mJon n buniui- 

*»!.. .IrcA. iii. SOT. 
7 ddwT niud] . . .jt uartifir 
rS-o. fi-imiv D.P.O. 1. 1 (101- 



cognizing; lokown; 



Adnabyddol , a. knowing ; 
recognized; familiar. 

Aduabyddiu, a. known ; well-known ; ac- 
quainted ; recognized ; familiar. 

God obyD tj cnv loboFfth ni bOm nditaby44m iddynt. 

Adn&byddiurwydd, *n. tbe state of being 
known or acquaint^ ; aoqnaintednesa. 

Adn&bjrddwT, wyr, rnn. one that knows; one 
that is acquaint«d with ; a recognizer. 
A Daw, adnab^Mnr okIdou. ■ ddog dyvtialHiUi Iddynt. 

Adnadd, -ion, am. a chip ; a chipping. 

Adnaid, neidiau, tf. a leap or atep back ; a re- 
bound. 

Adnain, neiniau, »f. the echoing of BcreamB; a 
Bcream re-echoed. — P. 

Oodde ^wTTch dymbi hir d bikdein 
DrohyRb bM aneg aw ei Aadneiii. 

Adnair, neiriau, tm. an attendant, an esquire. 

cbnn'iddrDi^ 

%, In the oort«sponding passoKO in the Hen- 
gwrt Ms. (Williaraa's od. 5 8) the word ia 'ao- 

curyeit ;' and in the copy in the ' Uyfr Coch ' 
(Hhyfl'sed. col. 61a), 'ysgwieryeit.' See^cur- 

Adnalr, tm.^Adiieu f 

Hkvr Iwy 7 cndsf do dtnir Iced neirthTad 
Eshel lead lied adnar 
Qwt yH7 ya ludv ym kaddr 
Own itaw giitevn,w goir, 

phglip Itrj.l),M: M.A. i. we. 

Adnair, neirian, am. reproach ; ill report. 

Bac drwa 07 divg sliflV. IJr/ovl: A.B. U. 307. 
OiTBlwyil alnrir 
OwedBgkyfrBir 
MewQ pdr poOMU.'-tf'-. K>u<I OA.' H.A. i. 409, 
Adnao, am. a possessor or .owner P 
Nid men ree adnan rbac adneir dilya, 

<ir. abU.itl, TW.r: If.A. L iTT. 

Adiuuit, pi. ©dnynt, am. a crying again or after ; 

a longing. 
AdnAu, V. to reiterate a call or cry ; to resoand. 

Nmd adxau oogeu cood neud sttrc, 

Ufa. ab U^w-ltn : U.A. i. 3»i. 



Ucb gvmod tna ih 



Aduair, -iau, tm. a careful looking oft^r. — P. 



T<iliaU,- M.A.i. 



Tn solcith iidiuii- mil rd udaM. (In Uu cooAkt Uma 
will uain betkU wbkt brfeU betors. FA 

CuvbUlK.- li.A. i. dfl (cf. lU). 

Adnawdd, noddau, am. a rosouroe. 

Ailnodilaa givtad, the resoorees of a country. 

Bn IV lutaoddau ddechnu metlia u d oblith, nairdd 

olaf yr aimedwydd, fygwth eC uWI. 

NidoM (hyd eitbif cyrfaudd alngwybaduUijiinaralrg- 
lod cyffradinol A chyflawn wedi «i fynLcnerTd, hyd eto, o 
•idimUiK Cymru.— JtMy^fiU, i. a. 

Adnawf, nofion, tm. a swimming back, a re- 

Bwinuning- 
Adne, -au, am. custody; keeping; deposit? 
AdnebyddiaeUk, -an, if.^Adnabyddiaetk. 



a cyngtutH 






iH y nue ... 1 wfddiD boa eu nlydd, a 
fal o lu T Soidd f adafWduAt rhrist. 

Etf. B. Davia .• lago, T«ti 



lago, Tsatu. 

Adnerth, -oedd. am. new or renovated strength, 
power, or force ; reinforcement. 

Dsetb byirrd so odMnl 1 Eshryi 7 Dvyrun. 

mtdmni: Cam. Alan, ISB. 
nil telynoriDn, dued adafrlh I'cb tuman. 

TA. U>^ Jumtt (C.aH. i«. M). 

Adnertblad, -an, am. a reinforcing: a rein- 
forcement. 

Adnerthol, a. reinforcing: strengthening anew; 
reinvigorating. 

Adnerthu, v. to reinforce ; to strengthen anew ; 
to renew strength to. 

AdnerthWT, wjt, 1 am. one that reinforces ; a 

Adnerthydd, -ion, j streugthcner. 

Adnea, -au, im, succour, help ; guard ; pro- 
tection. 
AdHtt yr uogeledd.— ^iarvA. 






I. ne. 



Adneu, -oedd, am, a thing deposited or entrusted 
in the hand of another; a deposit, pawn, or 
pledge ; a trust. 

PuybyimHC 7 cairr tlcdn.t ynr dy nen m dyble 7 ty gas 
Qot y ^yiunhu yndnu katbo yiuir ewH^twoy^arf raov 
Ucilrat euo pyjwyiwB liyBU fuu y ty r»c y Unirat me }jiw 
hynny y bamun ny y ty biiiuiv yn halaucty ac ^ hp alio 
y ^yt AC ew ffytbyr i^^nfli a byd CKny dely perrh^uuc yr 
aJUfH cHdu ty B»n I4C llcdntt Txy byd ccHkdyc ynteu or 






a mdder i gmdir i aimll- 



IcfTnS- 



i^ii'j H'oUiow, III 
T>ir ffoidd y ipnilieair da y wrtb dyo yn tuigby(raithi4wl 
aanJ vehanir u bocbenoifiu-Ui : td^— - "'-- - *- — * — 

GwvJtbH BjmU yn adMau, 

Pu fu cEwe«( ni bydd Utn.—Diar^. (M.A. liL UC 

Y ffHT a orau awyrawl ednajnt 

Ad Btlnru daauH*].— £)>d><- ^nu .- U.A. i. »IB. 
Edpydd gweioydd gwairtl nrfam cadd dafmrd. 



Ar adn«u, ) in tnut, deposit, pledge, or pawn ; 

Jn adneu, j deposited, pawned. 

^ <>val< dytoi diwedd ir ^ duleddaa hjrBy, fs ddodea 



Owaedd uvxh adiuu, a cry or proclamatioii 
over a pledge or deposit: 'the ciy of re- 

asaertion.' Bee Ad/iin. 
TUr ^wm«dd ndun j lydd : pncdd fwlad a olMB W d] rn 
Dedm ; gneda awch odMn jm hftwl a mint ; b gwudd 
vvch ikdwedd Tng Dvarfod o fnlat. 

BanUa,. L 368 (ct. IL W, <B, BO). 

Diaapad uioch adnea, a cay for restoration ; the 
name of an action in the Welsh Laws, which 
aeems synonymous with gwaedd uwch ad/an, 
guMudd utach annwfn, axid }iau)l ddiaapad. 
Tkir diupAd owch adnem {at, odfan) roydd. , . A hocuho 

m flwir JD ddiAflpad nwefa a4im ; a« nj irenodewir dyn o'r 

m*fed drn iUbh.— X<yu WaUiiac, ir. TO. 

Adnen, v. to pledge, deposit, or pawn. 

J<bn> cyhyrrn gu g»th.— Own*. (1C.A. 01. 148.) 
Dirnavt noi ■ ofd it drmiTDa. tut oMMh- j ni «■- 
■rmdlc— &^ 0r. at Arllnr (B) : H.A. ii. Xt. 

AAA BUibncbm.— Zfiiiret. [U.A. Hi. IM.) 

Adneoad, -an, »m. a depositing, pledging, or 

pawning. 
Adneoaeth, -an, «/. a deposition ; a deposit. 

Oacyfagwld, paddyddT^: neulofr, iKit (ulMaartA^ ueu 
f«aiTK, pn ddydd. ■ pha flwj;ddTii, t dyljid ei giel dn- 
(dufo, nea dAlu dr« ei^T'iwwid- 



AuTDTiAidMu^— iuhu.' A.B.ii.ias. 
AdiieTi&, -oedd, a/, a place of depoait, a deposi- 
tory, a depAt. — Llannver Mt. 
Adneuo, d. to bo calling often. — F, 
Adneuwr, wyr, am. a depositary. 



-ian, 9m. a T«obanging. 



AfnjTHf 

Admewid, 

Adnewidiad, -an, *m. a rechanging. 

Adnewyddliaa, v.^^Adnewydda. 

WedT hrniiT Ti) »**3' Emrr" i Lunde 
yr fi^lwriaau. Ac tut 11 
TkrnatbTeQ 



ocdft yn y kviiliaj. 



li hynny etholedidoiL 



ihilm. 



Adnewvddiftd, -au, mt. renovation ; renewal ; 
rafrMnment; retntegration ; a refitting. 

Tmmidfvf^ trwr adntKyddiad dch ineddwl. 

BImf. xiL %. 
Ta yr yfll^r ynu j nua [nnctviddlilLd] t^i mrwyddo cy- 
ffredinol a gfvddol adnnej/ddiad yr nufd. 

ff w. Enrii .- DrTdll Ti^T. 899. 

Adnew7ddia«th, -au, «/. renovation ; renewal. 
Adnewyddiant, iannan, am. renovation; the 
stst« of being renewed. 



7 Adofidiol 

Adnewrddol, a. renovating, renewing; re- 
newed ; coming or hapj»ening anew. 

Dyu nodd adaivfiUBt yn tfaedfff drwy vythi y pren. 

Culekgrivn, i. 1£T. 
Tw bywioctnt 
Gbd adu^vi/ddoi ddawrder yn ddiocd. 

/. n. P/raid! Ooll Oiryntk, i. SM. 

Adnewyddu, r, to renew, to renovate ; to re- 
form ; to refit. 



(wtii, Bc yngneidueth ^^wn. ftc & beHo odRtwgdda 
t. Uywodneth gynnefo^wl yn ci wlad. 

flnJ Abarpergam: MJ.. U 



Ave/ (Cyfr. r BdHd, Blu«dd. 10). 

Adnewyddua, a. renewed, renovated ; reno- 

Bd lunr [RhyddnuRhl . . . gwedy ftduot enryded y 
genfdyl s hon, a K*vdr UotDomanf u atmicyduna/ gvD- 
maTl y gyfaeMTyon genedloed.— 0pb( jf 7V*°ir'(Vi'<"<i M. 

AdnewyddwT, wyr, w». a reuewer, a renovator ; 

In EvTop. 

MfAm, HI. W. 

Adnod, -au, «/. a verse (or dividon of a chapt«r, 
espeoally in the Bible) i a sentence. 

Yr schlymr u hi nn y Uehiwyd ygeiriiu lydd i'lf mled 
yn yr adnod D*r blaen-— /fr. Own, 89. 

PeuTuxl ac adnod, chapter and verse. 

Credu yr wyt yr boll betlisn n adnddcidd M. Tbeolgffuii 

Bllan o't YwgTstbjna, gux hynodi i mi y benaod a'r adrit>4. 

Rabrrl Uvtd : IJwybr HyiT. iSO. 

U Davies (1632) says, 'Bstque vox nuper 
pfBcta.' The first edition of the Welsh New 
Testament (1567) was but partially divided 



Adnodi, IT. to divide into verses ; to subdivide. 
Adnodiad, -au, am. a division into verses; a 

subdivision. 
Adnodded, -au, im. a resource. 

A dyn, yn lie ymddyryini yn ei «nehyfBtebijlniydd, >ydd 
yn (s^ adnoddri ynddo ei hon iV gynnonhvyo yn «1 am- 
onjon.— A. Hobrru: Beryddiaeth. 48. 

Adnoflad, -au, am. a swimming or floating back. 

Adnoflo, V. to swim back ; to swim again. 

Adnoflol, a. swimming back. 

Adnydd, -au, em. a gate-post. 

Adnywocftu, «. [nyw] to roinvigorate ; to re- 
new, to renovate ; to reanimalf . 

Yno heryt a niae mefn H. oiwir midiosi. H rei hynny a 
ddwg eryrot parth Hg attam ni. a thnry y rel hynny yd d(- 
^^icofiaant hwy. afl y f^ffant y lleufo- ffwsdy aa oollont. 

Ado [?]. See Acdo. 

Nav ^It oao ado. 

Na bryn na tliynn. 

Na rynnawd goSo.—Talieiin ! A.B. ii. IBT. 
Adoew, -au, am, a spur. — Henri Saleabury. 
Adofidiad, -au, im. a vexing, grieving, or 

afflicting again. 
Adofldio, V. to vex or grieve anew. 
Adofldiol, a. vexing, grieving, or afflicting 



AuOFtBITB 48 

AdofldiwT, yrjT, §m. one wbo re-affliots. 
Adofwy, -OQ, »m. reviritatioii, a second visit. 
AdoApyad, -au, no. a revisiting. 
Amurcfarnl oU djr aJoflcyad byr. 

Can/aflKPc*.- Celnloo Attbh, m. 

Adotayo, V. to revifit. 

Tydl th bwi ■ aJa/vgaf tt 

Eufiucfa bad.^ u: O, Ai^Ai; CO. ill, 11. 

Adofwyol, a. revisiting, visitiDg again. 
Adofwywr, wyr, »m. a revisitor. 
Adofyn, V. to ask or question again ; to re- 
domand ; to reclaim. 

■ «]FIUMlI dy^ I odo/in d»dt 



Adofyniad, -an, t 



. a requisition; a re-de- 
e-demanding. 



Adofynol (y), a. asking again 
Adohebiad, -au, tm. e 

spending; respondenoe. 
Adohebol, a, re-answering, respondeat. 
Adoheba, v. to answer again; to respond; to 

re-oorrespond. 
Adoig [?]. 

Uyu die ui poll painbl a dtif 

HwD UmdawB ddraiMivv dd&WD tnfoiw. 

Urwivr ai,rvif:lS.K.\.Ka. 

Adolrhain, ) v. to retrace; to retraok; to 
Adolrtaeiuio, ) search again or anew. 
Adolrlieiiiiad, -au, tm. a retradng. 
Adolrheiiiiol, a. retracLog; retracking; re- 
searching. 
Adolwch, ychau, on. [golwoh] prayer; en- 
treaty; supplication. 
Hu aid turn adetuxh [ul. didalwch] 
Nac edJTUirch 

Tyth ««di ynu.— I-iliuH ; M.A. L SS. 
Adolwg, 1 V. to beg earnestly ; to beseech, to 
Adolygu, ) implore, to ontroat. The more com- 
mon forms are alolieg and atoiygu. 

Bhiidd I bm nu oilalKV.— IHarci. (H^ iii, I7S.) 
Gwall rd lad aogji fJcJwcA. 

LlyKarch Sen : A,B. IL SOT. 
En> rdd inlt^gtei yaten i» holl yani Dddimt buy I gyn- 
Dorthim i gafftuJ tref d djid. 

fucAoU 6r. at Ctnm : H.A. ii. BB7. 
Adalwo > wiuf Im dffWin doeUwt. 

Or. rood OoA: H.A. i. SIT. 
Jila<va. D* hint o KSUueddui • faeddiiut y byd n't 
adintn nyn dytodiwi CtM I 

Olmria Sdmidi.' Hu. y Ffydd, SB. 

Adolwg, sm. an entreaty, prayer, or earnest 

request. * 

lijn -rfmnaai heb ft AiUmt u bynny y mu Ty adaliK 
ytt drwy dalu ohonafl ytU diss dy dniul.^SI. Ortat, \ UO. 

Adolvg,fgon,»ni. [golwg]alookback; seoond 

sight ; a review or retroe^tect. 
Adolwyn, v. [gawl, awl: cf. addawQ to be- 
seech, entreat, pray, or implore. 

Bod ffWT &nll yn gmllu 

Ym odotvit-iKiBiiin.^Prsdtdd Bitlua; H.A.i. see. 

Yda y mackwy ft doetb paith ae att I&wnglot. w! tiUjiwjfn 
IdKH yr mwyn yr hynn mirybKf a ffarawd dryoeC dynot 
ygytu ef hyty flureat.~Al, ffrcol, }1 (of. 1, 126). 

Ao adcivt/K iddyot yn yqnaU roddl cuuiDrtbwy Iddav r 
gelHiawtnfelikt.— fiicViUar. aiCufua.' SLA. li.SST. 

Ac WT ddftatha p at yr Iwo, ao dddJHnuiM anv yn ddy- 
fal.— r. SalainiTf: Luo Tii.l. 



ACOH 

^ ^i£oZu'i/n,likea(JoIwoandafo{u<(7, is frequently 
used adverbiaUj in uie sentence, some finite 
verb (such as yr vn/f. yr yU/m, yr ydy») being 
understood, similar to pray or pritMe [for / 
pray thee) in English. 

Paid, Tor nefol, advlmj/n, 

Orydyudaollydi'Didwyn.— Msn Cni: IoloIlja.m. 

Fa lOdd, adili>rw, y dMlmh chwi y c] 
inyir IM a U;Kt«dig*«th yn yr enaid I 

floiew Lhc^.- h 

Adolwyn oi 
AiMwyn t, 
Adolwyn, *>n. entreaty, prayer ; request. 

A body diUwn ef. ao aAnticfit yw gconyf it y godw yn 
da.— Paii^a Ckarlfmat', ) W. 



M uiD^.- Uwybi Hyf . IB. 
o beseech, to implore, to beg. 



Adolychu, v. to entreat, beseech, or implore; 
to beg earnestly. 

fiaayi . . , yn anron tA- 
ymL — Campau dutrtyimatia, | U. 

Adolygiad, -an, »ro. [golwg, golygu] 1. a re- 



T mac Bn o'r gnalrjo CnanJB yn ddiw*ddar, ar ol sym- 
moryd bontliyg yr tdatsgutii bla«oorol yn si hi y haw lb. yn 
Imrtlia «i Ua naxo »c ai el andiit yn y mdd gudynoL 

Omni* iTBoUter MtcJiain, ii. STl. 
nn ndud, gaAedd mnraio J 
bur MuluB..- Omith, IL HI. 
2. a review ; a periodical containing examina- 
tions of new books or publications. 
Yr Addygiad Trimitol, the Ouarterly Eevicw 
(the jonrnal so called). 
At hyn, y mae yagtilcaydd yn yr Adoltfiai Trimital yn 
■ytwl.— OmUmt M*cM- .■ Owalth, il. SST. 

Mi chytrifaT ty bun yn dd^on dlragTain a dldoedd 1 gj- 
fhrtdd ■> adoiirgiad o'f belynt yn yitod yi asuar yma. 

ConrAaoHW .- Han. Cyv. TSt. 

Adcdygiadot, u. reviewing; that is by way of 

Tryd yr oeddym yn arferol. a pb^d yr oedd amCTlcb- 
indau yn nlw amom, i nevUiur Bylndan a-iotufiailiii ar 
ddygvyddiadan y ml*.— Asm Otmer, xriL 88. 

Adolygol, a. 1. reviewing; revisional. 

2. imploring, beseeching, craving. 

Adolygu, V. to review; to revise; toretooapect. 

Adolygu ll^r, to review a book. 

T rtiao a"! Uytryn ni nAolytKyi roam, aydd, baitli 

oywndndob a fwybodaedi, yn domv i'r byn aaooiaaoin am 

daiia.-tf»iKUr IruAou.' OiniU>,lLMl. 

Adolygu, V. to entreat, to implore, to pray, 
to beg. 
A gwedy oauD oon lladd. a darrot hely. y lUTebaiR ai- 
aiggatedi Vt braibiD. dyvDt y Twytta oe yatanell ef y dydd 
hwvm.—Daalilm Atn/au, IM. 

ills'": |'»i»~»*.>«i"pi™.'»'»s- 



Adolygyddol, a. relating t< 

Pe byddai liiyw oertli yn ein Uaia odolggg^^^ n^ "^ '*' 
dyrcbaiem yn d(liarb«l yn erbyn yr enmn caa ... a ajf^ 
1^ gan y naiU blaid am y liall. — Adol^ggAi, i. 779, 
Adon, -au, im. [Heb. adoa, lord, master P Ct. 
Eloi. A.B. ii. 13, 36, 205; la/, lau, lolo Mas. 
28S] a lord or master. 

A Oiynon laryvroDa odm deowf.— '<a«r4>i .- God. MS*. 



Tn OTT u Il&WT vyTlleitreid 
Yd ham medvoQ mat kTntfid. 

M^n^rcA all Uyi0^jpi .' H^. f. ISO. 

AdDti&ii, fm. [adon] one of the divine namw ; 
lord. 

Adjmait rw Dow o aUt.—Da/fiU .VanMor, 

Adore*77ii, f. to take possesdon again ; to re- 
pOBSeas; to reconquer; to regain; to subdue 



Aefli * CrmiT yiW f ff»TT, ■ Morfnuiirr. ■ ©went, ■ 
Bneboniog, ja Tcjtaatr nos ud Iwu 8*71 y FfruKod . ■ ■ 
mo adtre^gH w tiroedd a vnuth llawer o'r Cymry. 

/f .ia» Br«Va .- iLlL ii. SSt. 
A thoiTi iu>nic m^ell Alier Beiilivl . . . u Maragun boll 
Ofcedigyrnvn.— £rul jr rincirw^iDn, igs. 
Adoreagyn, (m. reconquest; reaposaesnon. 
RIi gellld uteddyd ua nu Kellid bnint gwkd ar > 
TC^si rrfel aAirtijifli «■ j Owjrddyl.— /oio ifc*. 198. 

Adorth, ma. help, ud, asfdatanoe; protedaon. 

Uew Unaoet Uimit 7 deniyn 

Uyi ehaith Uu ddcrM Ilevrn.— C7imJ<<>h>.' U.A. L XB. 

Baid nenet niieniK onad 

Tniac ufsnt dwth dumed.— CVKddiliii; M.A, i. Ml. 

Tm ^ i niwap t ym proniyl cneit 

Tn ufDrM ehorth ehoraeit kyngein- 

CrUddio.-M.A.i.afil. 

Bfartel m ddjKWTdd*nETotriiirag r Odfnida'r Defaid : 
K*r dsfkidineini duofn u uigbalimdid s feddyljuuit nui 
nlon Bjnof J B«ifnid otddrnt j bleiddlald (beb T>t>T tn 
Sod eT9]m>™ galoB iddjnt hwy^ detiid betyd) ■ ertyii- 
T— ' ea loAnM ni erbn r 8«fiad. Hynr ■ gBimot. . . 
Ac i rrtal ydd Beawit, >'r boh aifrod a ladduuit, s't boll 
btenuBu ac wlyfutbon a gataa 7 blelddiBid 1 a mawr 
a glnddeatiu vleddan a wmethuit i diig 7 geifiod. . . 
Ond pan dderrw'T ystoiiant brwrigli s fedarlwyB jr bleidd- 
iaid nrmpn fn luaaf ar T detald : ao tdly t gwJMU m it. 
. . . A'rdmJoLpanoeddrjddiweddiUiavelaVJit FaintBn 
dliynwyrdeb a*a bafaaia ua nttiuia o honriit fal byn 
sioed 1*1 Ueiddlaid ; a thra edhr 7 bu nnthynt teddwl 
i*w bo«d am crfyo adorth yr eBfllod unihingtz a ibcipua 
htaj.—lota Mu. 178. 
Actortb, a. conglomerated.— ffarunwr Jf(. 56. 
JSragch adorth, ) apparently anch cabbage 
CauH adorth, ] worts as form a head, as 

distinguished from those tbst do not. 

Chmfrar. Potgwaitblonain: plygberlhii pUnngTiln- 
wydd, a maaaenm gerddi ; plsnn oiyirull ; bau pannyii, a 
Baron. ooDiiii, Bwynwyn, Sorwr, jsrJlqt ; plun tta, pys, 
cnl ailortiL : ledaw nrdd & aasm. . . Uawrtb. Impia I»b 
Oniytb perilan. . . Planu pn. ffa, «awl odort*. . . Awrt. 
Haa tD«7<ib odorU a otatytbian obyn y flinddyn itnll. 

IT Da-ries (hesitatingly deriraig it from ad- 
aud eoriA) leaves the word unexplained ; 
later dictionaries, however, give ' studious, 
diligent,' as the metming, thus making it 
■ynouymone with eorth, which con scarcely 
be the case; for in the three extraota from 
Cynddelw, given nnder the noun, the two 
words stand in such close relation as to pre- 
clude that notion. 
Adran, -au, «/. 1. a subdivision; a section; a 
division ; a clause ; a part. 

Arb« rboid^ 
ibaiHdd byd ou gall ia 



2. in the Walsh Iaws, a division of hereditary 
property that is made between cousins. 

An mdr hyny keffyndsrw adyly airan eitbyr na lyniTt 
oeboedyddyn.. •-—"--.•->- -^ 



. A)> velly y iriy kynycdorw mnw. 

Cg/miAiaa ?yinn.. U. S» (cf . » 



gall (^ gTwydro 1 dragywyddold^b 



Tri pbilf-isnbid a fydd ar dbr ; 

S. adram rbwTU oefn^ " - -*■ 

ddenr.— Lf^Mlfa/tia 
3. a comma (in grammar). 
Adraiiiad, -au, em. a subdivision ; a tepartitioD. 

TneUier bellscb am gorfanau c«rdd diifod. a'u llsaoldsb 
ar beinu a chadambau melnadflr caniadaidd ar fU a pben- 
Dill ; yi eT y« corfan, adrauiad ni fan nen tniob paiUi 
gorpbiryifa'r cuwl, ao awdl ar ddivedd y baji. 

Adrannod, -au, i/-m. a mark denoting sub- 
division, a section mark (J). 

Adrannod — i ddangoB gvabanol mng«iau o*r un pvnc. 
J. W. Tlwiiuu: Try*. Athr, 888. 
Adranol, a. subdividing ; sectional, divisional. 
Adraau, v. to subdivide ; to part into smaller 
divisions or sections. 

NiddylyDanainacewyTtbnaThanuiiaoaJraiiiinaf^y- 
bydeddn.— £f»M Wallirat, i». SH. 

nam yn ddyryvwob ean^, aydd yn natorfol yn 
yn adnum i iwybiau ■ rbodtvydd aofeidrol, lie y 

Bni^. Orlat. SW. 
Adranwr, wyr, ) one who subdivides; a sub- 
Adranydd, -ion. ) divider. 

Adraadil, i. The meaning is not obvious, and 
the word appears to occur but once. 

adrtudit gogaa. 

Am dir Btmykawr o« girit hir alaoaa. 

XsnUii: A.B.K&. 

It has been rendered ' pro^ostication,' 'the 
thought of the toe,' 'tne mfemal thought,' 
and 'promised ills.' Fu^he reads AndToedyl 
or Andnutl (with n), as if derived from An- 
drat, a word in common use ; but neither the 
text of the ' IJyfr Cooh,' as given above, nor 
that printed in the 'Mvv. Aroh.' (i. 143) sup- 
ports that reading. The rhyme suggests the 
eeparatioD of adrat and dil. Adrat occurs as 
a personal name in ' lolo Mss.' 11, and ' Myv. 
Arch.' ii. 74. 

Adravdd, v. [trawdd : Ir. aithrit]. See Adrodd. 

Adre, v. to please; to enjoy. Cf. Aire. 

Adred, -ion, »m. a running or flowing back ; 



Bod d'i adred at betk, to have 

Adredeg, v. to run back ; to recur. 

Adredeg at, to have 



Adrediad, -an, sm. a nmuing back ; r 
Adref, adv. [tref: 0. arfns; Br. adreff; O.Ir. 
atrtba'] homewards; home (aft«r verba r.f 
motion) ; back again. 
llyaed adrtf, to go home. 
Ergyd hyd adref, a home-blow. 
Qwth hyd adrtf, a home-thrust. 

Argliryd doa di adrtf. — Mahinogim, ji. 331. 
Ho, leidt I tj b«l adrf/l—D. •>» Ovatm. 
Hhoddwyd adrtf tjtilan.—atii. ilU. 38. 



Jm V^.tltH^IL" 



Adreg', -au, ■/. a second gift, pt«Beat, or fft- 

Dntr Mprcher archer arch luiriif o'r nef 
Fan ddaeUi nkl vat uueg. 

Cf, r«arf Coc*.- M-4. i. 618. 

Adr«iBi^, o. [treisig, trais] oppreBsive. 

UeimaiTwyMadrriris.-ifyml nurgni .- U.A. i. B19. 

Adrgop, em. See Adargop. 

Adrif, -au, Mn. 1. a second counting or reckouing. 

2. a number whicli is a subdivigioti or an aliquot 
port of another; aseoondaiTiiiunbor; a sub- 
division. 

Goren fydd y UeiaJ ri(, ll« gEllir adn/ ar hyiiT ; ac 
Did doaparth heb rif ac adrif; a hyn a dwir t AU cti- 
■Efln, nea'r r7«eAu-ril ; ac o fewn i bob un o honav y 
bydd adrif. . , Bhif aiuBirddediK o ryw hefrd yw psdwsr, 
Kt y bydd arhvnw ndrifo aixa.—Barddat, i. IM (cf.lOS). 

Adrifiad, -au, »m. a reoounting ; enumeratiaii. 
Adrifo, V. to count or reckon again; to re- 
count, to renumber. 

A Qiu a^ at hyny , . . yrthlrf/vyf yrbm wrthnaynun. 
IJgfi- OxfiUi Ogffridn (Rha^ymadrodd). 

Adrian, wyr, mn. one who oounts or reckons 

over again. 
Adrin, -ion, -iau, «/. a secret retold ; a secret 

when told to a third party. 
Adro, -ion, «in. [tro] a wandering. 

auvVo"'^ Sriditlniog ! H.A. L IT!, 
liwrv Uochnant vdrymjit a dro. 

Ufv. bI, Uywflfn: If.A. i. 3m. 



Adrodd, V. to relate ; to rehearse ; to recite ; to 
repeat ; to narrate ; to declare ; to spook. 
Tu humt i adrodd, bejond expression; inex- 
pressibly, unutterably. 
Adrodd chwedl, to tell a tale ; to relate a story. 
Ny* adnwd OododlD « Uawr Mordii. 

Anlura: Ood. !7. 
Adroddvch, mafl'r Darwrddon, 

Urdd mawt, a fa'abniddiiMaiit— (^iniiili Owam,\i. 
Owaith mawT, and smiUi mXti a ohwiUi, yw adrodd 
helynt y CyioiT.— TAw. Kipow,- D.P.O. L 1 (I). 

Adrodd, -ion, am. narration; report; relation; 

SoiUala, OBnn, nea ygr lfrou adrodMcn uillad drythyll. 
AOwfdd Paradictl, 83. 

Adrodd, -ion, »/. a gift returned ; a gift claimed 

Shodd ao adrodd, rbodd bachHm. 

mara. (KLA. 111. ITS.) 

Adrodd&ir, eiiiau, wn. tautology. 

Taatologla, Bepetitia, Adnddair, a fydd pan adrodder 
yi on gair nan yr OD ymadndd diadietD. 

ft.i« Uji/p Cerdd. 117. 
Qwag adroddeiriau, vain repetitions. 
Adroddawd, odau, odion, nn. a narrative ; the 
predicate. 

At y dalenau canlynol, T toAo yu jggriteasAiK yr ad- 
raddnoi tbyfedcbf a ddarllcnwyd eilocd. 

J. ViUisM.- Or. Byv.^basl. » (cf. 80, 100, MS). 

Adroddavrl, u. narrative; relating; reciting; 
predicate. 
Yr adroddaw!, the predicate; the prcdicaUe. 



Adroddedigol, a. narrative ; reciting; reheaco- 

ing; jx-edicatory. 
Adroddgon, -au, ■/. KKntative-^IT. 
Adroddganu, v. to nug in recitative. — W, 
Adroddi, v.=.Adrodd. 

Owybodawl CBffai byn a aynlai o 
Adniddijuaew!idim.— W. O.Poglu: C.O. Ti. H. 

Adroddi, v. [rhoddi] to return a gift or present ; 
to give back ; to return. 

Nid hwyiach mai gindl g:an y Kv{ r byn ateh . , . miii afe 
[yPab] yw (Twylim a smjcbcidwitd t^ Ismel, ei fodef ^ 
ca«l atebioD oc yrOKdroodion o aneu Duw. ac yn adroddH I'r 
bold yr tmrhyw heUiau aff a gHfodd. 

Mtru CxfiA: DiByniad, vi. U. 

Adroddiad, -au, nit. I. relation, narration; re- 
cital, rehearsal; report; account. 

B jddsd yr adraddiad yn edlym a nwyfiw. 



A phao glybn Otdeon admddiad y breoddwyd, a'i ddimad, 
«fe a ftddoiadd.— fiuni. vU. It. 

Adroddiadau dadleuon cyfraith, law reports. 
—W. 
2. a sentence or period. 

oamrywamau ^^j^^rQ^^^Bytt. 477. 

Adroddiad, iaid, on. a relator, a narrator. 
Bf mvyhaf t met adniitid. 

lAttn. ok Urwilr> - H^ f. !SB. 

AdroddisdTdd, -ion, tm. a narrator or relator. 

Adroddwedd, -au, ion, »f. a phrase, an idiom. 

Bhaid hefyd adw adToddtctddau 'i OainncK. a eQw^ 

Qrowwyr phra^a; canyn Did o« dun wrthtma^ nw ym- 

admdd na bo ynddi bnawd phraaan, ao arferawl adndd- 

•HnUicm yr iallb.— fln^iuU SoiarU; Omu. XM. 

reciting ; oonununi- 

Po hynat, dosUui MA dyn 
Aindd>uaMainMiju.—L. ff. <7MH, i. xxrlLlT. 

Adroddwr, wyr, n». a narrator, relator, or re- 
hearser; a reporter. 
Adroi, V. to give back ; to return ; to restore. 
Adrop, »m. See Adargop. 
Adroaedd, -au, rnn. [trosedd P] transgression F 

Neud cynhebTK ddig ddygn adrottdd drist 
Ik pan ddelid Criit weddw athiist wedd. 

Qtnagn Ddi Ar/Bw: ILA. L «». 
O gjtjn^in angan dniawr yig adnmdd. 

Mai Clod-tddfa .- H.A. L HI. 



A mawr inni, gan j m 

Adrwyui, -au, tm. a roatringent. 
Adrwymedigaetb, -au, */. reatringency ; the 

act or action of robinding ; roobligation. 
Adrwymedigol, a. restringent ; astringent. 
Adrwymiad, -au, im. a rebinding. 
Adrwymo, v. to restringe ; to astringe. 
Adrwymol, a, restringent ; restrictive. 



51 



Adbojx 



OwtJlfr Cymry geUo idtlyss 



itirrjr Cl^nof. Ai£t. Orist. 
f BT d«lod-l»fer]rdd gea j 
dufpryl gflnfm i adrybadd 



, . Ij^dion ■j'n en mTH . . 

neira yigrifai.— Or. fioiirU.- Gram. 

2. lieanftj, uuoortBuity, random F 

At adrybedd, at random. 



tofynii oatanDlftcCh pethan elfouin yn adri/bfddus . . . □ 
fedm 1»nia ^ hTfrswd; TrwybTddir Dod dyn yn greftdar 
rtiesjms-irL— 'finrr Pern : Gg:L ETt- A"" 4. 



)a. [trybeUd] BkOful; es 
i dexterous; well-Teraed; & 



-^ lunddetald^ 
fu lyw beth bydol 



Adiybrfid, 
Adiybelyd, 
Adiybolydr, 

Pa ^o^nuH^ iddo yog u^hjtch nxitheg 
Ben br/nu tjr. neu grmiaaiaama ar oir. neu tt 
oiaJl, miri a*! oawKch ef yn ddtoon adr|rMMfi\ 
ptiuodetaMbkn.— BoterlZJiivd^.- LlwjbrHTfl. 

Adrybadd, -ion, «m. a second or reiterated 
warning or admouitioa. 

Adrybnddiad, -an, »m. readmonition. 

Adrybaddio, v. to readmonish, to iram again. 

Adiybnddiol.a. rewaming.adnioniahing again. 

Adryaedd, 'an, nn. a second excess; over- 
excess; HDperfluity. 

Rt met UjirelTt) Uf" in««Tgt>«th Wynet 
.Id/f iK< dtek aaoMli.— fftnin fTon .- M.A. i. 3SG. 



Llftca 



QwywA tdrjfw 



Adryveddol, a. very exceaaiTe. 
Adrywn, v. to be excessive? 

DngDat r 'Wytgrac a dnant ; drda 
A drvHrt L adiyBBei T] nftooDaat 

"( 



Jfi^nnA aft £ViHlr>i .* H.A. i. ne. 

addicted to pleasure; wild; 



Adryw, -iau, tnt. a secondary or subordinate 
kind or geuns ; a subgenus ; a species. 
Tli hsnmdd gsir rm&on : 1. Ayv, Itl y mae dyn, neu 
odioa; 9. adryw, fal y mae rwryv a benyir, babon. neu 
Klaiidi, BiegyB jpn- neu «™%, a tharw a buiroh, neu lo 
neo Tch 1 S. a lledryw, fal t mae il^naldeb, djndav^ ma- 
iHAaod, tadoldeb. mamoldeb, seu eidumoldcb, aiufeileidd- 
dn, bwyat^eiddrwydd, a'r t^Ueijb.—Llanovtr Mt. 48. 
Tri arfrrH gall : Dod baniuK ; rbagHnrrid ; a ehynwUt. 



Adrywedd, | -au. «m. the scent tliat hounds 
Adrywjrdd, | follow in hunting; a trace by 
scent; a trace; a track. 
DyiVwedwutrirelvBt u g«a eel^n 
Am draetik Edrywy odnnBtd bimin. 

ffmfcAnai.' U.A. I. 300 (ct. 966}. 
Xal yCjuydanTraifrfiHiUoddivrtiiTrymJyDiaidyDy 
goUoait bwy ea tuuynt.^^. Oaain ab Vrua. _{P.) 



Bnri I'lrri: Xfl.l 



Adiyw«ddlad, -su, *ni. a tracking or tracing 
by scent ; a maUng or leaving a trace. 

Adryweddol, a. tracing or tracking by scent. 

Adrywadda, v. tc trace by soent ; to track. 

Adrywiad, -au, am. degeneration. 

Adrywio, v. to degenerate. 

Adrywiog, a. degenerate; remollient. 

Adiywiogoidd, a. remollient ; softening. 

Adrywiogeiddio, v. tc remoUify; to bcoomo 
soft or genial again ; to mollify ag^n. 

Adrjrwiol, a, degenerating. 

Adaaf, -ion, »f. a standing again. 

Oonji ryug oalloD gomch aidaf (atairil Uya. 

Philip Brtdfdd: M.A. L S7S. 

Adflain, seiniau, a/, resonance, echo, resound. 

Daetb yr amaer, agog yw y (tydd tertyag, ac nid ndju'ii 
mynyddoedd. — Sue, vii. 7. 

Fui fr> un yn ymarfsrag od 

Adoain, v.^^dteinto. 

Heb flinder ua phryd 
aUaut ac yn rhwygo Ai 

Hae awn v ohil yn adtain nant a obwm- 

/. O. Otirimtid: Oelr. 99. 

Adoefydliad, -au, nn. re-establishment; re- 
instatement; reposition. 

Yr^^ixiyn dal moldiant a'r blaenaf , ac yndlflfwylait 
Adaefydlog, a. re-esteblished ; reinstate. 
Adsefydlu, v. to re-establish; tc reinstate. 



Ads«iUMn, feini, rat. a second foundation stone. 

Ad««iIflMniad, -au, *tn. a refoundation, a 
fonnding anew ; a rebuilding. 

Adoellbenn, v. to refound ; to relay a founda- 
tion ; to rebuild. 

Adaeilf^, -au (4), «/. a second or new founda- 

AdMilfEmiad, -an, on. refoundation; a re- 
newing a foundation. 

Adaeilf^nol {a), a. rofounding. 

AdseiUituiu {i), v. to found anew or again; to 
refoond. 

Ad«einiad, -au, rai. a resounding ; an echoing; 



TalUiia: A.B. IL 1S3. 



Adaeinio, ». to resound, to echo ; to rcTerberate, 
OogwD aliafnawr rwg nef a 11a wi 
Fan atteia adoanC pan ergyr adna nt . . . 
Pan lewych aryant. pan vya tywyll ni 

Crailvchai 



Th. Llo^ /mi. 
Adseiniol, a. resonant, resounding, echoing; 

reverberant. 
Pa amled y dlyvaaam ni a liryu 
Ken letbti bryn aditinimit IctslflU maint 

If. 0. P-sH'- CO. Iv. ;45. 

Adaofl, -ydd, -au, sf. land for some yeitrs so 
called after it has been in com.- Oireiit. 



AdsoBt -au, -ion, «m. a secraid mention ; a r 

porting or mentioimig again. 
Adson, V. to mention agnin. 
Adsyhr, -ou, •>». a aeoond new or notioe ; 

AdvylwKil, -au, rm, a noticing or viewing 
again ; a seoond notice or observation ; an 
additioDal remark ; a remaik or observatioii. 

Adsylwi, V. to remark, notice, or observe anew 



Adaylliad, -au, am. a gazing or viewing anew. 
Adajrllio, 1 v. to gaze or state again; to view, 
Adsyllu, ) look, or observe a second time. 
Adaylliwr, ) wyr, am. one that gazes a second 
Adayllwr, J time ; one that views anew. 
Adayniad, -an, am. I. a rethinking; reper- 
cepUon; refleotion. 
^liifriifa^ii aa fiinraUetli cyfelUa. 

2. ament ; agreement. 

Troedd ynrh&idlbobnciiudo^, cynTpedwaydddydd 
■r hnnjn a tta AwW canlynol, i gTdltQrtlo ym mJiob peth 
W utdoliad Ealwya Lowr . , . BmyncfrnfahoUolntliifiitnd 
■■a eyOtTBiM t'l hall liethu ag Mdd yu yr ugnfflul 
newydd o'r Uyfr Onreddi Cyffredm. 

D. ftdr; Han. CnJ. BW. 

Aday ii w jr riad, ~au, am. a reoovering of the 

Bonses; resipiscence. 

Adayuwyro, v. to rocover the senses ; to bo- 
come sensible again, 

Adsyuwyrol, a. recovering the senses. 

Adundab, -au, »m. reunion ; a second union. 

OiTdymmthfarwyn dioHg ein oyiff. tm te ■ r^dd jt 
ugyfodud oddi vnh j meirw yn adundrb Amur y gorff 
•■r 8n»ia.-rftoiiia, wta«„: Tnmdr.Buch.8S. 

Adnniad, -au, am. a reuniting, a rejoining. 
Aduno, V. to reunite; to unite or join again; 
to agree again. 
Am hyny m&s i ni hyn o luitaja o't Udsf, o aivvt ein 
oyi« a'n henddlau. «f dn bod yn «?] ein derbyn yn gwbl 
iffSfrDun,— riio-™ H'l/ifimj; Ymadp, Buch. 72. 

Adunol, a. reunitiug, rejoining. 

Adurddiod, -au, »m. a reordaining ; reordina- 

Adurddo, v. to reordain ; to honour again. 
Adurddol, a. reordaining; honouring again. 
Adwaed, »m. inferior blood. 

Cneiao ei hiT, arf erf&i. 
Cam Vtrtmr, dryllio pyrff rhai ; 
Uidd ndicaal. He ydd adnen. 
Tori yn ehwym, terwyn lAwaen. 

iBto Ooth, i OyUell Qoed. 

Adva«dd, -au, a/, a second cry, shout, or yco- 



Aatard cbwaat mt 



ntriyd.— 7^/iMl: A.B.ii.9 



Orrer j dtddyf * llsw vng ngwHh ei drafn noid el o'i 
vmln. A ctiBal crsIT a gafsel HtDBW gfirtyid «t Oun. B'i oivd 
1 y mun gonedd, yn* dadgui gifaedd nwch orfiM«W, 



Adwaos, e. [C. oauun, (uwonvoa ; Br. txnto ; 
It. aiigin. ail/mim, adciam; Qa. aitknich; 
Mx. n)n«y] r.t^/. to know; to be acquainted 
with; to recognice. Used only in ^e proa, 
and imp. ind., and prm., imp., and fut. sabj., 
with some other tenses formed from them, 
the reat being supplied by Adnabod, q.v. 

Nl B oiKiuiiini J neb ■ d^yar y k ymry t y nntKw. 

irolMD^i™, iii. M. 

Ar al un *yr brlymain 

TcydyniBr.,tdK»™.-i, G. (7ai*i, VIII. 1. 16. 

Oohl b^eyoeirDno'ohiUen' 

Grmn't OtcBiK, 46 {d. m). 

b. In ILW. and in modem poetry advxa is oc- 
casionally used for adwaett in the first person. 

Kyt alum i dyili heb yi Arttiiu-. H] 

-"— - ■■ 8(of.lO,M 

Tt ydwyt, hyd yt orfu™, 

Yn dv^ hunt ; nl*m giid yo boi. 




d. Adwavnaf for oiiuMCTi is 
Tr lem a. adaabyddnf, ao Fnid b 



imaf MdyliBD dynioD. 

Advaeniad, -au, #m. a knowing or recogniidng; 

recognition. 
Advaenip , a. known ; recognised. 
Adwabaaai, cion. ac. \ a comma (in gram- 
Adwahannod, -au, »f-m. ] mar). Also called 
rhagvxihannod. 

Jr odmiioMi B Brfarir n ladw y tikis mevn srym with 
isrun. u B ddodlr rhma rhan«n o benhynuagBwa Iddm 
mlydd.— IT. 0. AijAr ; &d. laiihOym. i.iii.iir 

Vr aJmhaniad B ijdd i't dynrodiBd dilynol yr effailh 
bwysleiBiad tma.—D. E. Jona: leilh. S-ia. IM (ef. va). 
Adwahandro, -ion, am. a quotation; quotation 
marks, inverted commas. 
Owellrmwyholaethrwydd ohynyn y Sillydd Cynukor ■ 
hefyd Hn y nllgall . . . yr odinUkniifni, u ereill b^buT^ 

W. O. Pughi: C*d. iBith (^fm. I. Ui. *. 
Some granunarians call it rhagwahandro. 
Adwahanu, v. to subdivide ; to separate again. 

y gvBliBnai ndd yn rhanu ymsdnwdd yn ddan, nen 
an. neu luor a ddosinrthladsn, piui ryddo ynddo ■ynlBdna 

Ciliuuwl yngytuiaoddsdlg'; b pba ni hefyd n ellir en 
wakam, yn i>l eu MrtfaynaaBQ. 

W. O. J'<vA<.CBd. iBilhOym. i.iii.4. 

Adwair, weiriau, am. hay of the second mowing, 
aftermath, rowen hay. 



ta35«"adofodBnbcirddcyilt^8^^^nyJ]0^''' ' Adwair, weirion, am. a second putting to right ; 
fV/"»"';S#'WBW, fthaedd. 11. a repairing; repair. 



n Birp MynpM: ILA. L MB. 



Adwidth, wathian, «ni. a work left un&uahed 
which most be taken in hand again ; resinned 
work or operation ; a resumption of work. 

A Tsel I>DWp jud i'u a^teait^ 
Cjrfnlth ddi aAmil* Tdoedd.- 

Dun/n ar adwaith, to restore to practice. 

T bdidd ■ ^WBUt BT eo (Wfltbien trWn ddminaw ar 
bn^mio o faoindir ■ chat crfrin. m'a dirrn u urfer h od- 

A. dwyn v ad|rof ac adw«dd M adtoaiih jt hen oreDon at 
ddefadn m brdniin ^wjt with gerdd dufod.— /oto W». sit. 
AdwuLU, i^. [gw&n] to pierce or thrust again. 
KnitinnuieiiiTtoilic™i,— ^.n.ri».- Ood.S87. 
Nit oanmri r< grmaei ri gwaant. 

flsrchn MiuldtrK: A.B. U. 108. 

Adwutychiad, -an, nn. a getting weak or 
feeble again ; a relapdng. 

Adwanychu, V. [gwan] to grower become feeble 
again; to relapse ; to mske weak again. 

Adwodiad, -an, nn. a repeatjng, repetition: 
Anaphora or repetition {in rhetario)^£dryd. 

Adwedyd, v. to repeat; to unsajr, to retract 

Ad^vedd, -an, »/. a return to a former state or 
condition ; a return to one's former place, 
home, or halntatioti ; a return, recovery, or 
rtietotstion ; a renewed or restored state. 
Dy/od i adwedd, to come to a former state or 
condition ; to return to one's home, habita- 
tion, or former place. 

Ednrd, bui dduth i'w adhxdd, 

Dnry jmiTidiiymeid.—L. a. CsUt, lit. ixt. St. 
Duyn ar adioedd, to bring back to a former 
state ; to bring back ; to restore. 

(Mnmuuit i wjMmeaa csdui wrtb nrdd daSoA nig 
NghuMl Nedd. r* el dwyn ar wIvoM hen gadair a fa 
PB a onoedd eyn oiA.—laU Mit, «g (of. 214). 

TrwT din j nue Dow fo dwrn ar adiaedd alo ei hun hah 
pMh a i-.Tin-^j a bMaa.—Baridm, i. Mi. 

Myned y» adwedd, revert or return to a former 



hjiiT r cafaa ef [Drien Bb«g«dl deynedd j wlad, 
w Blu^cd, a g^rnouChnr caatoU a thnf ddiDGai^ yn 
■■ 11- !--■ * 1. .. _ _ . — -th ifTO«l- 



A"^ hjnj ^ ._ ^ -^T,,- 

a'i ^w Blu^(«d, a g^meuthoi caMell 

Ab&ilycbwr, L]« bu'r orrmal hf d ytumhai ^ 

•abf IB Tua myned yn odiHdiJ yn im i Harganirg. hi y bn 
o'l dnArBoad.— /ofo Mtt. 99. 

Jfyiwd I cu^uwfii, to revert to a former condition; 

to return ; to come again. 
Dy (ddkm nid 1 1 adii>edd.—D. ab Inun Dm : O.B.C. ITT. 
OvMedd uwch adwedd, a cry of restoration ; a 

proclamation for restitution. 

Trilleyiiuei7iuialg«t«K*<*h;boddhydyiiB Dghyhuid 
nndydd a bhryddyn, sc., u ynddynt cynnal pab gwesdd 
Bwdi oitiMdd, BO Dwch adneu, ac uwch adfan. 

£anl<lat, ii. T4 (d. 48, 48). 

Nid U gair i adwedd, a word spokea cannot be 
recalled.— i>i'or*6. (M.A. iii. 169.) 
Tambt Gur UyrtiD hnnoet ar Ffreiiio 
LlainT FTmic ar odm'. 

U^. at Uftctlr' ■' U.A. i. 193 (cf. 3Se, 4BS, (M). 
Bhoed Dow in' adutii iavmndd tbd. 

an. Omi; 11 (of. 4). 



Otn KT y m*c yn ber f i 



M Doyutydedig i 

Adwedda, v. to return 
cume again ; to return. 



> a former state; to 



Br nlvad AlUon, mwUi i adKtMltar 
Baloh fiib, d yi w yK wah lasaa bun j bedd ! 

W. O.P%gU: Pal. S8. 

Adweddol, a. returning, recurrent; going or 

coming l»ck. 
Adweddu, v. to return to the original etat«, 

condition, or place; to return; to restore; to 

give back. 

A cfav«di h/ny y dug WBlun de Iwndtyi y Ttl Chmn- 
raml . . . oddi ar djnryaDgioD Dinefwr. a'u WicvUii yn nn 
1 Morganvs.— /Ala JIu. TO. 

Tri phetb y lydd, ac tal t mae^ ddao oyntai y bfdd y 
trydydd: dwr yn rhsdcg I'r mar oV lie dasth; llinyn 
eyl<ih yn dlwEddn lie bu'r dechrea ; ac enald hjrwrdanl yn 
oAnUa yn Nuw D ba la y tarddwya.— JtonWu, i. Ma. 



Ad-weinig, a.=Adwaenig. 

Adweiriad, -au, am. a repairing; reparation. 

Adireirio, v. to repair ; to refit. 

Adweiriol, a. repairing, amending ; refitting. 

Adweitliio, v, to work again or anew; to re- 



Adwel, -ion, tm. a second view or sight; re- 
perception. 
Ac o hyny gvybod aa adgot hi- 33»iini a cbfOawndnr a 
nhariftH ; ^t; jj^^ ^vybod yu odwd ar J [vif-irinoneddan. 

Adwel, -oedd, em. [=iadfel, q.v.] a stranger. 
Attweled, v. to see again ; to recover the dght ; 
to review. 

Aitctlir giMnan. aa amrwyn kwynnan. 



Adireleditid, -au, tm. a seeing or viewing again ; 

a recovering of sight ; rovisitatioa.— Jr. 
Adweledigaetih, -au, «/. a reoovering of sight ; 

a seeing again or anew ; a second vision. 

rSi^TiaSiiuy 

gaJon. i bregelhn gollyngdawd i'r gaethinn. 
ig^l* i'r deilliDn.— S'. &>te.i>i>-; / Luc ir. IS. 
AdwelifMl, -au, am. a seeing again; second 

sight.— IT. 
Adwelwr, wyr, tm. one that sees again. 
Advellt, am. and d. lBtt«rgra8s, aftermath, 
rowen hay. 

OaeeUlrgoddef colled potta lie bo yu fawr, neu adurlU 
bna beb ei borj, bon j dm oooh osu ddvr Uif amo. 

Adwen, v.-^Adwaen, q.v. 
Adwem, -ydd, if. a place that ia partly a 
swamp ; spungy or swampy ground ; a swamp. 

Catb hir-daith gettaiu-rnlth g^m, 

Cod Iwyd-wyllt coedwal adxmTi.—D, a» Svnl^n. 1. IS. 

Adwer*, -i, «/. a verse or lesson repeated ; repe- 
Adioerti gweigion, vain repetitions. 

mynealle.. 



IJ«/.- Im 



jm v_.(,K)t;ie 



Ofni gwi ui fnu ^wsth.— W. Cgnwal. 

2. retail, sale at second haad. 
Cy/anwerlk ac advierth, wholesale aiid retail. 

D^nu rt unig tfuufaiud gyfuivalh, fel r KHiivydj. k 
drnu r bril fwcbnadfa adwrrih. T m*o Ueoedd enill 1 
odiKTfiL— /. Jfi'b.* IuddewDaPry>luu,iu, 1, 

3. indeniiiity ; compensation ; relief. 

Ac ynghyTalr tt upywed hvnnw yn dnijf cUiMrllh nuil 
r dywettd rrtreiuu 

Ci/rciMni Cr-RV, il. «» (of. MS, 4M). 

Try ryw tol ywTd y nrynin': Keutwgi uea aumrrt; 
neuetniyt.— Cj/rfiAiou tfj™™, i. «0. 

Adwertbiad, -«u, *m. depreoiatioii ; a reaeUing, 

retailment. 
Adwerthu, v. to depreciate ; to resell, to retail. 
Adwerthwr, w^, 1 «nt. a depredator ; a re- 
Adwerthydd, -ion, j toiler or reseller. 

AdwtrUoB^ pTflgod, pomuu vbo tckU fiah ^ ripkn. 

Adwerydd, -an, «m. [gwei — gwjr] second ver- 

dure ; a second spring or autuinn. 
AdvarTdd, -on, «c [p»erydd^gwyrydd: 
m] a decayed 
idowed person. 
Na ha«dd ogui t^l luilwa], 

Ac u fydd adiacTyid wael.— C th OvUgn, asay, IS. 
Bd fsrw yi him SrjTea runog, no Ulcd rr hoi Brri 
lliryd jn weiidw adurprudd, mc unaduod o gyfulai, heb neb 
a'i cTVjrai tiac ■'! cycibe^ ya ei hoDAint ; yru, gKn drym- 
der brrd > Dmddvl, a thristwch cmJoo, meddvl a orv^ nui 
gorou tyddai iddaw briodaa d hea weddimttJKVrKU ffyfuod 
S'i hllll«li.~/r>(l. ««. IBS. 

Cin A muethpwyd droa farch s wtUwyi d i*larifld 
yn RhH-wd L la mwnir Bgan, lie, mewu U»i ju dvr.4wr, y 
ffwnAfithpwyd triugun a dwj o VTflgedd ya odtprrBdilimi 
ym mldwyf BAnffagui yn onlg. 

v. Saicndm- lUuumr Ha.). 

Adwir, wn, an untruth. — P, 
Adwiciad, -au, *m. a rocertifjdtig. — P. 
Adwlrio, v. to reassert ; to recertify. 
Adwiriol, a. reasserting; verifying again or 

Adwiriwr, wyr, no. one that recertifies. 

Adwiag, -oedd, s/. disarray, undress, disbabiUe. 

Adwiagad, ) -au, am. a disarraying or un- 

Adwiagfad, | dressing. 

Adniago, v. to undress, to disarray. 

AdwiagwT, wyr, >m. ono who disarrays or nn- 
dresses. 

Adwledd, -au, -oedd, »/. a slfiuder feast or 
banquet; a sparing entertainment; a short 
meal or repast; gp^diet; a collation. 

Fob fWledd, er j aydd hrfdyw, 

■Wedl'i wledde(,adiul*iWyw,— IWKr j4!«d: Q.B.C. I3». 
Adwn, am. [see Adoti] a lord, a chieftain, a hero. 



Ky hwjrgyieh dud 



in dad odicn 



Cindidv: U.A.I, a 



Tanrti 

Bawl odm ya^wn yaswyd yn tlete dnic. 

XtJnMrrA all LlfKrlrn: M.A. i. SSO. 

Adwneuthur, | v. 1. to do over again; to re- 
Adwneyd, ) make ; to re-form ; to repair. 

Ya gwyr fy nif « ysgwan ym adtrna. 



2. to Qlldo=:/)(H{u7neu(Aur. 

Nl odinu cyvrallh ■ ndo uniraith yn n^wybod . . . B» 
im bynaff > viwUTr, niddylit d aiivnntthur, 

Ct/rrUhiau Cfmn, U. «». 
Duw d& Did adxnm ■ vnieth.-'/iib Vii. 3W. 
Nyt odma Daw ■ wnd. 

lArB. lb Llyurifn .- H.A. 1. »3 (et. lis; . 
Nid dJU-Kd da d daiwncf ^ 

Duw ■ wnutb Bad el o aet.—D. at 0w>i|[>i>, lixix. B. 
tt«s ai dy bun dy gnmd ■ ddUK, 
Ao tutumrird erdOD ef , yr hyn a vnalat 
Kr dy oeouiaat t~ IT. V. Huglu, .- CO. fii. l«a. 

Adwnlad, -au. »m, aresewing, a restttching; 
a double-stitching. — P. 



Adwnlol, a. being double-Btit«hed. 

AdwnlwT, wyr, «m. a, douUe-stitoher. 

AdWT, wyr, am. a coward ; a wretch ; a alaTO. 

CoUes oi elydwr a Kyroludd tf i [al. «] adrr. 

Diartl,. (ICA. ill. IBl.) 

Adwriaath, -an, $f. cowardice; unmanlineaa; 

Cam s adaw beb got «mb dielaeth 

Nyt sdawd adwy yr adtrriarlk 

Nyt edewea e Ira laa kadoryon FlrdeiD. 

A-a.TU.-Qoi.9Bi. 

Advrio, V. to become a coward. 
Adwriol, a. cowardly, pusillaDimons. 
Adwr^giad, -an, «m. a recovoring of etrengtii 

Admygio, v. to recover strength or vigonr; 

to grow better in health. 
Ad-wrygfol^a. restrcng^thoning; nsnvigoratang. 
AAwj, -au, -on, «/. [Br. odi ; Ir. ath (gen. 

atha), ford; L. aditu»] 1. a gap; a pass; a 

passage ; an opening ; a breach. 

liywdyn a« kddw Uow yn idwtr. 

Ufv. al, Utvagn: U.A. L 101. 
Chwnhed I dnmwy 

Chwediad yn aimr.—LnfrM Br^frai: U.A. I. S13. 
Ef adoeUi y idwf oe Oaao.— fit, Orrtd,\llll. 
Tsir Koogordd mfwy Toys Prydajn : goaeordd Mynydd- 
■wn Biddyn yng Njgbatimeth ; a eoaRordd HBlyn, mab 
Cynffllyn ; a Koflvaraa Drywon, mab nudd, yn Bnodwydd 
Arderydd.— friDc<U.*U.A.Ii. S. 

A diywdiiant sdintat'i tf , pa le bymug ycaffcr adwfi 
ynddo. — a firm, vii. fi. 

Tmae llamr yn tori n^fm, end nM oca nenuwr yn can 
adurj/au: Uawer yn agnryd adwtah j oUirag i mewn Uf«ir- 
lant di^faint Duwarcingtrarukaf. dthrydiydjff ynceiaio, 
drw; wir fidifpinrab, cau yr nJw^. 

»o*B« i(io^ : Uwyto Hy«. Ht. 
Oa dygwydda adwgon. nid hawdd en dJwyvio. 

Anairin Ow»- .• AmaeaiyddkeUl, M. 
Se/yll ar yr adwy, to stand in the gap. — Eatt. 
sxii. 30. 
2. that which stops a gap ; a wattled fence in a 
gap. Probably a corruption of Admydd (2). 
OwnenthuT odv^ ar Iwldi.— Jf. IT. 
Ad^^ajr, a. [twy T\ conflicting ; troubling ; 
toiUng. — P. Unexplained by Davies, who 
suggests the derivation from ad- -^gwyar. 



\st.—A.n. ii. 17 (cf. M.A. i. 67S). 



Dolen dsD ebfT am gaa 



Adwydd, -an, tm. [g*rdd] fallow ground, 

Tri kg &d>t 1 sc nil ffwadif, 

Er naw wl&r Hi rim' nodwydd ; 

TtIt Ufl ' mfl sidion. biieii' ddii^dton, 

O IJT ddioa y tir oJkjA*.— t. O. CodW, i, liil. 5S. 

RmiiTliii hluit ya llo bl«f dd, 

A b*tr rd Us bu'c mtw^.—a. B. at Innn, i Buv. 

Ow&jw irUwydd odvfuid E^m Arrfder- 

^. aSAtndi/dd: Jt..A.. i. M). 

Adwydd, ».el. [gwjdd] 1. shruba, dwarf trees. 

Mh^ toH fwvddi K ^wjdd, 

I toyda llebo'r adujiiM.— e»to-r GIgn. 

2. -i, nn. a wattled fence in a gap.^-Ihi/ed. 

Adwyn, -an, am. [gwyn] metal, 

Mwyni^ (yn), o. shining, bright, glittering. 

Saenadd d ■drluk-waith 
M™ M«i, B'i chTian ro^th, 
ill 1 belfdr nydr yn pmu, 
AawgKleaxtoidaaima.—I. G. GiirimyiU.- Oelr.88. 

Adwyo, V. to make gape or breaches ; to bceaob. 

Adwrth Urnut, bfd oUuIedd iaitt. 
Yd adKiig "i thejwedd.— ApJtri Oioni ; Gwrrth. 16a. 
Adwyog, a. foil of gaps or breaches ; having 
posses or gape. 

Aimgoa ua anhirimDn.— Z>uree. (M.A. iil. lU.] 
Mms gTT dlog yn nAoyo^.— /oio ir«, wi. 
.DrSenrrdd ■ pynhyrtuit mn awn y mflnjboBion, a> 
ohrynm, s-r <«r6Tdau, put dddo Wwy dy byrOi S fd 
iyfod 1 ddiau adingos.—kiet. xxvL 10. 

Adwyol, a. relating to gaps, breaches, or passes ; 
foil of gape ; open ; gaping. 

liawentuITet 



Lwyredte, • oiiTweMii tgc ei aha«r 
^ADjntirgui aCtoRbi iddai threfn. 

~ 1. Pi^tii: CO. tL »7B. 

j; bowed or ben 

Adwyr, a. [gwjT] refreshing ; reinvigorating. 

Ki chd vAdd wycfa aq tuddai ; 

.Ji*Bf r d pwlodd M dii gUa.— /oiverrt Fynflw^. 
Adwjriad, -an, *ni. recurvation. 
Adwymi, gm. recnrvity. 

Adwyro, v. to recurve ; to bend or incline htusk. 
Adwyrol, a. recurving ; bending or inclining 

Adwys, -ion, »/. [gw;?B] a seoond summons or 

citation. 
Adwyaiad, -an, »m. a resummoning; re-cita- 

Uwysio, ti. to summon or cite again, to re- 
summon, 

Adwyaiol, a, resummoning, ren^tang. 

Adwyth, -au. *m. [g*yth; Ir. aduath; Oa, 
aduadh'] hurt; barm; mischief; misfortune; 
erO; Uast; mahgnancy. 
Knd aJwulh balcblwylb byichlnfn dnwedd Uyr. 



5 Adt tio.ua Lu 

Fr adwyth a'th gaffo ! ruin seise thee t 
Adwyth cU/yd, the virulence of a disease. 
Adwythain, a. hurtful; doing hurt or mischief ; 
wrathful. 

Oiryr Pryddu odvjfiAeiB ya Unyd. 

TaUaa: A.B. li. 18S. 

Adw y Uiig, a, hurtful; harmful; mischievous; 
nocent; destructive; apt to blast; malignant; 
distressed, miserable. 

Am^Mc Biiyndaiu Hadkne elast. 
Nid Beth, swjo odMjie*^, 

Edn byn ■ fu dan ei h^.—Gatfn Oman ; a.B.C. SOB. 
I>Bw, gwsnd dddUaid o ddig cutartftvl, 
Blug trota adiBf Alt,—B. D. alt Inan. 



L 1 (tg). 

Advythigrwydd, sm. hurtfulness ; maligoi^ ; 

contagiousness. 
Adwythol, a.=AdTPt/thig. 

Ung dltbao, Ucag adauihat, 

Ulwlddsw dn, Ue'dd Ediawl.— «^ antggid Fydnm. 



ff-^jS 



Adwythui, a. hurt;ful; noxious; blaeting; 
bUghtin^; malignant; distressed; giievonsfy 
troubled. 

[Hwyliu 



hemtiau a dmof^ 



A bair aditfU rtiwDB b 
.''BjiM*ryddi'wd«M 



^akgi Gedi GlgHttg/rdwy. 
On. Ovaia, 60 [c(. B, M, 100). 



glaifim, a*! <i«dd yn 
tr. Balttburg: Uatt. iv. S4. 

Adyl, -an, tf-m.. [Ir. and Oa. a%Uia\ breath. 

Tn Had* y lie yr oedd uifeTtli o . . . bryf tanaul la odul. 
Mabi-O}io». {P.) 

Adymannercb, v. to resalute mutually. 
Adymannercli, -ion, »m. a mutual resaluting ; 

the returning of a salut«. 
AdTmbrawf, brofion, »m. re-experience. 

Ac ni bydd ar ol hyoy drcdglo p6b diitb han/od, ond ym 
mraint iliydd a dew& yo grfymgyd k rwynfyd, yn itdum- 
brato/ae yn adymgoii 1 gwybodaMli.— Snn'diu, 1. 131. 

Adymbwyllo, ]v. to reconsider; to reflect 

Adymbwyll, ) upon. 

Adymchwaliiid, -au, rm. a turning of one's 
self back ; a return ; reddivation. 

Adymchwelog, a. turning one's self back ; re- 
turning. 

Adjrmdiwelyd, v. to return, to come back ; 
to fall back; to recidivate. 



Bydded dy law ar wf dy ddebenlaw. as u fwh dyn. yr 
bwnamdarnhfaktit'dylinn. YinioidiiJi,rMA>m{ion['«ini 
ta gwnlittaiiil 1 wrthyt. 

Llxfr OutAli GiffrtUn IBOT (Bolm. Ixn. 18). 

A phui adjincAvKlscU t Baesou, fe orfn iddyot gjlio fyda 
cbolled a ohywilydd.— ri». Eaant: D.P.O. li. 3 (iw). 

Adymddan^a, p. to reappear ; to re-emerge. 

Adymddrychiad, -au, »m. a mutual reflection 
of objects; a mutually returning to view. 

Adymddrychio, v. to reflect mutually one ob- 
ject to another ; to return mutually to view. 

A4yniddrycMol, a. mutually returning to view; 
mutually reflecting. 

Adymgaia, geiaiau, tm. a reseekin^ ; a second 
attempt or endeavour. — Barddat, i. 232. 

Adymgaagliad, -au, »m. a mutual reasseubliug. 

Adymgasglu, v. to reassemble. 



J;.wV_.(,K)' 



igle 



). to meek ; to eade*T<rar oi 



Adymgwrnio, i 

tompt again. 
Adymgorflbrftwl, a. re-embodjriug. 
Adynxgorffori, v. to re-embodj; to become 

united in one body. 
AdymgorfforiAd, 'Ku, »m, reincorporation. 
AdTmgy&rch, r. to reaalnto nratnaUf ; to re- 

Adymgyfiirch, -an, on. resolntAtioii. 

Adymgynuneriad, -an, rm. reaaanmptii 
EpaniJepHis; » rhetorical figure, when the 
same word after a parentheaii is repeated. 

Adfm^in^mfriad (brd J djwed Dooat) « frdd pan fo tt 
un ^lur pi dcdirm mc th ^orphsi jmurodd, ttl h jn : Ft 
nslulaii ■ lamrodd oth nriad ; m a >ch« hniT 7 lorodd 
ff ngbiUoii.— /Vh XIkA- O'^xniuM. (Iti.) 

Adrmgymineryd, r. to betake one's aeU again 
(to a thing); to ceaBsume it<elf (or them- 
telves) ; to reasrame mutnallj. 

Adymgymmodi, v. to reconcile one's self; to 
be mutually reconciled. 

Adymgymmodiad, -au, tm. a reconciling of 
one's self; mutoal reoonciliation. 

Adymgymmodol, a. reconciling one's self; 
mututdly reconciling. 

Adymgynnoll, v. to reassemble 

Adymgynnoll iad, -au, am. a leasaembling. 

Adymledu, v. to spread or expand itself again. 

Adymlid, v. to chase again. 

Adymlidiadf -au, ttn* a rechanng. 

Adymlnniad, -an, am. a re-forming of it«elf ; 
a mutually forming again. 

Adymlnnio, v. to te-form or reshape itself; to 
re-form or reshape mutually. 

Adymloniol, a. mutually re-forming or re- 
soaping; re-forming itself. 

Adjrmluydda, v. to fight mntnally again. ; to 
reassemble or reunite for waging war; to 
confederate for purposes of war. 

A> Duvnirr hwnw * f u wedi hrny 711 nn drj ^onam 

Monafa^rnddi; aet odimlmiiiMii t'r QvT^djI • wwwtb. 

IM Jtu. fa. 



Taurel fat t/r adymmyr, calm like the mild 

Adymrithiad, -au, «m. a reappearing; re- 
appeaTanoe. 

Adymrithio, v. to reappear; to reflect, be re- 
flected, or appear (as in a minor]. 

Adymrithiol, a. reappearing. 

Adyniweled, v. to rentdt motnally ; to revisit, 
to visit again. 

Adymweliad, -au, <m. reriHttation. 

Adyn, -od »m. [ad-^dyn (cf, aniw) : Ir. and 
6a. 07iriutne^:an-ddjn, airnyn] a wretch ; a 
miserable or wretohed person ; a vile fellow. 
A fa ddyn, uth yn ad/n.—Diar^. (U.A, Ui, 148.) 
Oolvg Dmr ar adi/n.—Diara. (If .A. ill, U7.| 

a. OuaU, S (cf. 68. 79}. 



Adynni, Tan, rat. [ynni] an inferior or lesser 
faculty; inferior energy or rigour. 

OreOiaiitbwytlTnbai.— If. O. A^.- CO. t. 10& 
Adynnill, v.=:Aflennill. 

Osna pOb fiiiiill, adfnmia dj him.— Vin. Arci. iiL St. 

AdJ^; I -au, «™.=.^dar^, q.Y. 

Adyni (y), v. to send again ; to send back ; to 

drive again or back. 
AdyagU', -oedd, rat. the afterbirth or placenta. 
Adyagrif, ) -an, ■/. 1. a transcript, a written 
Adysgrifen, ) copy ; a copy. 



Tebrgol todCandai 



kradawT, ar ol y 
Old gmiw ano 






11.Cy1n.37a 



Adyagrifeniad, 1 -an, «m. transcription; a 
Adyagrifenad, j rewriting or transcribing; 
reaciiption ; a transcript or copy. 



Cynuu gaeladgtpr\feiti, 



. „ .LI Uv d liDiL, yr tmll rtoimn a 
inuwUipwyd yn y ddw3[gymmaiifa hyn, ac a'u Hwdodd 
' — ^ ■^' ■" Ddewi ; fel y g^Uai hrfl og-liT" 

.- Han. Cret. IBS. 
AdyagriflBnol, | a. that is a transcript or copy ; 
Ady^rifbl, } relating to a transcript ; re- 
lating to a rescript; ti^nscribcd, copied. 
Adyagrifbnn, v. to tianscrihe, to copy ; to re- 

lolo Koisaiiw, Ji w yJf U yd J pand-bwyll pa ua a'l 
hschubodd o diuTwnc coU at anjhol, drwy adftgriJeHM'i 
oytan alUn beo yKiillyfiwi dulU a bracii«djg. 

Ct/r, t SrirM, Bhagdd. B. 
Heb ^ynghiair rtiynEddyiit a^u vktydd, neu adfsffn/tia^ 
haarnt mith naili jtML—OiciiieilgM, Hi. 363. 
AdyagrifenwT, w^, j tm. a transcriber, a 
Adyagrifenydd, -ion, ) copier ; one who re- 
writes. 
Adyagrifo, ) ». to transcribe, to copy ; to re- 
Adyggrifio, j write. 

Adyagrifwr, wyr, ) rai. a transcriber, a copy- 
Adyagrii^dd, -ion, ) ist. 

Yr uifflinufft nnlyiiol ... a ymddengyv a bod fa gyf- 
isittaiad o wajtb Lladin Q. ab ArUmr . . . yog nghyd 4 itAl 
ychwanesiiidan a obytuewidiadKu gan ad^tfi^yr. 

CanUHtaiMiK ! Ban. Cym. 6. 

Adystorio, I v. to store, supiply, or furnish 
Adyator, j again; to rcdeposit; to replenish. 

TU i bavb ei eiddo, yna U a biaa j frwcddill ; ac o'i ndw, 
t|rdl biaa yr yitswr a gedmist : me ol anghadw. ^ill [od 
ya hir, ao yn mr lawn, cyd y galur a orf jrjUacr. 

Colo CVmrac; (T Oreal, IM). 

Adyatwythiad, -an, am. a making pliant or 
supple again; a becoming pliant again. 

Adyatwytho, v. to become pliant, supple, or 
Dlastic a^ain ; to make or render pliant or flex- 
ible agsm. 

Adyatwythol, a. making or rendering pliant 
again ; tendmg to bo phant or supple again. 

Adyatyr, -on, rat. a second or secondary mean- 
ing; second intention ; reconsideration. 



jM.V^.(,K)t;ie 



ADrBrTBUH t 

AdjaiyriaA, -au, »m. reoonaideiAtioii; reflec- 

tion; a eeoond thought. 
A<^*t7ria«th, -an, (/. i«coiisiderotioii ; re- 

flectjon. 
AdjBtTTied, j v. to reconsider ; to think again ; 
Adyatyrio, | to reflect on. 



AdTstyriol, n. reconsdering; refleotJTe. 

Add-, px. [cf . It. adk, aidk'] a prepositiTe par- 
ticl« (governing the soft or mecUal scond of 
the mutable consoDonts) intensiffiug or en- 
hancing the sense of 'words. In the present 
language it hardly retains its vitality. 

AddaacEtb, AdamandBve; one of the popular 
names of the orchis (OrcAta maculata).—S. W. 

Addaig, im. Tiolence or force.— P. (ed. 1832). 



Bj^T ddTT. diE^ ir iOmlL-D. a» (Miym. «1L 11. 


LoBrOdmf du hrrn oddoU. 


-D,ab(}iMrm,<iiaS.1. 


iB?sfer- 


iren, 
GMnlrm ai S^rm, I'w Blue. 


Nid TV dfn DDd f el liim. nen ul 

I .*trit. nm lilariaiit.-JW™. /Vp..- 8«lm. «. 6. 


TcEl oiUaii, ■ pbob dinthr 1 


an py^mwd. *1«, « bwrirtfl. 



Yu gneod boid gostiu-i 



■^ unl luin mdtlufldl^ Bg- 



Usvai ■stlmai i>*i ^wjn-ddkll.— Jfjrv. Ardi. iiL 143. 

2. salad, eatable leaves. 

Dodwdi swin g*HI(ir mewa Olew adAuI DTnhn un yohydig 



atr'ffiKAa^BUHM.-l 



Bwniliwtti, *ef rliT*gvrdd ; nld uiuai n* akanlin « 
L diorfy AG tddaii ,- Bc o bnir eftrDvo^ ndam a uuuw 
iri.~rri/ Oan^ii ObcAoiuk ICmbr. Joan. S S. 11. f 8 



AddAin, a. [dain] fair, beautiful ; delicate ; en- 
gaging- 

AUabk fetdl »ddwjn (uchOK-— J"™" DruUcj/n- 

Addaint, nn. [add--Vgan, gannu, genni P] con- 
tente; what is contained in any thing or pdace. 
— Icio Oloiaary. 

Addair, eirian, vm. [gair] a maxiui or aphorism. 

Ldftlr Guvllion & Hor^ui 
hM ^wid ; ffiredi hjay 7 

^,, jT, Iduawdaj »-*--- ■--- 

r. rug Nghadalr UHlgrn I 

>. [tbe same as a/aTtc, of which it is 
only a Tftriant] 1. a fabnlous monster, similar 
to or identical with tbe Dragon of medieval 
romanoe. While both addanc and a/anc are 
always repreeented as terrible monstars, it is 
Temukable that either of them was ever sup- 
posed to denote a comparatiTcty small and 



baimleBS a."i»mt1 like the beaver or llMtl^dan. 
Davies's ezptonatiDn ('ccutor, fiber. Anglic^ 
a bever') may have helped to perpetuate the 
confusion among later writers. See J/anc, 
the more usual form. 



ur p&rth ar <wof , Bchynuyt y ta^ax yoj" ll»w BaBtu- 
ew yn 7 lift* dehtu. ao uai j daw y mywn. af^anuot 
iKf awnaoth ae wmn a gwuew trwydaw. allad ei b«iB. 

Peredur dec ooSa dy gret itodeist ti ymi pan lodea yttl 
y mam pan ledeiM yr oAuK.—itafiinoffion, i. 282. 
Addanc ni thTnir D anoddyn dwr; 
I Gaio naln Ittr i gam ni'm tyo.— i. O. CoOli, iv. X. 19. 
2. Addanc, like a/uJic, is sometimes employed aa 
a term of more or less reproach. 
Blioddaii fy mryd ar geiilair ; 
Hba dnuuif Uorpog rm Uav ; 
Qbowch i'r Gifting, rhyofaor y clod, 
AdilaiK C»er I ddwyn ootrod.— tfuio Qw Wmj/iI. 

1[ The jA. docs not appear actually to oocur ; 
but according to the analogy of a/ane, it may 
be eddeine, eddync, or addaitcod. 
% By some modem writers addanc has been 
used for the alligator, and afanc for tbe oroco- 
dile ; while others employ the latter to desig- 
nate the beaver. 

jUdaat, am. longing; earnest desire. 

Addar, a. [ir] arable ; fit or adapted for onlti- 
vation. 
T\T addar, arable land. 



Addaai a. [Ir. and Os. adhat ; L. aptu*] meet ; 
fit; suitable; proper; convenient; adapted. 
Addat i'lh achoeion, fit for thy necessities or 
circumstances. 
TmaeynyayortBygyairaawukyTanJKd gynt gan y 
kewry. ac yn an dyfleyth yv, « adai yth kenedyl ty. 

Smior. ai /pl*«r: M.A. fi. 108. 

Addat wyl i Ddcrwi Siii.t.—GTi>. Oioim, tX 
Bygwdt gan hyny ffrwyUian addat i edif enmh. 
.Jdd« i bawb el gydndd.— iMn». (K.A. Ui. I4e.l 

Addasair, eiriau, wn. on epithet. 

EpithWoili Apportion, gair dodi.iiou-liMitMir, a tyddnaa 
gymmercr gau cyfaddaa a^i ddodi mewu coda, wdtJuan 
Br Qsel cynghanedd, mlChiaa « Uknngi, « cyflawnl, uea 
addurnaw y godd : uteltliiao mill ar mwja pob ua. 

PunLiyfi-Otrdd.aa. 

Addaadeb, 1 -au, nn. fitness; suitableness; 
Addacder, j adaptednesa. 

A daa rywogaeth yaardd iddaa : prlodoldab nm addat- 
drr. u adduni.— Aiw lIh/t CnM. lis. 

Ac o addatdtr neo auaddaader lielD ac y petlun hyn y 
bydd cjrllftwntler mm anghyflawndcr.— Wjrr. <<rt*. iii. 110. 

AddaMdigaetb, -au, ■/. adaptation. 
Addasedigol, a. adaptive, adapting; befitting. 
Addaaiad, -an, »m. adaptation; a rendering fit 

or suitable. 
Addasiadol, a. adaptativo ; suitable ; befitting. 

OlrhaliilwTd y prU mthladan addailadol I doAddiadui'T 
laMi.— (Vrfuc* y SeMd, Rhagdd. 9. 

Addajwl, a. adaptive, adaptative ; befitting. 



Addabouiku 5 

AdduK>ldeb, 1 *ni. odaptiTeness ; adapted- 

Addaaolrw^dit, | noss. 

Addasrwrdd, »m. fitness; meetnces; suitable- 

nees ; adsptedaeis ; convenieuce ; propriety. 
Addasu, V. to fit, suit, or adapt; to adjust; to 

modify ; to qualify. 
PeofdatrD curelt eqkythredic o arwyd drcdc w adiutviit ay 

pta.-B'ul dr. „b Arllliir.- M.A. ii.!**. 

Addaawr, wyr, sm. an adaptor; a fit, proper, 

or suitable person. 
Addaw, V. [O.Ir. aithi, foenus: cf. L. adeo] to 

promise ; to engage ; to undertake. 

i. golTti Home Kyoon lub Klydna j Qayi hynn ■ adatct- 
tei Arthur uduut. minnea ■ rjtaatf yr ymmdofl da b. fieirid 
yminnMibeby Kd.-~ifaM<u>^, i. S(cr. »0; U.aiS). 

AMrvau jV hrn ddwymlth ; 

Addewid irft. addaa laitji : 

Taled taivb, Ml hyd y bo. 

Addnrld t, oMaao—Iola Uodi, I O. OlyndiR. 

Cha dyu * ttddtnno bob peth, bc ni rydd ddim. — Diareh, 

AMav Ug- ft wna Vol [nJ. jBtji. ffwl] yn llHwen. 

Et ft wnmeth yn ddioflryftwc aUov kilyaw y wrthftv. 

Addata duwioldtb [^:proffoeu duwioldeb), to 
profess godliness. 



S. Pftulm ^Dftj IwTftgcddymwlBromflwadfUftdjrweddDl, 
U«diwurvydd m chymni^amdebH nid i ^mut pletli- 

: .... eithrmem 

reiUindoedd 



IS.'S_ 

T gWBdilBj i irrftgBdd yn aJdo dnwioldi 
da,— Aotcn Llwyd ! iJwybr HySoidd. 

Addaw, -au. -on, >m. a promise; assurance. 

Ad e^redy dftTTot ydftW ef Irwy a fUi aOav^u bakoy 

Iwyllftw Seiied RuTcyn ef ft kavfte er hyn ft a!<chyB ndunt- 

Bml Or. ab Arthurs ll.A. ii. SOI (ot. 2»). 

O gftlUut "7 dy dwyllaw li velly . . . neu pytBynnyBit 
fitionftt *e hadatofu. gan ftdq obonat udont dy dwylUv. dy 
voflit fttii ^rtt ft ftDt y^kyfyr^oU. — Pitrdan I^drig, \ 9. 

Addam nwwr ft rfaodd fecluo.— /olo ,Vh. 306. 

Dyl8dftrh»wbeii*Wo.— ffn/'. ffiryjfjwjdj; U.A.l.Mt.- 

Omll nn hvde no dftn addaw. 

K-sl.rClrmfd: U.A.i. 171. 

Addawd, ) odau, tm. [dawd, dodi: cf. L. da- 
Addod, ) tuin] a repository; a place vhere 
thingsaroormay be deposited; adepoeitory; a 
storehouse ; that whicn is laid up ; a treasure. 
Wy addodt a nest-egg. on egfi^ left in the neat 
to prevent the hon from forsaking it, 
Molfttinbenodddiodgurini.— 7W>>nn; U.A. i, 13. 
Ardehi 
Ynn. 
Hil Mftel^im mUcant adedf. 

C^Kddelv! U.A. L a«8 (eT. SM, «BI). 
Yd UyHoet dshn yn Tiaeajt adodtu. 

Uy<^nl> ab UyvKlgn : M.A. I. SOS. 
Adod Uoc^yr 11uo«awc ftm pajin. 

Urf- "i UifKttin : U.A. L tSS. 



iihsbdi 



>lf<dd,d 



y/VVHl raloryn; M.A. L 51 



HaptinabThamiitiiiBiBion: lolo Hift. M (ot. 9M1. 
Ooniff Llew ftb Cynfarch fardd 
Orwyddawd ar blatnvd hwrdd, 
Yn addatpd llru a chof recAA.—loU, Mu. Kt. 
Odlftu, cyryddftii, cu addai^yd bEiiddlon. 
A gt-T yn helridioo ar Bnryn hyrddawd. 

/gum BTvigdd Hir: Omith, «. 
T bedyMim, «i Aaddnda'l hdddi. 

Drwi Wy<t: Bl, AH. St. 

Addavedigaethi-au.^. a promising; apromise. 

It propbwydi aoedynt yvkacnuotF'in a dyvcdaftant pan- 

1 A |p£ gKneiiraetli Crirt, yrhwnn a Badarn- 

' ' tcyn yr noUgawdyloed. 



hDOno ft dangiMgd gB 



nr hDOno ft dangu 
nel y adav^tdigitrif 



AviiEtov 

Addawsdi^l, a. promissorj'; promising- 
Addawiad, -au, on. a promising. 
Addawisdydd, -ion, »m. a promiser. 
Addairl, olion, »m. [awl, iawl, ioli : Br. aieui : 

by some equated with L. adolf] worship; 

adoration. 

A pbaa velaaant yr Inddema y rfaingyll yn dodi an- 
rhydedd ftc ndd^trl yn y mudd hyny I'd UATglvydd, hvy a 
vaAldaaant yag iivhlw Filal, ac a ddyvediunt yn giwi 
vnbftw ffti hyn.— i)<i>^ f^rJa.: Ef«n«. Nicod. i. 

Ar iftwn i Bor y r^riw-ftef, 

Ocgun tftWl I'w mUntcl ef.— /cuan The, i OrgftD. 

Ood maul yn ei liaddmul hi 

AgflrynfriRur^iiiJ!- /)ir> »>■; Bl. Arf. im, 

Breiuiftu ftc lul'lairl y Bryo Owyddim. 

tlKoOin- Jf«*oi>.- Onith, i. lot. 

Addawn, oniau. im. and i.d. [dawn] the pro- 
duce of the soil, of cattle, of trees, of labour, 
and the like ; fruit. See Addon. 



2. that which is givrai ; a gift ; grace. 

Addaum Daw Bydd i ddyn da.— 5i«i Ctnl. 
Owiw ym mhob gradd ^ addat!m.—Iolti Sue*, I Ddnv. 
Addawol, u. promising; hopeful. 

C/ioT ieuanc addawol, a promising young man. 
Add&wr, pi. addawyr, ) sia. one that promisee; 
Addawydd, -ion, f a promiser. 

Addaf, V. [def] to acknowledge; to own; to 
avow ; to confess ; to admit ; to grant (with 
see. and d&t. of the person, and absolutely). 

Haca>M'/dyiiniwaB.-My«irwt /r«i.' M.A. L IW. 
Nao y id'/ Dad airch tat diwi nac y diwftt ny dculhom L 

Pob pochawt ar ny» aJfe/nuI «.- t«n*ir, i a». 
Dad y tftfod hwnw ar nkm dyn yu cyaru, ac etfe a ^dd;// 
beth a wnaetb tnry sng.—MMdfgw M^dd/ai, iL 806. 
Yr %lwy» Lin Irwy'r hoU tyi ath n-Mr/ di. 

Lljlfr Oietddi Gpffralii, |Ta DvuniJ. 
Add/fT di yn ddltai.— On-ivy rh^ii), «fi (f1. S3|. 
Addef , -au, «/. a house ; a dwelling ; a home. 
—Haddt/. 

Oftji glain g-loy« addf/ yn nef drffrod. 
Ef ft umc net «:le/ Adaf. 



n (cf . 1S3). 



Tri nawdd ac amddiffyn ntadoldeb : nawdd bywyd a 
ohur]f;nftwddmaddiantftC4Md'/; anftwddbrBintflyiihenid. 

At Duw id^/ y nef ny lief Uvyprftwd 
Ynt cdrinaw lu-y no y diindawd. 

Emifn db CBr,)c**Ti.- M.A. i. SM. 
Saint yog nghAr yng nghfter add//. — Ivio Xtt. MS. 
ttowvh i hedd, a da'ch luubU/.- OnmHt 0>«w, OT. 
Sycunudftw addif rhag im^.—Diarth. <H.A. iiL 17S.; 

Addef, (?n. [dof^de, deheu] the soutb. 

Tri pbedmiulKnig: pedmrbanbydanuoiri dwynun, 
add-/, goffledd, a llywynydd.— flardda., i. SOS. 
Addelbird, 1 odau, mn. a ooufessian ; avowal ; 
Addefod, ) profession. 

Col Aal oed ddifal cadw odd'/oui.— Sr/ayn ; If .A. i. SOt. 

Pe al boftaai'T Fab Piua, yr un o'r ddfto, nft'r fftth on aa 

y maeete morddlrtftwr yn cfaTcnnycbu fa gy&it . . . ata 

a vTandami ac a tynaiai boli ein hadd<ftd aSi hatpbion. 

M-ir^i-gHi.: DUTyniad, f.R. 



Jm V_.(,K)t;iL" 



AddefedigMtb, -aa, «/. 

kuowledging; ACOidleBsion; acknowledgment. 

Addefedi^l, a. acknowledging; oonfwsing. 

AddeS&d, -all, am. a oonfessing, acknowledg- 
ing, avowing, or admit^g; a confession; 
aTOVal; acknowledgment. 

Adde&g, a. rdating to oonfeadon ; confessed. 

Bud ad^fic J Oriflt ^Ifldk dogyn Tolavt. 



Addefo^, a 



i: A.B. ii-im 
mfessed, acknowledged, avowed. 



At caliad lolo. ai fowl y ^yr fo 



Addefol, a. confessing, acknowledging, or 
avowing; confessed. 

Am 7 rniTremt dlodeffliiit l>av wf^Eniol. 

Or. oi Mtrrd,id: H.A. i. ««. 

Addefwr, wyr, ) *m. one who confesses or 
Addefydd, -ion, ) avows; aprofeosor, onothat 
profeeeea ; a confessor. 
UyAA. fel y g'welirch. y trlniwyd yn wasCadol ftthnwon 
tc addiflnfr J gma.—Morui Cgfi»: UUt. j. 3. 

fihaid l^r byd ddyvedyd ua dono. mai gm da ydyw, pan 
y drvMo beb rsg^un, u heb tnOihtl uj amsui i wBwdio 
cnndd, ac i ddwyn mnjoharch a&hA«ddiAiuu>l uuBJuri ar 
d kaUr/nvr hi.— /cr. Obp™, 106. 

Addel, o. [dd] fine, pretty, neat— 0. F. 

Adden [?], a word, so far as is known, which 
occtus only in the following stanza of ' Eng- 
lymonBedd8nMilwyr'(J.S.iL34; M.A.C): 
Oet ef K y fn y fn y hoti 

which has been thus translated : 



Here it is assumed that it is a variant of 
addien ; bnt others, making it a noun, and 
connecting it with denu, have rendered it 
' deceit or gain.' In modem form it may be 
T«ad either adden or aden, 

AddSwS; ! •i'iion../.by-tom.of.lAfc.i<I. 

IVwy ffydd yi oBcymadd Abnham Inac, pan hi braw 
■nw, at an mab a oOiymadd. yr bwn a dderbyniaiai yr 

•u irvirioiwdd Daw, er cadanibaa yt oHdrvjridion 



f. Salttbitrp: Bbuf. i>. S [d. 1 Cm. vii. 1). 
Add«wid, -ion, </. [addaw] a promise ; a pledge. 
OaD fayo, tft rhoddi I ni nddewtdton rtia^orfawr a ^verth- 
fB«r.— e>y. Marfan: i Fedr i. 4. 



il Generally eddewid in M.W. The form is 
rather maac. than fern., and in Uie Welsh 
Bible, Prayer Book, and contemporaiy litera- 
tim, it is generally treated as such (cf. Act, i. 
4 ; vii. 17 ; xxvi. 7 ; Heb. iv. 1 ; 1 loan ii. 25 ; 
and on the other band, Jfom. i. 96) ; but now 
it is almost always regarded as fem. 
Cbiwi a gtywwDh hefjrd ddarfod {"n Harglwydd lam Orint 
addaw ja m FfenCTl, tfaoiatiu yr holl Mthau byn - . . yr 
bwn odtCvU ete o'i ran ef s'l oddw yn wlr doiogel. . . 
Herwydd pa acbos, yn ol )t adduwid «ira a wnaeth Crilt, 
riiald 1*1 drn bychan yum befyd . ■ . addaw trwoeb diwi. 

LI. Oictidi Vsffrrdin (Beflydd]. 



A ydyoh ohwi yma . . . yn adnewyddo yr oddnrid panJbu, 
a'r adduned a wnaethpwyd yn eich enw obwi I 

a. GmMi Offrrdi' [Bsdydd £«ob). 

Canya felly 7 dywaid B. loan . - . mai kon yw'r atUaetd a 
addawodd Criit i sJ: sef bywyd tragj'wyddol. . . Ar> « 

ym n^b man yno ju cynny^ bywyd tramraTddol. fel jr 
ao ymarfer Ciiflt^no^afltb. — lot. Tonuv: fincb. Orlst. 10. 
Bendindle fyddo Duw am gyflawniad o'r addewid Am / 
Prur Wiaiamt : Oen. lii. 

Addawidiol, a. promising ; promissory. 

Tyriffii. Uwon baerlR. addKieiditd, anvbyfreitblbn. 

Sd. Sum^il: Hall Ddyleda. Syn, iv. 1. 
Addevydd, -ion, «m. [addaw] a promiser. 
Addftin, pi. addfeinion, a. [main] slender; 
delicate ; delicately slender. 



^Ifinwdcfl, gwraiM/nin hiroedd; !■ 






*>wh . . 

I oedd. a thtdt. — FfOtn Dartd, 1 1 
Osdd fwya llaia, addfaix ei lion.— enmiiw Owoin. ». 
Addfed, cp. addfeted, -ach, -af, a. [med, medi 
fcomp. B. npe witi reap) : Br, admet, axff; 
C. arvn; Ir. abaidh; Qa. ahaidh, abaich : cf. 
ae/ed} ripe ; mature. 

N dihytyl y eur yn arfed trawt Tclrt 
Dal frwylh coed Ilawn adiad. 

LtifToareh air Ll]/vet^Tt : H.A. i. S9S. 
Kam Bwr doelb ad/a oodd bwnw [Gwrlaii]. a mawr i 
gygboT.—Rrol Or. ai ArlAtir: M.A, ii, 381. 

A ouLRliBwc rwychnf a dewrbat a shlodf orhaf a doethat. 
u «dv!l ay oH.—Srvl Or. o» AriAur: U.A. ii, ISfi. 

Pfkn fyddo rbyw tv mewn ooArtu addjodarik {"v bcdyildia, 
hyapyDer byny mewn pryd i'r eiwob, 

LlM/rGMUddi G^ffTVUn (Bedydd). 
Ffnoythau addfed, ripe fruit. 
Owypal, deallai » diwyllydd 
Amaer addon, odd^Hfvn fwydydd, 

ZIncri Wn: Bl. Alf, IS, 

Addfadedd. i . 

AddfodrWTdd, *m. npeness: matureness, 

Addfedwoh, ) ™**'™^i mellowness. 

My BTWonyneu ^^^^^ j,^^^^_.^^ 
Addfedrwydd oedran, 1. maturity or ripeness 

Kaaya lagor oed ydaw o oducdrvE^ a doethynep rac pawb 
w kyCemdeythyon.- Ami Gr. ab Artkar: IC.A. ii. MS, 

2. puberty, ripeness of age. 

Owrai^ a d yn Uathmd iran wr yn fli hadd/tdrwjidd, a4 

Addfediad, -au. t i. ^ 

Addl&diant, } im. a npenwg; maturation. 

T adi/edlad 

A bair add/edinnt trwy gynnyddawl Awydd. 

Th. Uoyd Joivt: CeioloD Amm, 17S. 
Addfedol, a. ripening ; maturing, maturative ; 

Ferlysiau y maea, a^r beiidd ffrwythan addfedawl. 

T». Ltond lana : Cdnton AWBU, IM. 

Addfedn, i*. to ripen; to mature; to become 
ripe or mature. 
Bbald i'r dynged sdd/tdu, 

Wedi rhyw fjd bir a ta.—I>. iliojnJ ah U. a* Omffi/dd, 
Y grawnwin a oddfedaM, a phwr a'u aathr T 

1 Eld. iTl. m 

Addfeinio, V. 1« grow slender; to become slen- 
der and delicate. 
Addfeinna, a. slender ; delicate ; thin. 

*faliwi baen bren oddMinua 
Owaigadfod glodtawr boddbwr bi 



Utrdi 



,)glc 



AnDrwm i 

Addftryn, a. [mwynj 1. pintle; meek; mild; 
placid ; calm ; good-nstured ; fair ; pleasant. 

HTBAm TI>rVfU hTDot djfwyn - 

Gr.al. Xtnd^: M.A. L V». 

Tchydio mdr hrnnr TRkrlch B*y1 Bedjr ■ Fbki 

KaiMDd n»b Bi» rwM leuino -■' -.....• .«. 

wylliwu.— flr " ■ " 



n niinpua yg Kimf- 



IfloTwyn uUncyii a enlr Bf hjnt, — /j»(u, ni- 
QwTD 8U byd y ibal iitIi(AF|>K.— WaO. *■ S. 

2. fine, choice. 

rn dlwed r ytwydyn bomw y doetlunt cOmtUi yOmd- 

IjMwn, 1 (hyt M wynt Mnriair In - '-•'-■•-" 
bdwyr nil iun(rrl<il> whemil o b«d^ i 



dethoIedi^TVB ya- 



Addhvyndag, a. fair and gentle; fair and 

pleasant ; pleasantly or elegantly fair. 

Ae «rw»ill » y«l»adl adatnodtc moingsnt oe diudiaiD. 

St, C™J,(a(cf.M). 

IJjmM nirwfu ienanc (id'4H3ni.lfc yn dyuot mttant gui 

yDlyiyranm.— a. ^inal, It. 

Addftvynder, -an, 
Addfwyndra, 
Addftryndod, -au, 

Hon u user TEWlodaedumTTiDtrwrd- fcynutaJiwyil 
me adf^jff^er ae oitbeDrwyd. — MahiKogioit, i- iM. 
Diwnidd el tundy dor odd/icjiiHlrr. 



Adnwynhai or aJm-, 

Kennlijd B doty^ dydbimwt.— TWiui 
Hyd pu dsl Cyuui m 



ibMcrtdfM:ll.A.\. 



.B. ii. 1 



Addfwyng&r (h-r), a> gently or mildly dis- 
posed ; of a gcntie or meek dispodtiou. 

finyf &det otJicviiiMr [a^ KdmryrksKr]. 

Cjnd<Mw.' M.A.i.HS. 
Addfwynliau, i-. to make gentle or mild. 
Addftvynh&d, fm. a making OT rendering gentle, 
mild, or placid ; solace. 

Ea Uawn o guiiid cnnnwnnnt. nod 
Bu cydfai, ibtA/ir^'^MAd «u pech, asm blin 
O nwytoi chware imynt Cnclul cwta. 

W. O. A»»«.- CO. Ix. lOlB. 

Addiad, -an, »m. longing, earnest wish. 

IVi ^yo ftr derfyn dw 

TrwT aMiai dr*w 1 Biddlg.— r. Prat, 
Addiai, eion, sm. a stranger, an alien. — P. 
Addiain, a.=Addita. 

Ar toUuit nir ar Tilytwd grdl 

Af TBirl i Voir ax vawr niirieir 

At von iKfi«>.- rM <•» Knvl/Jd.- U.A. I. MS. 
Addiant, em. oaroest longing ; a wish or doaire. 



Addiant, »m. fruit, fruitage y 
£t dy^vnt pTQiiaQ bywyd yu j Ncf 
Amrwrsowl luUianI, ac y rhoddant irfdd 
Enncichd»r.— W. 0. A^4«: CO. t. M8. 

Thoogt In H«ran the tree* 
Ot lite ambnniil /miUgi bfai, ud *liw( 
Yield necUr.— flinnlrK /*«, T. US. 

^ jjifffmnf may be a misprint for addon ; for 
otherwise it is not known to signify fruit, as 
endently it does here ; and in the glossary ot 
' Oeiriau Cyfystyr ' at the end, it is exjJained 
by 'hiraeth,' which gives it the same signifi- 
cation as in the extract from Oronwy Owain, 



AddibyiL, -iaid, tm. a dependent. 

Addi«ii,a. [dienjfiwltlasB; fair; fine; pleasant. 

Ut adjf9it hymn Hywel neod sdiiBa. 

LIfic. at Lifitif ■■ ILA. L 3M (ef. OB). 
Am^-OBwd Ddit y dewio adMii. 

Cyfyd yt'bkirddrrd, radUm har.—D. at Otillim,yi.1M. 
Ooedfran bUnitaim daim ^■^»*<. 
OMOtt^ idSin, gvyidd IluB Uwyni.— /lb Mat. 141. 
n^uw't addita dlirw m udj gl ra AwTDledL?. 

Sojiitl Ddu, US. 
Cni^MO, mynyddui addim, 
£a ooflair KTm. oat k rwto. 

Oa>atUtr VkAhh .' ChnHl^ 9*. 

Addig, a. [dig] angry; inflamed; jealona. 
Tr otddimt yn bur addig wrtko, I was very 
angry with him. — Dyfed. 

A'l ind oedd fmlkd addif 

Eflv^Ui gael ti nls o'th n. 

&. ;).ai7na>: lalo Uh. SOB. 

Rlwld TV i*r etVAdnriiiid tnjiUn byn ymdrmffertliti ax ym- 
ffwduiii drwy'r flTrddyii, haf it ^uaJ. ar rew ao eira. ar 
(nrdaniaeUi «c oerfel, i gwlu roe nghyd en fyllid I'll 
bardretlii, «r mwyn nUu taJu iSr meinR' tir ofid^ jn a 
ddydd.^stirt l/i^: Uwybr Hyfl. 908. 

Addigor, tm. a jealous one ; an angry peraon. 
Addio, V. to make an effort after. — P. 
Addion, -au. im, [cf. adon,adiim\ a lord, master, 

or chieftain. 
Addloew, a. It is doubtful whether the word 

adl<n/u> in the Gododin (817) should be rettd 



^ddw^ , _ , 

Dair.— JTiiix^Aev <>ii«ilml, (. X 
Addnaid, eidian, eidion, t/. a refuge or aaylom. 
AddlMf, i.^Adneu/ 

Addarf meet a r«"i<h a giAUb a dytndd. 

Myn. Artk. L 031. 

Addo, V. and ».=Addaw. 
Addod, -an, tm.^Addawd. 

Addoed, -an, *>». [oed] 1. an appointed or set 
time; appointment, assignation; a period. 

A g-lyweut tl diindl Owaith 7oed, 

Lie ni cbanu bir addartL—Iala Ma, SM. 

Addoed sa.fr, the time that the goat takes the 
male ; the rutting seaaon. 

2. delay; reoessorsuspensiou; abeyance. 

Uaecyd llwH nann odA^d. 

Soft. Sirt Xya^dd (U^. L Stl.). 

Dan addoed, in abeyance. 

Ac old oea nil trwy yr hoU iyfriang i y m ufodyewyddo^ 
aMhao hyn i beidio, neu 1** vaiw da,, ad4etd, 

AlhmmuA fr EglKft, 389 (of. SST). 

3. destiny, hap, chance ; death. 

MortraBa*«A-'l.— TaJiam.- A.B. iHM (cf.aH). 
Ovae verin Addaf nddotd mab araOadd. 

Shan't BrttKnk : HJ^ I. tS9. 
Diesel -wnBixa hooaw yntoi Tyaneu yn Twy no neb pan 
ddyektt y aditt abiin a'm bachain inneu. 

DoMioa Rhajaia, |W (cf, 17), 

I^H wSlicaa, lu. Is! T, 

Addoediff.todefer, to delay; to put off; topro- 

oraatinat« ; to prorogue ; to put in abeyanoft. 

Ac yny guton ^weti a dodaf 
Am dodca Dwyi ym adatdi. 

Kiatim "* UmricJkrani.- M.A. i. US. 



wV_.(,K»t;ie 



CjaiaaBt. FsdI both tzaflerth i brofl ei bod yapc 
i gntrdd Abnbaio, ei bod irsdi « koiUMdi dan r I>< 
■n bidiiinrrdda dan yi Efengyl. 



onadd.— Auvnwn JTim, L U 



Addoedi&d, -&a, »m. a deferring, delaying, or 
proroguing ; prorogation ; prolongatjou ; a 
leepiting. 
Addoediad y tentdd, prorogation of parliament. 

Addoediog, a. delaying, deferring; fall of 

Addoedwr, wyr, #m. one who delays, defers, or 

prolongs; aproorastiuBtor; a postponer, 
Addoer, a. [per] cool, chilly; cold ; frigid ; raw. 



bi JH rjir.—Xabvioffiont L e* 
a« B wnasth llewrcb o'r nrllewin 
Haol ■ lloer addotr &ddef terin. 

Da/^ Biiifra:- U.A.i. 
GircDllaer Vftivrtb adoer adwrr mAa-fd. 

Isrwrtk F^cJta-: M.A. i. 



Addt>er«dim«th, -au, >/. refrigeration; the 
act of chilling or cooling; the state of being 

Addoeredigol, a. refrigerative, cooling. 
Addoeri, v. to coel, to refrigerate. 
Addoariad, -an, tm. a cooling or reMgnating; 

refrigention. 
Addoeriannol, a. refrigeratory, cooling. 
Addoaiia&t, tm. refrigerati<ai ; chilliness, oool- 



Addoldy, dai, *m. a house or place of worship ; 



Tr oedd uiirtw o volnJdHim Cjnarig jnjTJw 
ji hwyr, wedi dycliwslyd o Sonynt o'r mUoMit. 



Addoledi^eth, -au, i/. adoration; the act of 

worshipping. 
Addolaa, -an, ^. a fenkale worshipper. 

Tonl kdetladwyd Iddl u y Bryn 

Tmag^tj^itu gAU j rvreiccar derm, yr hwn 

It nuwrcj tii, nn aa oMcltt deg 

A bodid 1 ■ddoUdeJvma Sol.— £<ef iialmM, Til. «a. 

AddoUR, -oedd, fgydd, t/. a place of wonihip; 
a sanotoary. 

Uspoiaald Bdm, imibUii, 
J&la(A> •UBTIniad.—yica^a-: BI. %L 111. 

Addolgar, o. given, disposed, devoted, or in- 
clined to worship; worshipping; devout, de- 
TotionaL 

Mam TD VMtad r g-mai tt Sglwjt GatboUg, am 
■^TBdd oatrngedig as mUalfar. 

Ed. Smuel! Aogb. Hjn. Orm. US. 
ICa< ftjiiiai ja grffnUu in gnadnriiid oiidBldcD-. 

/of. BarrU: SmMh. IM. 
Addolgarwch., am. a devoat disposition or in- 
clination ; a devont frame or tnm of mind ; 
devontoess. 



ASDOLtAIML 

Addolbau, v.=Add6li. 

Ot ! ai oea nn td byw, a wavdta «i 
Ddlniwed atddl tfaj ftnni i aJJeOa^ 
Bbrddoetbidaliiilairt— IC O. Paglui ViLK. 

Ai edyn r^man SiKWdd, 
Qao fan eitedw peri TrbollM 
Dt <>Mo'*«i.-'I% zJayd /<>»>.- Oelnlaa Awtn, ITS. 

Addoli, v. [addawlj to worship ; to adore ; to 
do 



Gvtdy yd ailotKff nd yr Argli 



«dy yd adalvff y 
T gyndryflboldn 



liird. dunu y 
a GoEvtlaobTL 



ywgcnsTf 



S iKUofaiU nl ohMant ar belrdd llnlan. 

MadBt at OmOUr: ILA. I. MS. 
Daimfh, oMotm a lyrtbiwn rhao bran Daw. 

Bufydd Cdk BiraMnf: M.A. 1. MO. 
[Qlmlhnll rydd I>ow a*i aMaU.—Kfw. AnA. i. 181. 



Nlad 






d ITrt 



a'i it. 



gwirimedd.— /KM It. H. 
Nysl a hrddwd yn canlyn y PeifleltUar, an yn oi 

mwyaf Ail<MaiiKg.—lM. tbaiu: Boeb. OiM. SI. 

Addoli i (^:to worship te or before), oi 

in U.W., and occasionally later, but now ob- 
solete, may be am imitation of the Chreek and 
Latin use of tjie dative. 

Ao Bitwng BQ pauun ttmgmut wynlen. ao mMi Umr af. 



"li 



Or. a 



Tllmt Ii 



D WBlai y Ut 
.—B<idiMtlair,\ai 

aaddDWi UdiiD ef, «riiH gwsli 

^lelw minub Hair ydd i-ddotaf. 
ffr. <ii» 



' (BryUuok, Ui. MS). 



nd eymaint df anrbrdedb dl y gann bi 
Ibaepb J gann yr Alpbt. j gvr a uiJ^iutanl 
pai bnr ni.—L<ia£ir, | i^. 



Addoliad, -au, nn. worship; adoration; de- 
votion ; a worshipping. 

Myned i'r addoliad, to ^ to a plaoe of worship ; 
to attend divine semoe, 

Addotiad glin a gwtfvt, the devotion of lip and 
knee; lip-worship, lip-devotion. — C.8. 

Addoliad angglitrn, the worshipping of angels, 
angd-worsiup.— CW. ii. 18. 

Addcliad delimtu, image or idol worship, idola- 
try. 

Addoliad cythrtuliaid, demon-worahip. 

Yd yr Tagrrtbynn Un gelwir eiliuuddoliaeCJi ireithimi 
yn aMaUnd cfl^niMiiid.~6icgddoaiadi,r 0»im>, i. 92. 

Addoliad, iaid, tm. a worHhipper. 

Oddiwribyt.— IT. O.Pufhn CO. tU. nS(cf. ii. SB}). 

Tp addoliad, a house or plaoe of worship, 

A batogi llMtri Dad 

EiaaaTtdtaidtliad.—/. O. Otiritmtii: QtHt.n. 

Addoliadea, -au, «/. a female worshipper. 



AddaiiaiUiHi tag ei gajim er 

Hot ftaiift, rhag delwaa hagnm t g^rantdU. 

W. O.Pxflit: C.d. LH 



Yd maffD ynddynt yavyd addttticJol, 
Ao ya en (ywya i rodwydd tbiniredaaL 



Jm V_,(,K)t;iL" 



A dd^lu arist, I ddelw grin t 



Addoliaeth, -an, >/. worabip; adonttion. 

HwT m ffipiftfluit niutlk Tir lutifytiA^tk Daw. 

Moral ClJhi : DUt. v. IP (cf. ri. IV). 
A b*Tt^ii tieb ddjm ya m irw»uiii«th cjrffndin •« oedd 
liUuedijr i'w ^w&hadd hwv I'w AatUo/io'lA. 

If. i>iD'i ; l>wr Dkit^ IN. 

Addoliannot, a. pertaining to worship or de- 
votion. 
AddoU&ut, (fi). worship ; adoration; devotion. 

irddeulin, 

Tm hikm y dodit addoiinnt t'r I<m T 

Ci/V^ ^V;*"' . Efeng. Nic. 1. 
Fe a ddylai fod rfafv imgoriiLeth hynod rhimg yr addoi- 
ianl hvaw BC wAlrWfanf y Ganichaf iMuir. 

Sd. Samul: Otottu. It. 1. 
Tn / Ilenedd j bu dnwioldeb u oAMiani dwyfal nnnith 
JDCyfuuwddu. — JereM OiefH, 1)5. 

Addolui, a. worshipping; religious. 

Y rhki. hi y orybwyllwyd am t Fernaid, yljnt brd 
beddyw |m talu panta tddalm I'r ^leoad hwnw. 

Jtolan finAirU .• Daear.UT. 
Addolwr, wyr, ) »m. a worshipper; an adorer. 
Addolfdd, -ion, ) — /fefr. ix. 9. 

DwK aUaii wiBRoedd i hoU oiMiilwiir Baal. 

lfim>.x.K(ct. 18,21, 33). 
af ddefoydd, ao y^ 

Dnw gwyn i le da Tm 

.il(UoZu>r deltoau, a worshipper of images or 
idols, an idolater. 

Ac ar y Gregori kwny nut'i hoU oddolirjfr df^wan y dydd 
heddfw yn gvuod lail ea baniddiflyDfa. 

jtfw. /aiui.' Horn. il. N. 
Addolyddea, -an, a/, a female wonhipper. 
Drwy aaJIa«l hudo m gti\vo, cr yn CiLirT, 
Gaa ddelir-wUo'M^t^aa t«e o bryd. 

/. ». jymirf.- Coll Owynta, i. 138. 

Addon, »,cl. [^vddawn, q.v.] fruit; offspring, 
progeny, issna. 

Kitksiaiie«<i[*rTitbeniit yA'Uan.— Vjirddui: A.6. 10. 
A'r luQ a blanodd o bmuD bloenavl . . . 



A glywatat ti ehwetU y 



/Vm H-yn; 1 



. Aif. U {Id. W). 



Yd ymbortb ar <iddc~ rbog )-/a<o «••. XSI. 
Ac addofi y ddaiar h Hdit Dor biwddgaT. 

i>ar^ o-r Sim. 

ddlyiiS^.-^™»M^«SS^M.A. ^^1. "^ 

Addonwy, -on, tm. progeny; issue. — P. 

% Bo entered and explained in the dititionarios 
since 1793 ; but in the only passages in which 
I am able to find the word, it appears to be a 

Da y doeth adonKa atw«D [ai'. at wmj. 

Jwurin: Ondodfo. (06 (A.B. U. J8). 
Da dyrot adfnwg adovcf am wlHuaut. 

OorcAan JfoeU-rw.- A.B. IL W. 

Addon, »m.=Adon, Adwn. 

Addor, a. relating to a door or entrance ; door-. 

PorUior addar fn iddynt ; 

PorUieH y tair ^onnea gjni.—S^ Omffj/dd Fg<^ii. 
AddoB, a. [doa] dropping; dripping. 

Oer oeddmi I'm «a addm, 

O'cba'm ffer. ynnyfndeiaoil— /hoi Llicgd. 

Addoa, -au, *m. [dos] a drop. 

Amlodddf am ttrndloawedd 

{Dygaf ooh) a'm dw^ i fedd.— fif^uy M« nh Todurf 



Addniddio, v. [O.Ir. admd; Mod. Ir. and 
Gael, adkradh ; L. adoratio) to adore or wor- 
ship; to reverence.— ffrf, Lhwyd: Arch. Brit 
233. 
Na mm pnl^Uiir n* obfriawr 
Ny byd nac odrr^dg^tB yr allawr 
Yny dygwydho net ar tawr. 

Cgf-riilttTddi.y A.B. a. !SI (<4. H.A. i. SS1|. 

Addn, V. [cf. aetk, oiAu] to go. A rare form, ex- 
cept in the 3rd pers. sing. perf. In some of 

the finite tenses the initim is changed into t : 
but fddu and (litlain also occur in the infinitive. 
Addioyf, I am gone. AMaijd, thou art gone. 
Eddyw, he is gone. Cf. Pughe, s.v. 

BrDdTT a'm bivyad ; 

O OD i nn flMyoI oil.— /^yimrcA H-. 

MMr ai Onmlrkmai: H.A. 1. 3X1. 
H«nt rddwi/ yn o*r dyddyn.— i). Jlrx/ntii U.A. i. Sit. 
Nyd etiic heb da dyn y urtbau. 

Li^aiui Om-: K.A L 840. 

Nyd ifAv^draUvrdnHdyvynKor 

Nyd adwfd hebof beb «f beb vw 

Nyd'd>~'b(>biidrsclodiaffor.--C»<iAMK.- H-A. i. M6. 

fiiUfiU feirdd, ft pan addvird, 

Heb auT aeinh, beb teirch, beb fwyd.— P. 



Bod wrth addug tin, to be at one's beck or com- 
mand ; to be ready to do what another person 
orders.— S. W. 

I.laum addug, full of intention. 

AdJti yr bydd i'r maaa iB±irT.—Diard>. (U.A. iiL 14S. ) 

Addul, a. [ul] moist, damp, humid. — Mo Oloi~ 

tary. 
Addnll, -iau, im. [dull] a rhetorical figure, a 

kind of inversion. 

AddnU y gf Iwir rbyw ai iailh ac ymadrodd amna naV 
eyflawn liesefin; meyya. '™dani o ddyn," yn lie 'dyn 
cadan;' 'gwir a geidw oi wynch,' yn lie "gwr a ddyn^ 
wir yta mhob p«th h fptidw a iryn«b, ' neu ' ddyn gvirioD- 

yniadrodd,aUymAddang<]ayTenvo<iaf obonynt : 'ifiyfedd 
fllwi oedd Arthur ■—■ milwr rhyfedd oadd Arthnr.' 

Jfn ai^ Ym^rBdd. 

Addun, a. [un] simple; uncomponnded ; uni- 
form; one. — loto Oloiaary. 
Adduned, -an, »/. 1. a vow; an engagement. 

Ef« a ddaeth i'r yuyi bon yn amwr Oadial ab IMn 1 
ercbj cymfaartb yr ynvq bon dan addunnl na rhciHuu o bob 
prif-giin lumyii y rbif a ddetai guiUuv <ddl. 

Triordd: MA. U. SS. 

CadalrTallnln.. . BelwidCadairFedvdd,am naamJUd 
braiDt aUuvv ynddi und a fyddai dan fedrad ao addurted 
y ffydd yng Nghrin. - Cn/rinack y BrinU, Rbagdd. 10. 

Talaf t ti fy adda«,Jii,.—Salm. Izri. lA 

2. a wish, desire ; a request. 

^iMu>M(barwThirnaa.— Z»ar<^(H.A. ill. 146.) 



Yna y bu y ^vynfydediff Collen wytb mlynedd a d 
mie yD dywu, ae yo ynwre^ddu yn addunedaiBt a tfara 
lyobirydaiii.— A>e*«iil OUlni (T Oreal, SST). 

Addunedu, v. to vow ; to make vows ; to j 
mise solemnly ; to engage. 

Isadn wedi ^vybod byny a addumfdvMi 1 Einion d fe 
ya^aiodwai^.—Bna Aba^rfvrm: U.A. U. N4. 

Pan mMuMla^ addnnsd 1 Ddnw, nao oeda ei tbiln 
y peth a adduiudaUi, tiL OweH i ti fod beb addimtdi, i 



Addvtnedwr, wyr, 
Addimedydd, -ion, 

priou yr c^ariaA ^.—Lt 

Adduniad, -aa, tm. 

requesting ; a vow. 



im. one who makee i 

In lUw yr «U»Mrfjdd, Mir y 
L vowing; a wishing o 



ADDnHNWAlTH 

Addumgau, genoedd (n-g), am. a mou 

(in architecttire). 
Addnmbau, v.^Addumo, AddamocHu. 



Addnno, V. to vow; to wish; to implore. 
Adduno addunrd, to vow a vow; to make a 
vow; to vow.— Oen. xxviii. 28; xxii. 13. 
Dj okl oddajui d ddvyn, 
Dy rodd. y ywr dewT «oaw7n. 

^[jm Om<ii.' O.B.C. ill. 

Cofl&yr ■ddoned ■ wMaiuul y dydd y dseOHHt i'r rRDla- 

taeth.— 1 £■!. IT. 13 (or. 4S). 

Hicy B addammit oo ■ mMunuai dri pheOi yn fy cinr. 

«Kfr OKWWf ayffrrdn (Oteoinn). 

Addnitol, a. votive; vowing; wiBhing. 

Jddunolo/rynuiu, votive offerings. — I£tii. ii. 7. 

Adduml roddion, votive gifts.— 1 E*d. ii, 9. 
Addouwr, wyr, «m. a vower. 
Addnm, -au, »m, [L. oi^omoj 1. an ornament; 



Vw goleuaw yn 
ECo (uMxrnMiTf y ^ruiUd 
Ou Aer bwtli. ■ ffyddliwn Guild. 

lofo Trieknig .- Budd, lij. 3. 

AdduTniad, -an, tni. an adorning ; adornment ; 
deooration ; ornamentation. 

mbel- 



n embellidimeut 

K diymttot o wfim mnloed 

im aoed gui pavb o hynny. 



T (B) : U.A. a. an. 



Otdarn oed [Itlid1 sOwc. uhnedic b hsel, a 
TCKBni dK.— £m f 7V<°*«f>«. t3£. 

Miuhm a^iglen bot nn. psi (u nelut ti mo yo ttfiirw 
InihiiBirl. y gorUjwJwa dy boU focsBCb di- 

Cnmpaa Vhnrlrmatn, \ I 



Yn y dydd bwnw y tyn yr Ai^lwydd ymiiith ad 
■ ■ ■ " ""■ ■ ■ EmM. le 



2. a figure or ornament of speech ; a trope. 

Onatiu. ^^d^htn. m'i rywo^avtbjLn. ^ddan uvth a fydd 
Air EDor yHOuLi a houaw cf huo, mal lud rh&ld ynyswydd 
^yiTzTdinach am danaw.—JVnt t^j*/r <7frddi0rMfU, lao. 

Nid wyf wedi mawrniuiTfer A throellau u a44arvit, mm 
nad yr cyfTirdiiuald (>inni yn bu deoJl. 

lolo kargniiicg : aalman, Rlug. IB. 

3. a diagram showing the aspects or houses (in 
aatrologj] ; a figure or horoscope. 

Tr •uUvrn oddi tanodd yrnddonini dull y ffnrfafea, u 
■mrrw leofldd y planedau yr aoiHr Byny- 

Tnu 7 ^adswir i'r ayiredyddiryT roddl m bamedigaflth 



1,6). 

Addnniaidd, a. ornamental ; decorative ; orna- 
mented. 

Ooaodwyd birynt allaa m«*n dull daritiniadal ac oiMiin- 
aUd.—CMklv""'^ ii- 11<- 

Addnmaird, odau, 
embellishment. 
T BMe J ddoll hon yn > 



, ornament, oraatore. 



raalTT 1 iriMtliiwb. 
^tW; ^1. Ftr. xxTii. S. 

Addumeg, -an, tf. ornament of speech ; flguia- 
live or tropical language; syntaxis omata; 
rhetorical langnage ; elocution. 

•iddarKf yw tevnad nao wiiB-addiini aneth, nua ( Uy*. 
ian anuith ac aniliw, i gynhyrfii ac ymchwelyd meddyliau 
a Dvydau y jrwrnndavyr. — Haa dan fnkh i oddnnu^ ,- y 
najll yw boell ymadrawdd, nen drofe^, aralj yw dnilwedd 
ymadiswdd, nen ffngr.— Tn»U ymadntrdd. nen dnt«r< 7* 






1. Pmi: t^. ttt. t (ef. i»fU., 1 



M«mV» hi t rhn lenriE 
—HfriPrrA: %1. Ffr. I 



AjtJiur yna anchu 

Addnraiadaeth, -au, «/. 
ment, adornment. 
£a oyflwT angholotdBdii^ in 
nrfforaiH. bt y nalU law ; aF i 



ei vynet y odrycb ^witb y gadelr 



wnpethsu « 
ryUavaiall, F 



gwareidd- 
• Han. Cfin. S*T. 
Addumiaeth, -an, »f. ornamentation, decora- 
tion, adornment. 
Addumiant, iannau, am. adornment, decora- 

A ffWadui Inn ar ri vorff yn a^itrnuanl anrydediu. 

ProrlHydoIucM 9iMi iMi?at, 1 14. 
Ni fuaald yn myned i gymmalnt o draff«rth yn y p>T>- 
aheatjoa pHUtynoI i Ourfiad Be adduraiaai y beddrodau. 

OtmAnanam:.- Han. Cym. ST. 
Addiimnod, -au, »/-m. grace-note (in music). 
De&iyddlr dan a uManmoiau yn RyflTBdin. 

J.Huit! Oram. Ceidd. T. 

Addumo, v. to adorn, decorate, deck, embel- 
lish, or ornament ; to be an ornament to. 

Trirtiyvyinadmrddyaydd: ymadnirdd parilalth : oyf- 

iawn; acoJ'lxnwl^.— ifyv. JnJl. iU. IM. 

l>air . . . afl kyflanmwd o anhyby^edlc byder. ac ae 
toddnnuinf a Ivvdar a maly*nrwyd. 

£nU y IVtfff OfioK, IM. 
T ma« y ddull ynw yn (rm>uiaMlia jBwydan, yn boddhao 
y gluflt, ac yn aadttmatu yr an4<ii. 

Huri ftrri; %1. Ftr. miU. 



Addumocftu, V. 

TeOtgdawt Lnndain 



adorn, embellish, or oma- 



F ddtdlwedd addamog, the decorated style (in 
architecture). 

TcAr a bertbyn i'r dduUwedd a ehrir Seiaonir oMwrKng. 
... Y rmH tfr ooea a berthynant i ddaU*edd ndiUrtee 
adeilyddiaetti.— autjiiMoiriiTiIiir Cgiiirrig, i. SB, SD, 

Y mas pob adian o bono yn dechron t Uythyren hwr 
adduTine.—Liyfriiidiaalk c Cimrn, lei. 

Addumol, a. ornamental, decorative, adorning. 

Tn ffyntal. gohannd rhmw y naill be(b a*r Hall ; yn 
OHBt. yniadnwdd StmOi, uUiinuiDl. 

i/. Firri: t>s\. Vtt. Asa. 4. 

Addunoldeb,«in. the state of beingomamental. 
Addumwfdtli, weithjau, (m. ornamented worit ; 

decorative or ornamental work. 

Y mae yr mfiliiniuiril* iwed yn harddvynh ddlgySdyb. 



,)glc 



Addumwe, -oedd, i/. omameiital web or tex- 
ture; lace. 

.rfiMKniiH mir, gold lug. JiMmnH truii. dnr bos. 



Yt bm oedd rn ^iriago wUannFuf aur u akih diUad 
shwl.— 9 Sam. I. 14. 
Hi jna dodn aJduntvvsifdd brith, 
I «fTn *t1w t rhodiwDl rilh. 

7-1. Llo^ ^DW.* Con. Amo, loa. 

Addumwr, wtt, nn. a deoonttor or adomer; 

a beautifier. 
Addumwych, a. 'beautifallf adorned, oma- 

meated, or embeUished. 

Chwr^^iiri J boCch, ni fwrivch amhyw fftf. 

QaJi DA roed bmynt reiol tlm «a ncdd, 
Mewn eg[«Ti Ivjagor, l]« m»« olodmwr nJ 

Td prudd tklutuir mewn addmrmriick f edd. 

7*. j:J<i>i /»« .' Ceiniou Awan, ITS. 

Addwg, *m. a taking away ; sbUtion. 
Addwng, a, near, nigh, contiguoiu. 

Aidnnit, ngtrn, ga Uiw.— fforri Hir. 
Addwyd, -au, -on, #m, 1, an impoatlmme-^P. 
2. Condition; diaposition. (»p».) 

AwdoMl pwT ^vell u tso ne ; tIhh 

IV pora l»"'jt rwg djD mc urnwyt 

PwT ?weU r adtoyi Ha leujUH He llirrt. 

TaOeiiM.- A.B.11. Itf. 



Oininav snath U] 
Br un ndn med a ffwLn 



TWiolii.- A.B. IW. 
Addwymp, a. [gwymp] fair, fine, elegant, 
beauteous, (qm.) 

Bmnfrmith . . . 

Tn caub. 'n dlddum drn, 

lalth a^ujm;:, rn (d thyddya.— 0. ol fiwiliwi, ooU. W. 

Addwyn, a. (|dwyn, o.] honert ; Tirtuona; good; 
blessed ; dvilued ; becoming ; respe<Dtable ; 
honourable. C»p».) 

Owr addvn/ii, an bonest or moral man; one 
that ia under no legal impediment. 
Addwyn yui t /renin, it is meet or fit for a 
king ; it becomes a king, 
Qwitgo diliad adduiyn, to wear decent or be- 
coming oloUies. 
Cenedl addvfyn, a civilized nation. 

Onedl aMwn oaddTnt j CrraiT, u iitMwja • SHaon. 

LliiwHr Vj. 

Ac wedi tj«fnu flrrnlth & veddal tr wUd a ofaeoadl j 

CrmiTt hflrwrdd a dlid gan fan aUmwoD a doetUcm, ber- 

vydd BTD^FnlDn j fTjdd viut Kp^briat a doapartbau gvlad a 

ubBaedl oddwiM. afa a daodea ar Flauywrjd . . . m rtiol az 

ddn a gwju—ttlii Ifm. B7. 

lU T maent ar got a gwybod gwlad a diOMdl nMwn. 



badydd.— BanUu, LlOO. 

£un addwyn, a virtuous maid. 

Altai baiddm-wTii rtus bnn sAlKn- 

JHfi 9wl a) JuiwH; lolo Un. 34S. 
T ddjD a viag addwyn irta I — iJ. aA fTvil^H, coltH. L 
Hid oca llya ai gsidind o bydd addtim. 

CtfraOiiam Cymn, II. 1S9. 
Tair Ooaftctrdd ..fiUvvm Ynri PTr<l*'n. . . Ae achan 
bjmr a'u gdwld bwj y lair Ggagwdd AtUttrn- 



yoddala i *inryd yn od 



m fwyn. — loiv Mortfmwg, 



Addwyn, -an, -ion, im. Tirtoe; honea^; 
beauty ; grace. 
Hoftair na tbyUai boityn 
DdawD al Dduw'D addKr^ i UyD.— Omwy 0<mabi, n. 

Addwyn, m. \ a. [gwyn, /. gweu] white; 
Addwen, /. j fair. (rU.) 



I.- a.B-C. m, 



Ofer oadd, ar rOriuMKn, 

Fan ddaetb atad i'tb ndair. 
Uw'r benhno, tj odAm FUr. 



Addwyn, v. [dwyn, v.] to take, bear, or canj 
away; to bear; tocarry; to bring, (rtt.) 



Gaeuafuy afHira, 

a ^vnaeUi yi. ^^^ 
tn Afhf Dygynnali 



diJS Cf/iOiat: U.A. i. MB. 
OwT aa ^wnaeUi yo dyn ya delir boeDedig 



Addwynder, -i 
esy ; gentian 
Arch. iii. 279— ioi. 
Addioynder Morganuig, the oourtasyof Glamor- 

■ (< lyi yn ail 1 Lya Artbnr, aatd 



Prydaln ab Aedd Ma wr a wuacth wladoliafllb a Uiejmcdil 
■yntaf ar Tnya Prydaio, a chyn do byny aid oedd o iavn 
namynanialidoad.loro'''.— ni«dd: H.A. iL OT. 
Addwyndod, -au, tm. probity ; honesty ; gen- 
tleness 1 oourteay ; a blossi 

Myned bed baibnryd oi 
O laaa Cyaddelaa gbjd a^ 
By gadet ttuf ain xeg attc 



blossing- 



I.- A.B.1L1TT. 



MMir: H.A. L in (of. OS). 
Addwyndra, tTn.=:A.ddwyr>der. 



Addwynbau, v, to dyilite ; to polish, 

Trl ohyflwydd bardd a barddoniaeth : addiegnkau m 
rnrinair rwnadl ; syf annaddn nrlad : a nallln nybod- 
m.—Ba7Mai, ii. lii. 

Addwyno, v. to bless; to felidtate. 
Addwyuyw, -ian. tm. a good sort; uoblo, 
generous, or gentle kind. 

Oralcb or oilKiFiirvKT llew Uyw lie bei. 

ifillya- M-A. L US. 

Addwvnwaleh, veilcb, »m. a gentle or uoblo 

A (^kaia addvirt-KnUJi a diynnoddfao hdrdd. 

Addwyr, a. [gwyr] oblique, inclining. 
Grenlloer Vawrth adoar adwi/r waoryd. 

lor. Fidum: K.A. 1. US. 

Addygiad, -au, tm. [dyeyd, dwyn: L. alueo] 
a Ininging forward; education. 



jm v_.(,K)t;ie 



65 



AxbO 



J«/, (•Iwjd lylw 

dtgiad jBf Nghrmni. trwj |f)iuif);iid ya 
— , . -, — lui, un AjtttffchiiiJ st ; Yttmam, jb ertjn 
1 el mimtirdi i beii 1 Tmboliad gad si wnenthur 1 gjtfi 
A^diaiad yn NhjwYnguCh Cnimi. 

Ttpd: Adnddad. BfC. S (d. 11- 

Addygiadol, n. relatiiiK to or oonmeoted with 
education; odacatdoiuu. 

rw TD bell Dddi ynw.— ZtyHl.- Adtoddfad. lot. 
Aildygyd, V. [djgjd, dwyn: L. educo^ to bear, 
take, or carry awsy; to bear; to oany; to 
Ining. See Aidwyn, v. 
Cynriurbaa sTth aAli» [dj. Kttn]. 

£un6. (H.A. lU. UH.) 

Addyag, -ion, t/. [|d;«g; L. additeo\ 1. tn- 
Btrnction ; educstioii ; teadtting ; tuition ; 
Iftftming. The more usoal pL is addy*^ada%t 
(from a4dy*gia^. 
JL ntftnimt ti chmdl y pne 
WiiLjmanatajnniiitbginjtgl 
T« Inch DBtDT uf aMt^t.—Ialo Mu. aao. 
HkUs, dswrder, doethdBr, dnc, 
Bynod wedd, hyu yw d' oAffip.— Mn JTmddvj. 
HabTltyTiiUeUUTiulilw.— Jrr'-.*r°*-ill'll«' 
CIaf TW iMft HUrddrd. 



If. Ih 



a.OT. 



Tr ydvyf fl Ts duddl i dnrl oddfv dd«.— Mv. fr. I. 

A dafurddisa d«fti aMetg.—On. Oimln, Bl. 

Aa al vo I pa haia na bal^ tawn ermhwria^ gytuieddf 
Lm at v JMt^oa addftg nvfyddoL 

/fio XorgoKKg: ^Inuu, lUiaff. 19. 

Tn^vrddairl trig A mUnig.—Tegid : Qwalth, l*>. 
Addytg grtfijddol, religions education, religious 



aa^;,, i .di.i-fcpo«.. 



2. the moral (of a fable or apologue). 



AddTBgedigol, a. preceptive; didaotic; in- 

atrnctiTe; teaching. 
Add7«g«idiAetli, -au, tf. [from addytg, like 
dyigtidia^k from ''ys^] education, instructioii. 
Yd y ByfaiDser Saljatai a fwriodd el uiuer yn grofrddol 
n liny TwTC, no gTmnHrrd ei oddyi^ailliudt -with draed 
"""-"»■ yng DKby&iitb j Tyroiaid. 

<C. !>»>.- Dvy Daltl^ lU. 

Addysgaa, -an, */. an inBtruetreas; a female 
taftcher or instrnotor ; a gOTemesi. 

Addyag&, faoedd, fSydd, «/. a place of educa- 
tion or instructiou ; a seminary. 
Y mtrSii*^iim ... jw jr itddttgra hynaf yn Nhileltli- 
iaa Cytmul Amerlc^—Litfrjddiaelk y (^w>rr, 17fl. 

Addyagiad, -au, »m. a teaching; instructioii; 
education ; tuition ; edifloation. 
Addi/taiadau, instmotions; practical deductions 



1, pcrthynol l*; oell 



ael^d^dau, gyda'r 

iH. Barrit! OmlUi.StS. 
bi^n Mttwr . . . yn mha bh y oxAdait y Danryddon 
en jbaddjKjfia^H cynadinoL 

CanJmamaiec .' Han. Cym. >T. 
Kae bywyd Crilt yn Ilyfr Uam o aMiifiadam dwyfol, 

t/icamOtr: I>y«a Fyw. Bhag. M. 



Addyagiadol, a. didactic; inatniotive; edify- 
ing; doctrinal. 
Prydf/ddiaetk nddyagiaddt, didactic poetry. 
Sylwadau addytgiadol, practical rema^ or 

serrations. 

tod yn llawn 



ob- 



Han. Cym. iSl. 

Addyagiaeth, -an, »/, teaching; instruction; 
education; tuition. 

Hflb byn byddai yn euog o*r afrapnaifish o bori i mi neti 
ddau a jmaibDddlaQ dyrys mewu an Epiitol bycban ddl- 
ddymu aMyteiaia eglur pub man arall. 

JltnwioiM |ir ArtB^, Ui. E. 

Addy«gol,a.t«aching,iiutmctiug; inalraotiTe; 
educational. 
DaiUoiau yi hyapyilad ol ddytodkd nda Ihyddocdiih 
a boddhld ; rng Dgbyd li'I rbifynan oyntal o'r gwailli, pa 
ni oydd byddawr ac aM^igmul. — Dmytf^wr, L 144. 
Addyagu, n. to instruct ; to teach ; to educato. 
Tydl nn hyny, yr bwn wyt yn luUatgu anil, OBi'th 
ddy^ Jy hunl— fifiy'- ii. M (ef- 18). 
Addyagwr, w^, 1 tm. an instructor, a teacher, 
Addyagydd, -ion, f an educator. 

Un o biif irrthddfyoIiaD y QymdeiCliaa Oymmaidd yw 
. . . bod yn amgflleddydd ac yn oddfFrpgdd ffnriaoBdd. 

lot. MutIi: Oweitb. 188. 
Addyagwycli, a. well educated ; acoomplished; 
polished. 

Y nae bl yn gdfkdana ^ampna, yn gnddgna addftf 

Kych, ya «wg rtnweddnl, ae yn tam ddedirydd. 

BrrltuM, 11, M. 

Addyatr, -od, «n. [=Bddeatr] a horse, a steed. 
See Edde»tr, the more usual form. 

Hnrdd naUiaw <iddrtir pe i benbid. 

Jutu UrtJ! ILA. I. SIB. 
fAe, a medieval form, representing the modem 

^ Ae-, as a prefix, in the Owentian idiom, 
Bometimei stands for a in the other dialeota ; 
as, atdd/ivyn for adi^ioyn ; aedd/id for add/ed ; 
aedduit/H for addwyn, 
Aed, V. let him (her or it] go : 3rd pers. sing, 
imper. of the unnsed rerb au (=iled); and 
also the perf. impers. indie, passive of the 
same verb (=ttelhpvjyd, aethwt/d). 

Brut Or. ai AfiHur : M jL B. M». 
As ruf on o btmamh yr yitabyL— -JTaMitfjriM, IL & 
UlaTacbwedd. .. 
Ati bngaU, delld oaddanT. 



, (iblryfCd n 
mHoedfiwa'li 



1. 1. 18. 



Hyd LwyaHi 

Aed Bblalart at si inma.—Dafyid SEJnqn. 
^ Pughe inserts aed as a substantive as well 
as a verb; but as such it does not seem to 
occur, Qxoept as a personal name ; as, Prydain 
ab Aedd Mawr; Afarwy Aedd fab Clya. Cf. 
O.Ir. aed; Mod.Ir. aoM; Gaul. Aedui. 
A«dorw, e.cl. [appareiitly aeorr. of tiddiorvig] ivy 
{Hederay—HughDamee: Welsh Bot 2ft, isl 



Pan a bortbaT I'm Dsddaic, 
Ktyr eob«ydd, ihU tag^ 
Teym-TTDD trsoUad rynolwair, 

Zlyworc* An: M.A. I IW (et. Sn). 

IT A doubtful reading ; cf. A.B, ii. 267-6. 



,)glc 



oinByiiuit a Chi 

Yd«J.M ■■ 



fuuuf Zophi^ u 






«. ymtti-oflUuit 



W. O. Fufkc.- CO. vi. 690. 

Some modem writcra (we it to denote altitude 
or Terticol distance as well as souad. 

0» wl-gU™ elo byth eich tiawiJ 
Oaffrvd aUoa, neu foel Tiibor onW. 

Aedd, -ion, tm. a noise, din, clamour. 

J'JJ. Urfneulain; Uwirt,— Crirljt^rjr- W. Ciiiivl. 
MawT fir aidd yr WB bniKnnaTl am j Hfydliadai 
[jCimideithAittuC^iiuTMrTddHwl]^ ~ " **" 

yn eu ffwpithrgdiiMd.— /'»"■*'?' ur, i 
A«dd-, px. variant at Add-, q.v. 
Aedd&l, a. [dal] steady ; firm ; stable.— fftwjU. 
Aadde, <i. high or taU f 

Atwrn henl yn ehwybyr yn nwyfre. 
AirflatwynrytlalwjTafJr.— iWifjfn; A.B. U. IIT. 

Aeddfed, ii.=JcfJ/^. 

NuQuf hwnnir yn auiutl. — Mabinoffiom, iii. IM. 

A tawndot A trelu y nub yn ffyilBini o bop duoul u yn 

A girelet T BnryUi yn doc »c yn guraddd to1u« nnMnn. 
OotlhlaH /tk«/fiiii, 111- 
Ab yn» y trigyynird yny bu wr oniiirJ. 

finU n I>iitlc>fic», 118 (eT. 186). 
KtuiyB oHlucf Tyd y UyaKuned u ffnrytben nu, 

Aeddfed^t o> [=addfedig, addfedodig] ripe or 



Aeddfedn, v. to ripon, to mature. 

Da TV y kmin y vyouuia ug^Rn. M y lAliHtlii asn. 
wrteu.-*oMM™ i»J*(/iii, i. 138. 
Aeddfwyn, a.=:.^({({/'wyn. 
Hab lam forryn 
Qt«tydd ardd/Kru" aeddfed euian. 

jrada; ab OKtOler: M.A. L «» 

Aef&lch, a. [balohj proud; grand, lofty.- 

Aefed, a.=Aedd/ed, Add/ed.—S.W. 

I a'n nabydder 1 ~ 
nao tOnt ar/rd. 

Aefel, a. [:=hafal] similar, like, resembling. — 

Aafelfdd, a. [=hefelydd] like, nmilar. — Oweat. 
Aetwya, a. [mwyn] gentle ; mild : also written 

ei/wf/n.—Chjeiit. 
Aeg, -au, >/. language, speech; expresaion. 

Aee,Ulieaage,—ll'. Salfturf: Dint. «.T. 
Aeg A arwyddocA ioJth ; mwyi Beisooaeg, FfAogaeg, Vr 
oyfryw.— Wm Yifrif (Hani, C.C. Ilii. 81!). 
Da y grwyddcMt ih^ y mddt. 
Diwedd da ar dy wedd iL—Uairig Da/nai. 
Uefara, attolwg. wrtb dy weifliini yn BfTian-avd. 

Stg. KorgiiB: i BreB. irUl. »8 (d. BhL dctI. II). 



Pryd T rhoddir yn bendimt i Dda«, y mae'o cyfaleb i'r 
anv flebrawfef lehofah. 

RoKtand Vauflm: Tmarfsr Duwioldeb, 18. 
Aif er laith w aeg girtad Caoiuin. 

Rhtt Pridari: C. y C. bt 8. 
Rbtii'n bnlodaidd wcddaldd wi« 
1 eglwyawyr a/g Iwyiwiv. — Wfl ah Devi, 
IgioD ydoedd o<^i. oodal.— Atjii Jfor^nii. 



Byd aowMd y« bod nn u; 
I mtha enw'T Frrilnameg. 

B„ieH ah OiBiIgm (GwyUedydd, T. 114). 
O ! aabnrol awn Oraiii, 
Owau a darwain teg awdurol. 

Dewi »>.■ Bl. Art. *Crf. 8*^81,119. !*•)■ 
Teitboedd lawnoedd, ol«i wlw-na, 
Aeg yvnb addolwrr y QvureH. 

UunflicrJVecA^; Chnitb. L VS. 
Yd fy lion hsa union aeg, 

A thannaa j Frylhonaeg.— f-iiDnIa/,- Omlth. 0. 
Eu blaith a ndwant, er Sa«nu« ■ phob «;,- 
A*a N«T a fount yn yr iaith Gynuaeff. 

Tr^/ Onitlt, UH. 

1! Davies (e.v.) eKpremea himself strougl]' in 
opposition to the notion tbst aeg Bigiufiea 
laug^oage, dialect, or anything ebe : ' Toto 
errant ccelo qui banc vocem, Linguam, vel 
dialeotum, vel tdiud quicquam sign^carc pn- 
tant. Errori oocasionem dedit Eg terminatio 
vocura dialectos siguiflcatitinm (vt & nonnul- 
lonim aliorum foBmininoruin] vt Owydddeg, 
F/rangtg, Hitpaeneg., Owyndodtg, Qwenhioytg, 
DeheMartheg, Oroeg, lingua Hibemioa, Oal- 
lica, Hispanica, oc. Sio has vooes poets 
veteres cednerunt, dc historid scripeenint; 
scribont lic^t Seioli recentiorea Owydiielaeg, 
Ffrangatg, Ac & Tocee compositas esse exis- 
timent k Owyddet, &a. & Aeg.' It may have 
originated in the oror which he oombAtii, 
but it is now, and has been for upwards of 
300 yean, employed aa an independent word 
denoting language or dialect. 
f When the diphthong at occurs in the pre- 
ceding syllable, -to is, for euphony's sake, 
genenUy preferred to -atg; aa, Altaaaieg, 
Daentg, Oaelrg, YtpOfeneg. 



i[ Some writers, notably Henri Perri, nse -org 
tea -rg as a noun termination ; as, hraaiddr- 
atg, givatvxiTaeg, for brawddeg, gioatwartg. 
Aeg&iu, a. [cain] fair, beautiful, elegant. 

Aegam, ttg, hardd, eigaln- — Owigfrjpt W, Ognval. 

Aegfor, «m. red or wild campion [Z>ycA«M 

dioiea). 

O Diyni lanhau dy galon, ifnaaia wywell rnenynddail ; 
cymnwr hefyd wyi^ell dail yr aeg/vr, ki llynan yr ychen- 

Ael, -iau, »/. 1. a brow; the eyebrow. 
Ad y Uygad, (pi, adian j llygaid), the eye- 
brow.— i^. ^v. 9. 
Banner dymued yn byt pob deJ Ida*. 

Campa^ C^rlrmiim,\ta. 
Ac yp syndaM y aeUu ar muohnd. — Mabuiogiom, ii. ST7. 
Ni ddanJonaist, ddyn feinafll, 
Lal*i ym', ddyn linttu ail. 

D. St OwUgm, xh. 87 (tf. IXXT. 17). 

2. a brow (of a hill, Ac). 

Atl bryn, the brow of a hill, — Luc iv. 29. 

T*r dinHEl naelji allt.— £. oi Ovagm, llvi. 40. 
Ail i'r 4t ael Eryri.— ffnniicy Oman, M. 
Vn boiv coUala e, — fy iwhof ly brudd, — 
AraeJj bryn, ao ia ^ ddcrwen daen. 

T*. Liegd Joim : Oeinian Awan, m. 

3. a border; a rim; a skirt; an edge, verge, or 
margin. 

Ad gvriig, the skirt or border of a garment. 
At ael lien outfaen im oaifaglwya.— TMiau .- U.A. i. 18. 



Ar ad, on the border of ; on the margin, edg;e, 
or -vBrgB of ; nigh or near to ; close by ; near ; 

ty. 

A llwyalon yw^ llTaiB.u, nil ffcmau'ii ofi Bwa«n- 



DrMfrr w»*dd imat srial RwaneR ar arl Owynedd. 

Or. ai ilfrrJudd: k.A. i. 4 

n of day, daybreak ; the f 
ae.^D. oi Ourilym, dsiv. 
Jd TkW, the edge or verge of night; the eren- 
ing twilight, tna dusk. 

lljwwaijgmeljna'laot.—Bhgt Gock Ernri: O.B.C.W. 
Nt bo or niMl jm «tl „oi, 
Airiubelurnuhos.— ttA^i/Bou: OnsiUi, 286. 

Aal, -oedd, »/. [=»1] produce ; a litter ; a brood. 
IV ad gyntaf t hwck, the first litter of a bow. 
— t'.S. 
Ael, tc. f-rrail-sab or ach) a son or a daughter 
(in pedigrees]. See Ail, ic. 
UaonoB. Cnna Sontfa act Tewdwr Uyixv. 

loto Ma. Ml. 
Aelaf, ) a. doleful ; sorrowfol ; sad ; dolorous ; 
AelBW, ) woeful. 

B^ iddav yn oelan ejlon ynddi. 

M^rdiU: M.A. i. 13T (ct. 1G2). 



T nn a elni oedd yn atlaw. 

Gt. Y«nd CorJi: li.K. i. 896. 

*^^^ j «m. dolor, grief, pain. 

Aalan, (.p/. dolor; sorrows; horrors, 
Jfjnfflun lydaa 

CyfiTFreiii mawrdan.— ra!Sw<». M.A. i. 1S8. 
Odld I'tiaff angau a4 oe^jiu mawr 

HibydilaT lefovr iiui*D. 

Uymanh Iltn: M.A. i. lis (<!t. 1M|. 
Tnotgeiddigybelddla 
jtijim, oer D vedd fal in, 
Deu ffwHflV nu«th binietlilyd, 

Dn^ Draw, sidwyad bryd. — W. O. Pugfie : Bardd. ill- S. 
Ajeiavr, t.cl. riches, wealth, opulence. 
Cni i bwy a^avt beddiv eui eiliv cloirdi- 

JfirdJin: U.A.L IKt. 

Or. »» JTcmiW .* U.A. I. 447. 
Kyndllt grym yuym ua«d y Alon 
Ay dr^ai" ny chronaAwd- 

Llrwclan Brr/dgdd Hodiuint: U.A. i. 41J. 

Aelaw, u. rich, wealthy, opulent \ precious. 

Oed d<J«° OCT iwlwTd Beblis.- -Cipiddiiu:: M.A. L 9)6. 
GomiH yw dadaw luiaw elyf. 



Dcalld. 



UF dooOi dicll wyled.— 



iir^gn: M.A 



» [rf. 4M). 



Twni afJaio ttnon olwg.—b. ai Uurilj™, cbturii. W 

O LTwelyn, In oeJow, 

A'r Tewdwr wyoh o'r tu d»w. 



„.M«i!aoi: ^Im. cccdx. 10 (cf. . 
Aeldrem, -iau, «/. a leer; an oblique v 



Aeldrwm, i 



)pl. -drymion, a. knitting the 
Aeldrom, /. j brows ; big- or heayy-browed ; 
frowning. 

Dimi^ aitiintm, d«rs ^-drwyn. — Qroaiey Ohkiih, 109. 
Aeldrymu, v. to knit the brows. 
Aelddu, pi. -on, a. black-browed ; having black 
or dark eyebrows. 
C^al ymddiddan ychwiuieg, 
Cuuna dyn ofJtidH deg. 

h, ab l?iiiilgm, icvU. U |ct. ■'■IH IS; Clllx. 11). 

Aele, la. sod; piteous; lamentable; woeful; 
Aeleu, j awful. 

AfU, ^Ksyn, doEuriu, toatur. trist, trmn- — DitriH, «.t. 

Braw Ofk, a sad fright. 

Bnder de bnw aiU eiin.-EliJir SaU: M.A. L 345. 
Enimwc Kyueilyanc ya kot aitt. 

Liaw. Lii/iccIsr: M.A. i. SOT (p(. BDl, sot). 
At ddan gwyddfld arte y gwelid ol ei gWDll. 

JfoJdj Dw^srais: M.A. i. 488. 
Gwelwn ryw olwg oetf. 
Owdw ofuD dnw ger llsir'r lie. 



Aeled, -an, tm. ailment; indisposition; disease; 



i.44). 



pQined bwystnon ax holl vibnon BgypetoB 
BeUd mlled o drum O'Ud deritolioii. 



Dyduc 



ir deill a bydeir o pop ae 



L m (cf . H 

abwyf ffwr gweryd boed (fwr ffwared 
pwareao boen, o bob MlfJ.— iljoufyri RtnMf (P.) 

Aeles, «in. [lies] benefit, advantage, good. — 

(iwad. 
Aelewi, v. [aelaw F] to ornament or decorate P 



Aelfia, faoedd, feydd, sf. a brow ; a ridge. 
Ad/a bryn, the brow of a hill. 

Efe a welai gaAell mawrar asl/o biyn nohel.— /fai™* Mr. 

AeUbin, feinion, a. having slender eyebrows. 

Bdm gynt eer wynsb em gain, 
Anwyl.^aTdd 1 won ad/ain. 

D. ai 6'ibU)™., cili. T (rf. KETriil, i3; diiv. 4). 
GoTCD Oven od/ain gmig yn EUed. 

i. G. Cnihi, IT. V. 82. 
EUtyw y'm geilir dyn ad/ain.— £.,'urf« F/ratthmd>, -ri. s. 
F'eDaid coeth funodiaii oain. 
F' anwyl-fBPeh oedd fun nel/oin.— CinijiBi oi iy^^. 

Aelfiiwr, a. big- or largo-browed; having 

large eyebrows. 
Aelgerth, \pl. -au. »/■ [ael-|-certh (P.): cf. 
Aelgotb, \dgfth: C. f/jfA( (C.V.); Br. e/juts, 
Aelgaeth, ) dgez. dgd. The r in aelyertk may 
be intrusive (cf. Mab. i. 283), owing to a sup- 
posed derivation from rxrth. Pughe gives 
eilgyrth as the pi. of (ulgcrth'] 1. Se cheek- 
bone; the jawhone or mandible ; the chin. 
Mflwn gwBilgi wyf. mae'n joel petth, 
A*r w«l^ hyd yr a^fftrih.—Bfdo AeAtnn. 
Ae o^^jf f*. liw fftwd ^weilxl 
A gjtbaedd hyd ei giuAd U I 

i>. atf Guriirrm, Tiii. 51 (cf. ccxxzrili. 51). 
CangeD ddifetli tttt^jtlh li>flw. — ^. 
Sod blutr wrtb dy wddf dao dy arlnarili. 



,>glc 



Aelioo 6E 

2. a hrow ; the edge of a cliff or ateep pUoe. 

ChwTtlMn^ VT udjryni nr nffvvrxA riiliinliiiii 

BIndnctU: Cebl. Alim, US. 
ftrnmyTiH^frMafwltiirjbrTiiiHi.— rt. UtftlJona. 
Al atliHrlS dirfr T mOgl. 

Ottallur MecJuin : amth, L M. 

Aellog, a. browed, hftving browa ; having targe 



rn udnet hatwyd meiut 

AAodav TO wrth y dfD T^it T^ hrim dwyUv deu trofld 
dm lre»t den (lu»t ffnjaom yn lie th aeXami dwj; wefuai 
whebu nirtipuniiit o airiuit yw gwerth pob vn or rd byiuiy- 
, . . 8ef »t»I boll oWmfci. dyn pui gyoAer ygyt nytli punt 
— *■-■ 'it punt.— Cji/VBtHa. CViKK, 1. MH, MM. 



Hesyi r tot y meddya da ymaltli iclad pwdr ■ . ■ rtiag {"r 
acJod innnr Irvra yr oMpdan twsif ato. 

Bi. Itmat Horn. L SB. 
A*i imeothnT yn iuIdij byirlol o'r unrhrw. 

U. OwxUf Offrtdbi (Bedydd). 
f^iilp4ff f ml hefrd fad yo a^od ^wiol o'r nnriiyw [w- 
Ymjii\.—tlimt WUtamt: Uawlyfr y UaiiinR, ili. 

NId lawn Iddo goUi hrt^ « ail>ni,d troa mil. 

Ci/rMHan Cymn, U. M>. 
^ydydd yw, dadleu dmddyri yiD mhsryfrl fiHitf Bc wJdd- 
«.— IVipxa dgfrailA: M.A. (U. 3M. 

2. a member (of a nooiety or community). 

^efod imeddcl {pi. aelodau scneddol), a member 

of parliament. 
Aelod o'r gy/mitk, a limb of the law. — W. 
Adod gymdeithat, e. member of a society. 
A^odau'r ffymtutleid/a, the members ef tlie 

oongregation. 
Adod mygtdcl (/. aelod tygedol), an honorary 

member. 

3. (figO s relative or lriiiatiiii.ii ; a family. 



Set ea ailaiitti obraayayaeybyoDayneycrytita 

AelodMth, ' 
Aelodia«th, 



-an, a/, membership. 



rmatyn pwy ydoedd 



si fulodaeth jn y oolev . . . yn siii haj 

■ addyi^wyr a"! (rymdeittiioo. 

kiai^ib^.- DyBga Fyw, B 



, s/. a female member. 



A 4^fu fiaint addae fntd 
Yn ddlddiff cyfluwn ddyddiau ; 
Jilada Srwyibai until 
O byd, M Did oedd ei hail. 



Da/^ D>r Mni, Ud. Hn. Gamaih 
Aftlod&in, a. slender-limbed, email-limbed. 
Aelod&'WT, a. largc-limbed ; strong-limbed. 



Aelodfraa, a. Urge-limbed, large-membered. 
Aelodfyr, m. ) a. short-limbed ; haTing tdunt 
Aetodtkr, /. ) limbs. 
Aetodi, V. to make or admit a member ; to be- 



malring at aduiittdii£ a 



A«lodiad, -au, | tm. a 

Aelodiutt, ) mem1 

ber; matrioulation. 

Aelodol, a, relating to a member or to members. 

Sea tal y bydd rhif j bwwn ottaM taewa bnpynt nea 
loatodyn.— Ci/Huet r Mrold, Tfl. 
Aelodwjm, m. j a. having white limbs ; wliite- 
Aelodwen, /, j limbed. 

HyncD lutodvn ledwyllt.— Zf. ai Svilfm, 1. tO. 
Aaluaen, -au, */. the same as Alutm (=eluann], 

tly ■• 



and appai«ntl; 



n of that word. 



Aelwineu, a. having auburn eyebrows. 

DuIaaddulas'vBiwddyn.— Z>.at Gttllfn, <iEiv. *0. 
Aelwyd, -ydd, -an, (/. [C. etfrf (C.T.), otaa; 

Br. oalef (Cathohcon), a^ed, oalfd; Ir. eallagh ; 

Oa. ttailaeh] 1. a hearth; the fireside. 









Llytmrrll En: A.B. &. m, 
troh bob lUiimgi yn ynyi PtydeUi — MaltBiotKii, iii. wa. 
Bet gjww^T, Hoabai yn Ac^jrl Duurbok. 

Asth olw droi trig vytli lujwnj. 

i>. ai dwagm, ocsd. G lof. It. 88). 
Tri plwlli diddan gta wr eo ^wded : tanwyd din ; yr 
(uiKydja Un; a'Tinsig yn llawBii.~Jlyn. -tre*. iU. UB. 
Uae •ul-wi< o'r dor mslan 
Tn ban o^i bodol din. 

0.^m Oimui. iFkrcb: O.B.CBB. 
Jdtitd a ffyiiibell.-i>>ani. (H.A. UI. IM). 
Adwyd y pdydr, the point in which rays of 
light meet, a focus. — W. 
2. (fig.) a family, a household. 
Do, nilialK dawi* «liD«d, 
Dalar a Dsf Deym wyd.— WiHam Sgtntil, 
IJe« advird Uywelyn.— Gnljni Otcain .■ O.B.C. Ifll. 
Aelwydaid, eidian, a/, the fill of a hearth, a 
hearthful. 

Un Hnll yn peodviDpian nmh ben at l wf imi d o aasmi 
tolciog.— flit ftVn.' Bardd Cwig, 31. 

Aelwydog, a. having hearths; having a large 
family ; pertaining tn large families. 
WrUi nfi luUcriaKt AtUhu aelodau. 

Aalwydd, a, Bocoessful, prosperous. — Qveat. 



Ac OnaUt tab Oaawl •K'Hyii.— CV»1<M« -- >LA. L MO. 
AeffiredilliidOBtwallt , . . 0««wy<w(iri™ i nawd a denth 
en TTenin en i le.— And Or. at, At^mr: ILA. ii. SBl. 
A obynna) e^tatl Oawy aal»i>ii.— L. Q. CoM, i. Evtii. 9S. 

Aer, -an, -oedd, a/, [fair {pi. furou), fhair 
(Zeuss, G.C. 102, 1063, 1065) : Ir. or] slaugh- 
ter; battle; a fight, oonfiic^ or engagement. 
Strictly aer {=Li. etraget, eatdet) denotes battle 
in reference to the slanghtar committed, while 



bnpydr (■=Ij. pugrux) regards the omofiiot oi 
etn^^le, iiretrpeotiTe of the Twnlt, and cad 
points to the number enguged. 

Atrgataia-niai 



A dTtwK 1 EhidiB art aim. 

OttabL OiflUitt: HJl. L MS. 
tnw nr »r» amtid dnf oedd dufu, 

Gr^ff. all MrndftU: UJL. L «M. 
livTd auben, irrd laini ben atr.—D. ab Onrilfm, xIt. 4. 
r ddeo-frBVd ddunt o ddlTrir 
TiatrjntAOaBaoTa.-O.Xtdutbi: OniUi,LT0. 
Aar, -od, *m. [from L. haeret, heret; E. Aefr; 
Br- haer, hear] an heir, an inheritor. — ^. FT. 
Cadwei 'Daw JT OCT l~L. 0. OoOii, i. xzz.18. 
&)rr H gUMwjT Mr aglwyn^. 

7n»»I> aip^og! M.A. 1. sn. 
Wjr i'r ffwr yw*r fl*r pwiw^'rodd, 

Atroarrhim,mierwfnm3a.—^. Biratlitf: G.B.C. ». 
Aer 7 ddw;^ luun. hudd Uwn rw ; 
^«rdeu-daid, enr&id rdfw: 
.^■r Lleweci, iarll hai-nai ; 
Aer BervD yw, bur i&wn vaed. 

Sim PXillf, i lou e*l>bri. 
Dflid «r gu df law dl.— 0ran»r Ovate, SI. 
Tt nn fsth ^ T bydd DSDrwyT td addair I amd ISDaliie 
bird 1 'brfi^Siandtr: Dyigs Y*m, art 

AeM«iib,>T% oydCTisuI— CuctAi/.- Gwetth. 171. 
Aaiaesor, a. bearing a ahield in battle. 
HtroeaKWB ti Noe, mrtuKr taewi, 
HwT, bnvdl ofwr, to hcwdl Ifar. 

flu/-, af "--" ' " 



AArttwd, odaii, tf. a battling or slanj^htering ; 
slaughter; battle. 



, , „ n#i dyt miwken. 

ugK. oft ur¥>ds%: ic.A. L va. 

Atramd gmwd^mdr dlael 
Act dalmlthn sor hvltthTT hul. 

£Jjw. a» Utveirn : K.A. L m. 

Aerbair, a. causing slanghter or destruction. 

^crtrv- bttr Imet auid. 

OtaMtlw .• M.A. i. ass (sf. 33S, 3SS, aSl). 
(hnenrwmwT afl-idr y tdr taleilb. 

LfsffO'' ^^»r.' H.A. L StS (c(. S8B). 
Aarbaith, a. lairing open or wasting by slaugh- 
ter; ravaging by war. 
TattMlUuiini snum aerMOi DinehR. 

Ugfodthnr: H.A. i.SM. 

Aerbalsdr, belydr, tm. a battle shaft, ^«ar, 

Atrialadr arfui Bdi— 9r. a» Iftrrdfdd: M.A. L MB. 

Aerbar, baian, beri, i/. the spear of battle or 
slaughter. 

Kflnd blaeogu canhar grrm atrhar gtjd. 

Giril^m iM« .(r/m.- MjL t 409. 

Aerbar, a. preparing for slaughter. 
DUtM gM gsnniryU eurbwyll rurtair. 

ffr. oi MtTtdfid: M.A. i. iSB. 
Aer te-WT frd bvT tu atriar beOnir. 

Ori*mm: M.A. L MS. 
Aerblanc, blainc, sm. [aer-t-planoj a warlike 
youth, a youUiful warrior. 
JorMaiBf jv GnflTdd wyr-Mrgr 
A bw& fffflflt, fljd Dai otTK.— i'. ofr ^iHJ^it, fsxril. I. 
Aarboat, by«t, »ro. the pillar or stoy of battle. 
Ownaathoat gad oA-froA Red eutbar- 

Uynr, af UrtMl,™; ItA. L SOI (rf. SB). 
Hab B;b wrtoif llri aerbdr yn amsa. 

Ftgdydd Bfciam : M .A. 1. W^ 



. battle- or Hiaughter-frightening ; 
g opposing armies. 

Ardvynikf bael haul diaohor dialg 
Aer^jxrt arvnalft affdcnrf AAfrar. 

OyxJdiluTSl.A. I. MS (of. 3H, IH SS5}. 
Aerdawelwch, nn. silence or etiUneea after 
battle or slanghter. 
Oryr yn digyn yn dy^TRTdwch 
Qiroiia nar TD d«nf(UnuiK]l. 

Ufw. ab cir»i|n .- M.A. 1. no. 
Aerderfyag, -oedd, -au, ml the twnult or oon- 
fusion of battle. 

.Jarrfinirie am y damyn.— C>arfJ«lw ,- H.A. 1. nt. 
Fvyr fyiD atrdtrwfae ar donyn Uecm. 

X<^. at Llytnlfn ; U.A. I. 301. 

Aerdew, a. thick with camarge ; being in the 
thick of battle. 

Yn anrUwryf yn aortotyf jn aodart atnltiii. 

CrwMcJic.-M.A.i. VS. 

Aardorch, dyrch, >/. a warrior's torques, collar, 
or wreatit. 

Bf a«n<>rre* amli kynA un Iqmbimb byd tnwd. 

llr~. ai lWim .- M.A. 1. 180. 
Aerdoif, -oedd, «/. a warlike or martial host or 
force ; a battle-teoop; a host of elaoghtcr, a 
elanghtering ho«t. 

AOBoryt wrdani/ enidonhaire. 

CridMte.- H.A.LlH(iif. Ke,tM). 
Aurdarif fsrjt gwtt darrwyn y neld. 

£Jr». ah Urwtir' ■■ M.A. i. ws. 



fir. oi Mtrtdidd: U.A. i. UO (sf. MS). 
lU daU r«edl Hrdnt yn giia yn y goedwlK, 
n denldi/ oedd dannoeUi ar daen jn VTwedig. 

rt. Usjid /<ni» : Cein. Aweo, ISG. 
AerdraCsl, em. the toU of battle. 

Howe) atriraM nj wyr drofa. 

a. a» Z>. a» TuAir.- M.A. i. «7S. 

Aerdram'WT', -on, ma. a frequenting of battles. 

Cefala ia diapjr dnryglad arr^ramm)!. 

Madeg Dtaffffraiff : H.A. i. 40S. 

A«rdi&nc, diainc, -au, «m. extermination in 
battle or by slaughter. 

jadan parablan per. 

Or.iiirtr. 
finanffonriawT 

Slidlr Sa 

Or. ab ircfvlgdd.'ii.A. t. IBS [d. SSI}. 

Aerdranc, a. killed, slain, or fallen in battle ; 

battle-aUin. 
AsrdrAwd, drodau, drodion, nn. a march to 

battle ; battle-tread ; a military movement. 

deg^a .- H-A. L 8fff . 

Aerdrawd, a. marching or moving to battle. 
Aerdren, am. [of. ardrm, praepuKnis, in Oloss. 

Luzemb., Zeuss, Q.C. 1064] the rapidity of 

battle; battle-fury. 



<i MtradgiA ! U.A. L «0. 

i.-U.A.I.34S(i>f.SSr). 



Haarwyntvybnn.— B*|rjSiMikalB*K«rl: IiioJtm,MB. 
Aerdrin, -oedd, tm. the arrangement or manage- 
ment of battle. 
Adtavdd a] ddaad aenlrim ni alJwn. 

Daftild BsK/nu: H.A. 1. 306. 
Usw llyv Uu orlllu 
Uann entdtanm airririii. 

A llywym bydln kyn llawr bydar. 



wV.tll.)' 



-glc 



Aerdsoui 

A«rdrodi, v. to march to battle. 
Aerdrydar, tm. the din or tumnlt of battle. 

Oorui? if Ujw tlew ungiied 
ewyw am acrdrndar drted, 

Prti/M Stdmn : H,A. 1. S§0. 
A«rdwr, dyrau, im. the tower of battle. 
Nend wytt HT amJ«w «rdiry enras cud. 

Kedernyd Eneai.— /.lyir, s( /.lyir''vi> ; M.A, L 800. 

AerdwTcli, dyrohod, nn. the boar of battle. 

Ltew Uyw orlUn milm don^ Crin nul arrdirrTA bwrd. 

(,V. lA Utraifdd: M.A, i. MS. 

A«rdwTf , dyrfau, »m. the din or sound of battle ; 
the tumult of war. 

Yn aerdvTuf jn fterdoETf jpn urdArf yn fterdew 

Tn aiowjf rac trylen 
T du llifnwT lleitfa wotew 

T dan llunr glu y Uu Dew.— CVddcfiF: U.A. 1. »fi. 
Ron ar dsryoc greiC Run atrdfrvf^. 

Shinrdyn : H~A. L US. 

A«rddar, «m. the stately oak of battle. 

Aerddar glew eurddor y glod. 



RhyOi 



Ur. d» jrcmffM; H.A. i. « 
urddsvl roddfodd hul. 



Hun llcatoli ft., , , — 

Ellwiw ym fy ofrrUtaf cadambar cad. 

Uiriljria Dd« Arfm: M.A. i. 410. 

A«rddidarf, a. not to be driven off, Mghteued, 
or intUnidatod in battle; inflinching in the 
conflict. 
Aryliunlidiiri^DTddedie.— 'IVumaljo; If.A.i.4M. 

Aftrddlhftftirch, a. bold, courageoua, or intrepid 
in battle. 

Aoch rotafHiiHrd mnfiA^/nrcA wyi. 

•JaiddtlMi: M.A. 1. »«. 

A«rddor, -au, >/. the guardian of battle. 
Fortbais alai Lnnn tnunawr , . . 
Am ioTunUDTUTddedig.— £Vuun Wan: U.A. I, S3I. 
Kyaeusot Bohdor otrrfor curdym. 

fixbn oA (^UHkitiut.- U.A. L 330. 
A'i BTmial yn^^o gainlu, _^^ 

k«rdd 
tto. 

Orjin etrym acrdtac ae dyIy.-(7^iirfiWK.- M.A. L M7. 
Dynnt ffraig atridrnig AT ddruiMig. 

^-w»/i BryfiiTcli : M.A. i. 839. 
Oiym erdrym lurrf rnc yn dij'ffro. 

f,;,i,nJ ffwr.' M.A. i. M '-• "-" 
Grym trddrTm aerddreie aua«J 
Oruffut hil UarsduC ttA^.—llirddyi, Fardd: M.j 
Aerddrud, a. bold or bravo in buttle. 

0>milttIewafrdriillly«urdrM.— flfti«-rdj(».- M. 
Arrddrgd tad or ta pan ttaSy, 

bxfgdd TUn/Tot : M.A. i. «». 
Aerddnr, itn. battle-etccl. 

Gad cddyw aertUtnT yn u^dyfrwyH far- 

7*ri/nlC.rf./o--.M.A.i.B«. 

AerdduriOK, n. steeled for battle; hardened 
for the coi^ct, 

Eyd a« naf cadam rK Kit™ 

Fryd^di BycAniI.' M.A. L 388. 

Aerddywal, a. fierce in battlo. 
Pwy'r gler llrw Uit aerdiftcrd 
Afi dci]y kyfrwg dwy brcnnvHl. 

Aere, t.-=AeTfu-^Ai:Ta,u (tg. aer, >/.) battlasF 
Rhuk Llywelyn llyw a^re 
Or Bog nyd ym MndtwwK 
Ltnwcr nuarchotf marcn dyro 
Utaw. gm. aiTiyd giii»lte.^Cs-«i.iriw! M.A. 1. ali. 



Aeredd, tni. warfare ? 

Bthab sotynrbyl biif [yngnKbyftit!] otrrM. 

Or. I'lad out.' M.A. i. 339. 

Aerea, -au, »/. [oer 2 : E, heire*t\ an beireso. — 
JV.IT. 

IJawf[>rwyna eloynofrvj [*stifedda) iVmwtna. 

Ue mu gw^ yn rbeoli u yn dyagn yn ol Iniidan a chyn- 
ffoDHH Tli«wm, Hd yn goaod i nmy (feL Atra brydf^rtli AT 
Diwddfalnc) blenCyn, yr bvD eydd reddw yn ei falcbdcr a'i 
irm^mat.— Morgan lAwyd! Ymr. il. 11. 

Arra lore yir"r oien ndd. 

IfiBBUItT Mrclmin .- Owaith, L 68. 
A'i ami waff goryn ■y'n rwRhod y glanddyn. 

Jidu. AtcAaH; Bogeilgerdd, ILT. 

A«ifii,faoedd, fau, ef. [aer+ma: airmaou [Glou. 
Loxemb.), ZeuM, 2H5, 10»4] 1. a place of bat- 
tle ; a battle-field ; the seat of war. 
Ao «diych yvlat awnaathant ford y buaiHi yr afruofu, 

MaUnifian. Hi. IM. 
Uai nerth giryr aryr atr/a, 

ftrr/aiCidifar: U.A-i.BM. 
Ni hnUr oir/a m*y t llacbar ddv. 

SUuiteiU.' {Mb. Alan, 163. 

i. battle ; fight, engagement. 

Tair drat an/a Tnys Frydain.— TVioaM: U.A. It. 11. 



Heb dial aniadnnt er •■ 
rianl ninhen gynl. — Brut 
Triohant djoa dridiaa'D tivcba 



3. slaughter ; carnage ; execution. 

Ac en dyannot en brywaw atbrwydunt i 
mewn ed aetbant a nneBthDr omu or Bum] 
Brul Or. ab Artk^. 
Tno y bn an-u nwi 

Ac ncrUi bwnnw y 

dtroainaenui.— Ai-ai|i TyujiHi 

Aerfttb, feib, feibion, »m, a son of battle or 
alau^hter ; a warlike son or ;outb ; a Toung 



Qmlaia o arfod mr/it Oniffnd. 

OwaVAMUti: U.A- t. 191. 
Airntah Marednd md fi maL 

BItddyn Fardi: M.A. i. MS [ct. 3n). 



.4tn«ii(aiarn«d['MTel].— Jamrti.- Ood. 163. 
Mflwnid amxM anl a byl^— fiSIyi .- U.A. i. 41S. 
Arfaetb maMh nulib ner arr/aUd rbaidd rfaoddfer. 

DufyiU V CmiI.' M.A. i. 4%. 
Aerfoidd, feiddiau, mt. a daiing to battle ; a 
challenge to fight. 

Ein ioc ydwyd, ia«a waredog, 

Bin qnn atr/<Md, 6k>Doyn arfoB.— Cjyr. » Brirdd, Bl, 

A«r&Icli, a. protid of battle. 

Prfdydi Bytkan: U.A. i. 385. 

battle; 
€kKb y laayn o lat yn ragor 
Tn Baolan yn ndym flinor 
Eocb arum ocruan kodillir Imnan 

Ban Islan bsiit Tangor.— (7jnddelii.- U.A. i. m. 

hxitax, tm. the wrath or rage of battle. 

IJaoben gyiufpar 

Tn omKiT' yn arum.— OymdWio.- H.A. i, 137 [cf. 383). 

T . l ao ha r nar amiar (nynyad. 

fiW™ al 6'(<v«.' M.A. i. SM. 



,,Gt>(.)t^lc 



Adu Ukl n edjr'T marcL— S(<i« Omd: 
Aer&rchog, -ion, «ffl. a knight of battle=Cad- 
/arcA09. 

AerfarduJiffff dtitBiMWg dor. — CyuidtitiJ: M^A' i. 210- 

Aer&Uiru, v. to tread or trample in battle. 
Hr^TT iTvalkfra lio««der Teitlirin danwd 
Bfder UiLwci oed byt srllevln.— Atucrdfn .- M^. i. 433, 

Aer&wr, a. great in battle ; doing much exe- 
cution ; fuU of slaughter. 
Drfoi dem tztod acT/aicT ajBglta trio 
Hewn MM otal Kwutad, 

Br. ab Mtrtifid: KJl. i. 443. 

Aerfedd, «m. [aer-f-medd-u; or it may be 
dmp]; an inlerenoe from the next entiy] 



A«Tfbddog, a. [aer-|-bedd] 1. fighting, alaugh- 
tering, or revenging from the grave ; grave- 
staugntering. 

A^/eddoqvm, Blaughterors from their graves. 



Triaw/ftWaiptfyB^ Prydim: Belyf ab Crnuk Qarwyn : 
K Ataon Dub Tilieon : a OwallairK mcb UitouiliR' : Ml 

..i______,_^.. ._ . ,... un ddartod dia" 

» {d. 14, m- 
only an ej 

tension of the preceding sense] victorious ; 
ranquiflhing, conquering. 
OauwT glyir glewyd dinUeth 

Gornlws *nt atrvSatt de^n.— Cynddcte.' HJl. 1. 1». 
Mi H^ uwyre Tt bn bniminirc 
Brniclsw aiuel hael d hS Uadam 
Apwt yn amm aerueiauv dejm 

Eryr at ^edym cmiKed uuiJia^fo. 



r/an, th 
Lect. o 



Aerfen, if. [= -/«n (nien) mAy be=: -/an (man) ; 
O.Ir. /% : then oer/en wonld be: 
place or field of battle. Bee Bhya, ' L( 
Welsh Philology,' 307] 1. war; b^tle. 

Bafuuv* wjmlcdt odTvoa t medlftfyn 
A« nedlAii du^fwetL — C^iiddtlw: M.A- 1. 33t. 
Qonig- Artlien ab Aith Hen, 
RfasE Itwyr «gu ae aagon, 

Uaol yn^ oghad, 7119 oghAdr rvr/m. — loio Mu. MS- 
2. an old name of the river Dyfrdwj, or Dee. 
Kjmin TTnnu. kynafchveln. eq dibedjd. 
Deoln AefiLS*, diJTwrs dilen ; djdawliijd. 

Bfd ■ tatjAA, I fo i Aer/t».—L. 0. CMi. iii. xiiil. %. 
Aw/tJt ben^nch falen fawr. 



T Bwe KOriioff em n gvmt, 
O nt Klaw ai a f obt. 

A ChoelW oul (d dulon ; 
Am a welaia ^ niyn EUsn t 



O lAonifn) 1 Lrn .J«/b^ 

Warn mor mn a'r moTwynloD.— £>iViKlif *i Edmnmt 
Bat oedd f ertoetli hrnjr ana ydd flat Olwyd yn Airr/tn. 

Into Ma; ta {ct.m). 
Aerfln, -ion, -iau, tm. the edge of battle. 
A fforf od ac vTilq Aam ddurgledd. 

Ba/vUyCMi: M.A. i. 497. 

Aarflaen, -an, nn. the van or front of battle. 
Oct fnMb y BnvwUi atmlaa gjnaisa lln 

IJywvlya anlbflpcor. — Prj^fdd Bi/dviA : U.A.i.380. 
Aarflaidd, fleiddioid, fleiddiau, «m. wolf of bat- 
tle, war-wolf. 
AtnttUneid Tledoycdd Tleitiea kynamod. 

Cf-UtlK: UJt. i. S31 |<4. 214, na). 



Llya. ab Llynxlfm : M.A. i. SM. 
Hcb artod heb nn/sidd,— U^iiWrn Fanldi U.A. i. 366. 
AnnDg atr^fiaidd H'i mnyn. 
Al las tudd, ai bardd yw bya I 

avHMUTMBAan: Owaltli, I. IG. 
Aeiflnwdd, a. active in battle; nimble tor 
Blaught«r. 



Ctsddtln,: lAJi^ I. 114 (d. Ke, StOJ. 
Blaid ddrjCaml ainnavd Ammwythig. 

Ct«ddili»: M.A. LSOe. 

Aerfiawdd, tm. activity or impetuosity in battle ; 
battle-rage. 

AtrfiaxM IJocn llnoedd etfill. 

EliAirSai,: MJL.LMt. 
Nyi amdt atruUnpl fravt Fivino 
Nya geill aeii ni Uiteli u ttanuic. 

Prtdydd Budiaa: M.A. 1. 883 (of. Ml). 
Bh-wyg atrflmiidd UwgtBBwdd LldeKT-gad dtotyll. 

PrydyddHrtuaa: M.A.i.491. 
Owynn rwaed nairt atritlavc aerulelt auael lew. 

Ct<idilda: U.A. 1. XiS (d. 240). 

Aerfle, -on, «m. a field of battle or slaughter. 

Fiea y ndawc rod nann lunfa 
Ae haffWcid gyr J bui t 

Zlinmrt lAicUy .- M.A. i. 417. 

Aeifloddiad, -au, mt. a hastening in or to battle f 
Aer aet ty na tbaei a/r BUAnal.—Anairtii.- God. 416. 
Bftlr OHXvt natb hair air niodyai. 

OoTXinn Matldtne; A3. U. 108. 

Aerfor, -oedd, «m. a sea on which a battle or 
batUea are fought? 

Ehagor rting] ocr/or eirf ddonlaa UatlirfTwyflg. 

Gr. It ifsnd^.' n.A.i. 440. 
Aerfrftd, -au, am. treachery of battle. 
Dybiyd sioh brwydyr daer aer turfiad, 

Cynddtlw: U.A. I. 2£1. 
0th bfceist [of. birhaiot] mofniiat air/nd ajyoalB 
O Bonwy frwrdr Kyrehiad. 

Onffydd ai MsrtdyiU : W * I. 441. 

Aerfrau, a. breaking in battle. 

OwiTfl ofrvmi daduca nn dsohryn a hwnn 

Hooncld oyt y iBrtija.—CyfddtUB .- M.A. L US. 

Aerfraw, «n. the terror of battle. 

&weilch yo aetfrwydi Kweildi yn atrjraa. 

StitfU Brygardl: M.A. 1. >8» (d. SM). 
Gwnaatli--1aw aeruruw anrml Bryneaoh 
Biiwlan liw s bwl.— /Vjidj^u flj,cAa,i.' MA. 1. S90. 

Aerfre, -on, int. the hill of battle or 8laught«r. 

Bq trydar en ofnrt bu tan 

Bu ehut H wMwawr bu hnan,— Jneurui .- God. MS. 

Aerflrwyd, a. pierced in battle. 

Fy nghydymajtjj aeaawr eoi-faiAitb oeawr atrfriByd, 

Or. ah Hertdyild: U.A. L 44E. 
Aerfrwydr, -an, »/. a battle, conflict, or skii- 

Oweiloh yn aergrwydr g-waniji yn acr/roKdr ^weilch yn 
aerfniK.— S™^U5r,/mTJi; M.A. i. BS«. 

Aarfirwyago, v. to precipitate to battle. 
All yn duvyn, alon dwyagftW, 
With atrfiv^jgaw, Aruiur freiagedd- 

D. at EdrmI : 03.C. 106. 

Aer&yd, -au, tm. inclination to battle; dis- 
position to war. 
GwT belch y daryut dewr wryt Bedwyr 
Gwr bHilQh e nilwyr aryr arr/ryd. 

Bltddyn Fardd: M.A. i. 368. 

Aerfryd, n. battle-loving; on battle bent, 



Tl 



AEfiOtlK 



A«rfty«, am. the haste at hany of battU. 

Ovneattiaat atrurni Ryi R« nuRdn 
Onwdlwyd ■ ^ncdUrin ]fu erfitto. 

Mgv. Jrt*. L 418. 

Aerftur, -iau, tm. the wall or fortress of battle. 

Atnmriaitahiirhtrbjtaijtr.—Or'iibUl^: M^A.i.SM. 
Bhwft nstar aer/ur erfld brwydno. 

Or.abJtertd^i H.A. 1, MS (cf. MO). 
Dnmmnn-iirTBriraT jiryoli.— C««wd»»-' K.A. L «I. 
AerfnTW, a. nuhing into battle; dealing 



Blaughter or destruction. 



Owuw Mtrjicni ri , _. 

CfnddeUc: UJt, L m. 

Aarfyn, u. disposed to battle or fluting. 

Prt^tM Slrahu: ILA. 1. 880. 

Aerfiy*^, a. impetnoiu in batUe. 



Collein ByBooIlsd nrm ImIk 

Pkb lAjwOjn Ilew utAk 
Ovr mm punhei pudi dueM 



ponhfli paii^ di 
AD BUI iDtel mt mrwiao. — njfi^aa ajfcMCM: — * i_ ««. 

Aerfi^s^, -an, »m. impetuositj' of battle; a, 
hastening to the conflict. 

ir H flat drn. 
lAntBarti ai Linwafn .- H.A. L SS. 
Aeryad, -au, if. a Hlaughter; a battle; an en- 
counter; askirmiHh; aooiiflict; aflght. 
Tb aerffod yn ArgofA UwrfeiD. 

(W<<«>».' M.A. 1. tm [itf. Ml). 

Canmlfn: lt.A.LU8(i4. ue). 
Uidlairg: mtb frwrdi Mwddrf <»v«i. 

/srvMtfJHfd: Hjl, L SW (of. MS). 

Aer^wdd, goddion. goddaa, am. the rage or 
wrath of battle ; the terror of battle, 
Uadawo (nOlft oca allw^ iu>v«< ■ ■ ■ 
Colled ffwi anrgsi] ■nroM. 

0,r«lil^.' M.A. I. MS (rf. «7). 

Aergi, gwn, »m. battle-dog; dog of war. 

Eus l»Tn»wr cooli ifurmwr dOIUIWU 
uwjn a^ogjn ed taua^yn aetfwm, 

Aunrfa; Odd. IS (cf. ns). 

Am deym auOTni •urrtcn Uthjmr. 

fliililyi ftnM; If .A, i. 887 (of. 888). 

A«rglaia, a. bearing the marka of battle ; bat- 
tle-bruised. 

XtTfMM giwyt Twjl nt bOiMyi. 



Aergl&ia, ^eisiBu, rat. a battle mark or bruise. 
Aerglan, a. aotiTe in battle. 
Owri fdiijrsD atrgltm anlwrt. 

J^mrcA ol U^Hl^ .- If .A. L 186. 

AeJfleddJrf, I -™>«m- the Bword of battle. 

Atrgltid ndd evislsdd roddaw. 

tf . 44 C. ^ 7W.f .■ M-A. L «rr (of. 4M). 
Arrglrd)/ Blew digu.— Jf(v. .:1ns*. 1. tlO. 

Aerglwjrf, a. battle- wounded ; wounded in the 
conflict. 

Etyt aerglanf tiglwji Rfi 

Mfl^ Brjdt^: M.A. L STfl (of. 08). 
Tuft jia u^njd a»vliii)i/ set Decttrmir. 

OgiSiUm: ItJl. LMl (of. DM, STS). 

Aeiglwyf, -an, *n). a battle-wound. 



Aergol, -ion, «nt. the sting of battle. 

lUt rgqnic Drmet. 

A^al u gerdk.— IWmi./ A.B. B. W». 

1[ Qenerall]' considered a collective plural ; 
but in the preceding quotations, the only 
known instances of its oocorrenoe, the word 
does not ajq)eBr to require that aenae. 
Aergorf, gyrf, tm. the body or strengtli of 
battle ; a body of troops. 
J«-por/ toif Urij'ii Achtibj 



Aerggr/aretJtril'aaBaai—Dnffidt Card: lf.A.L<8B. 
Atrfftrf lorf LowrUitli vwutJi vvrthlonaJ. 

V^JfsM ofr iler^fdd: J1.A. i. 4fT. 

Awgrain, greiniau, tm. the wallowing of 
alao^ter ; proetration in battle. 
Urd vlodlg Unrig Uu awgrain 
Urdwi Daw diwynmwd Ownin 
Urdawl b«n prlmwdnen Prrdun 
llaljnnltli Atdmrd f*7tl> V djrrttln oad 
Tn irgTKl yn aergraut, 

CfTuldtitc: MA . LM7 (of. 1141. 
Tot™iu1> Tweln teynjet aergrtia 
TeiFniii* nirejn nnD Benlli. 

lAyv. ai LlgmUgti : ILA. L MS (cT. SW). 

Aergrau, »m. the gore of battle; blood shed in 
batUe. 

BtgTjTt^d'bidrMBinS!™ 

CgmUiht: If .A, L au (of. IH). 
Qwr nloD anuu ojrym «vi7d. 

AMdjn rartlS: H.A. L 888 (of. MB, tft). 

Aergre, -on, tm. the impulse of battle or 
alaugnt«r. — P. An obsciu« word. 
Ood lluT Ukw aerfrt 
Oed hIsh eilayd oed dinu u yatre 
PfU TTD doet perchrll (* enhyll] snds. 

Ll^i^di Sea : A3. U. we (cf. ILA. L 118). 

Aergraul&wn, a. cruel or fierce in battle. 

Airfratimim trft gnoled.— CfMuliKhiF.- ILA. i. US. 
Aergri, griau, tm. the ory or shout of battle. 
Eiaiyf aarari, wnigg ddTfrwi, 
P]rl>TT Tuu pawb AT imwutti. 

O^aaUiT McdIMin : QmUh, L aS. 

Aergrwydr, -au, tm. the scattering of battle. 

Tram arrgnoj/d^ vrwjAjT vrhr. 

Or. Hi Jlrrrdgdd: Tt.jL. s. iBI (of. MS, 880). 

Aergtyd, -au, tm. battle-tremor ; the dread of 

the conflict ; a trembling in battle. 

KodoRiTd blcit arrgrgd bl«s. 
KetwsfiiwkadMtoDi^.— C/wWsht: JCA-f-SlS. 

AwgTTf, a. strong or powerful in battle ; belli- 
poteuL 

Bnmidd atroTTif k ndd <nixmwa. 

OaJ^ddg Coat! ILA. L IBS. 

Aergiyn, a. battie-trembling ; causing tremor 
in the battle. 

""*"■•'"'"">"'" '~ffls,trri.». 

Hawt Hopcyn oerufn «aiffT«lr pwrllw. 

JferV ai Jwmr**.- M J.. I. BW. 

Aei^un, -iaid, tm. the <duef of the battle, a 
war-chief. 

Ygona aeraua ttrrjtnia. 

O^addalic: ILA. L lOT (tf . tU, MT). 
j4«rffKiiint< Unniofd oooh J honKTT. 

Ok>«ii Oi/WMv .- K.A. i. MS. 

Part woigotd diwo^oi-t diwn^sm 
Tfxi furouH odtffUD wvdvrrf tnrlu. 

Ovnfardd BrgtMiniar: ILA. L MB. 



AEBomt 
Aergtir, am. the toil of bftttle or war. 

Tndnr warw arrgur wiw a eujnr, 

G'. ab Xtrrdfii: M* . i. 4S7 (cf. Ml). 

^ Acrgwl, given in most modem diction&rica, 
IE a proper name, probably a modification 

of Hrreida. Arrywl gadarniech, Herculean 
strength [M.A . i. 227 ), An early Britiflh chief- 
tain of this name (Airgwl) is oommemoratod 
in ' Englynion Beddau Milwyr ' (A.B. ii, 33); 
and the Aergwl Llawbir of Dafydd Benfraa 
{^M.A. i. 319) may be either thia or the Grecian 
mythic hero. 

Oflt oAyw^ oet oemryD m» 
Oatt unturv f toryr urrnu. 

Fr^gdd Sgtlta:,: M.A. L &St. 

botr ixwl ul QraduwlimvriRTd. 

£■»« Off^jiad. {P.) 
Aergwya, -i, -au, </. the furrow of battle or 
slanghter. 
Dufi aergni/i Poayg poet eitr>ii. 

Utfod Otor.' U.A. i. 3U. 
DiydonyvjFiiwrTiuigedTiiideiUi.— (7|r>KM<'u.' ILA. US. 

Argyfrain, teinion, rm. the meeting of battle- 
spears; the mutual opposition of spears in 

Tm p«o dnis deninit oed oslain. 

Cr»M<I>: U-A. i. WT. 

AargTimnid, a. actively moving in battle f 

Arrgntii crndlid CynuelTD. 

JJ^. at UfHlys.' U.A. L aot. 
Aei^yrcli, a. marching to battle; assailing or 
assaoltiiig in the conlict. 



RKtt Oxh ai ShiaH : lolo M». 3U. 

Aergyrchu, v. to asUy forth or march to battle ; 
to attack. 
Uymnm lAaeitm raivr^jrrvAui. — HiUtpt: M.A. i. 414- 

Aerioath, -au, if. [acr 'i ; C. ertecK] heirship : a 
heritage; inheritance; hureditoment — ^^. ir. 
Aerlew, a. [glew] brave or hsroic in battle; 
intrepid in the conflict. 
Can Um IIW anle\t llBK nwy UochaL 

CfiMtli^ .• XJi. i. ZSO (of. SIS). 
LImT mt atrial Ueu MujA.—C^/mlMv : M.A. I. «B. 
Aerlud, a. [glnd] tenadoua, unflinching, or 
unyielding in battle. 

DradocHwIuTlewTnurlleit}!.— CymMiAr.' U.A. i.ll&. 
^A4wt ddnid ddngoD eifld lUd Lli 



Aerlladd, v. to kiU in battle. 



li MiTtdfdd: M.A. I. 



Corf oed enriloTf cad aerUadd. 

AerU&fii, 



Saii.ltJi.i.»l7. 

ab Jtrndfid: H.A. 1. ISO. 

I. the blade of battle; a wor- 



AerUafi, d^D finiaws talUrUu'. 



Abhon 

Aerllaith, eithiau, »m. the havoc of battle or 
slaughter ; death caused by war. 

LIfw anaw llau^ cuiUaw nrrOriiii. 

Cgxddrla: M.A. I. 21S. 

Aerllary, »m. a war-chief. 

Yor drydar arraary oerUAvr tt ffortho. 

Aerllew, -od. sin. the lion of battle ; one who 
a lion in the conflict. 

itrUeu, jdan enrUain ;1ed 



ArBl"ydKl'-. — — ,_ 
G]«drfal ffTDwyrun. 

Cytddtl^: M.A. i. BM 
Rqjac otrtlfv tiyleu yn treutna araou. 

Et oedd atrUw arUwybr Ad. 



[cf. 808, 2S&). 
Ml (rf. MS). 



Aerllid, n». the anger or isge of battle. 
AerbeiT bar bast eniid.— QinriilcIit'.' M.A. i. 22 

Aerlltn, i/. a line or race 



OodBMUewoiurKuigadiaith.— (V"*'''"' M-A. i. SIS. 
Aerllu, -oedd, (m. the army of battle, a battle- 
■■ "«t ; an army- 
raws Todavc arvavc eiryf batbrHm ruflii. 

Cartvidlin: M.A. i. 4i4. 

Aerlludd, -iau, em. the obstacle or hindrance 
of battle ; the stay of battle. 

A hil Bys ocWIui aerlllt byddin.— .tf jnMtn ; M.A. i. lae. 

AerllTW, -laid, -iau, im. the ruler of battle; a 
war-chief. 

Py uyt glyw aerttaw ar Uwrw taunawn. 

Cyp.4W.o; M.A. i. MS. 



Aemer, am. the lord or ruler of battle. 
Ddydbarohen. 

Aemerth, -oedd, an. the strength of battle; 
amiipotence. 

Uaa lonrertb aertterth ent neirld ■ idiu 
Ooh yrdav nyd odld t 

Ugvarci, all U^aelfa : H.A. i. 287. 

Aerog, a. connected with battle or war; war- 
like ; bellicose ; martial. 
Aerogion, warriors, men of war. 

A'i vraig ohll afmfuni.— Z>. at £Uniin!, 

DrudAwr briodawr, aryr BrJldain, 

D'wyiBirg llym a«rab>^ ILn minua.— (J'-cirir^ Otmia^ 114, 

Mwy dI ffrydia dnry ?i bata 

Na-I huUwyifB, el dwr llnfawr ; 

Oud ror-mUmo acraag len^au 

A'o slain arfau gloewon Hrfawr. 

/jMi. tfind Oeirimtdd: Gslr. «0. 

Aerol, a. relating to slaughter or battle ; war- 
ring; slaughtering; destructive. 

Hyll n-mwi arcboll husctb sydd inl. 

Dan veil Ayadliiteth.—Cnimii/: Oweith. 113. 
Aaron, t.p'. [C. aerati; Br. irin; O.Ir. n/runf] 
1. summer fruits, such as apples, pears, plums, 
nuts, &c. 

Atwyn iTDit yn amser kyriha«af . — Ta'itsin: A.B. 11.117. 

Afallen benn blborig 

Helyu fli haeron old macin el meaalff. 

Mgrddia: H.A. 1. 161 (cf. IM). 

Ooreu aeron, afalao. — Mip/r Arch. lii. 42. 

Addfed oedd yd an mnn.— ffniyn Oimh. 

A'r neum a chirennycbodd dy enald, a aetbant ymaltb 
oddl irrtJiyt.— n«d. xtUI. 14. 

Owir nvdlniald a gSnt fwynhaD hytrydTcb paradwye, 
kI cmib'iuat.—riuiTtn EitKnril'.- ifan. y FfyJdT KM. 



Aekoni 7 

Mit yr a«ron, the fruit montli ; an old n&me 
for September (ct. Frurfiifor of the French 
Republican Calfindai).-~Bar<Ulat, i. 414. 

2. fruits and herbs that are oaten raw as salad. 
mcb as onions, radish, lettuce, and the lilco. 

3. the berries of some trees and shrubs. 
Aeroa mieri Mair, the berries of the dogroeo, 

Aavn gwin, the fruit of tho vine ; grapes. 

Blued AT lecfa vyw enrAid wlith, 

Atrat iwi*. nes nwa gmaiib.—Rliiii Tm. 

Atron lAtwurydd, oLves, olive-fruit. 

A ddichyn j pren ttaffrt, f y mrodyT, ddwyq olifKjd f *<il0w- 

IFnryth, aertm oUwwifCtd'/.—Etg. S. Daviu: logo ill. 13. 

4. fruit (in general). 

8yl»Bt prany faj\ nfon, 



Aeron y ddaiar, potatoes. — W. 
% It fonos the names of some rivere, of which 
the Aenm in Cardiganshire la the only one in 
Wales now known by this appellation. Cf, 
Qod. 196, 232; M.A. i. 73. 209, 220, 261, 271, 
296, 412, 413. 

It is also a woman's name, more usuaUy 
written EuTon. 

Nitb yr hul, ni tbimi hoo, 

NI tboraii i oitli K-roi..— ^. ah G>Mf-^, e&t. 34. 

In some cases the word may be a plural of 
atr (=actau), battle : cf. M.A. i. 5T, 58. 
Aaroni, v. to put forth fruit ; t« bear fruit. 

Coed y tma xn aeroni 

Td tibtr ja d'uuer 3i.—BtJB BnoynJItri, i'r BaI. 

Aeronwydd {tg. -en, /.), t.pi. fruit-trees. 

Ffnrjlh unniiijHM DlphyTthyrauid.— //uw Da/iid. 

.4mraie»ddBl»rg»m»gjrchwirdo'tEidal, gan SttHutI 
V'oUoD.dngy BreiiiiifiuTliU7l>Dtsr. . . PBOddaetbT 
Pieninefl Aon i arwedd coron j deyroAO. hi • ffyflwynadd 
jTT acrmtci^dA hyn i'r Aiglwrdd UMDad, o F&rgun. 

Aerroin, i,cl. battle-lances F 

GkId yn ow roin [nmnuii] 
Oinrr yn meiYnin yn enrydiaw. 

SrUfU flry/WiT*: M.A. I. 88». 

Aeru, e. to contend in battle ; to battle, to 
fight ; to wage war. 

Atr H furel] enwy ei ufui a PTniDC 

Mag""!- U.A. i. 160. 

JmuliDVSUrildHf.— Or. dt Jfrr^InU; U.A. i. (49. 

Aerwalch, weilch, m. the hawk of battle. 



rb urwymp dryd^r. 

ilcddya yardd: M.A.i..'MB{r 

Mfctoenielygolil. 

? m!a. 1. 9Ut (ct. SI 



S*_'S?!P°J 






J. a. Gciria«,dd: Gdr. 1 
A«rwan, a. opening the battle. 
luivi yn arrvan yn enrwBith. 

Cs-IM-.- M.A. I. SI2 [cf. 31 



A«rwaa, weis, weision, tm. a young warrior ; 
a warlike youth. 

0«dd bann nwr mm ben nrtimn 

rAugaliiaiurv.ueannD.~El^dirSaU.- U.A.I.SU. 
Aerwawr, <m. the hero of battle. 

Eurwalch balcbbolchyduyui.— LViuf^'c'v.' ICA.LStf. 
THit wyf DLun^lirTf nwire 

bV. at M-rti,iU.- U.A. i. MI (ct' MS). 

Aerwib, -iau, a/, the course or range of battle. 

~P. 
A«rwib, a. darting through the battle. — P. 
A«rwibio, v. to dart or range through the battle. 

Arncibim, bnthent ym mhob rMthl&d. 

GkMUt JfecAon : Omttb. L SI. 

Aerwoagryn, -ion, tm. the shaker of battle; 
one who causes the foe to tremble. 
Auch rotef umvd Arrvcvdr^H Bowys. 

CgnMrlte: 1I.A. 1. MS. 
Haq bwynt TT wrv/otgrgnim^ dfiinion synt, 
CuBuiud lUmTain fe plienaetitiaa Qroeg, 
H™ ytnniHt byd 1— Avo TWatmj. 

AerWT, wyr, *m. a warrior. 

Uysn peMdnd piudlid pnadlui 
UyaTs-M.-wirbryrbren — ' -"-- 



Pymbcd wely^ort 



pymhsdnn ( 



.' A.B. IL 4 [cf. 900). 



Atotyawn crenliwn no cwmliBB. 

CrttAMit: M.A. I. 38S. 
Arf Urf t«rfyn chuwrwydd 
Amur oran pci cuuulwyild.— Enisit W** .- U JL L IBS. 



Ome bybyr atrmr oanredd eo dmne. 

U^^ IIbcM : ILA- 1. fin. 
Bbag gonawwyr, div axncj/r ^drwvn. 

Dam Wgi: Bl. Alf. 39 [Bf. H, OS). 
Dy oemyr dswi-rryd ens, 
Dy nur prid, a*th nn dor prva, 

/. a. O^TinKfH: <Mr. W. 
Aerwrifteth, -au, «/. the profession of arms; 
soldiership. 

»nri »>>.-' Bl. Arf. IT [ct. «). 
Aerwy, -on, -au, fm. [aer-f rhwy] 1. a battle- 
torques ; a collar or chain worn by warriors 
as a badge of distinction ; acollar; aband. 

BalUitBcin kyffwng jmyDcrwfj.— JWfsriii.- A.B. IBt. 
EirgflteryrmcTgntarrwy.— ffAiKTrf^n: 1C.A.1-43S. 
O radan kttJi mur ydyn\ 
Armtan teg u lad d»n. 

D. nj (i'Mym, livlU. 3 (cf. zxiv. lOi clxEd*. M|. 



Gwyl Fair y cair, u y «id, 

™r iHrwy ^ ^.^ ^_^^ ^^^ ^^^ ^ ^^^ ^^ ^ ^^^ 

Yw bwn o'r Dytlwn « doid.— Ai/VM at G«n«u. 
Z. an armlet, a bracelet. 

Anuwy an onv^ y ^wid bnhdiTwy yn noapaitli y Rml 

Tri olmir cylCredin y lydd ; vwiig : bryiyil ; ac nnvw. 
/obi Mh. 317. 

3. a lie or band, especially such as is used to 
fasten cows to the post ; a cow-house tie. 

Avno^ bumth, a cow-tie ; a cow-house yoke. 

Aeruiy a/n buuich, a cow-tie before a oow (al- 
luding to a premature act). — Diareb. (M.A. ii. 
146.) 



jM.v^.(,K»t;ie 



Ydd wyf fD ardoDiaw i'r ddwy 

Wrth TT awrn, arth ry-wych, 

Yritmr, WocrKjrTrdl.-(?«*y« Oioain.- O.B.C.W*. 

A1 mwn mal ivrwy numb Hulorlg. 

/■ilH LlK^: H.A. i. BBS (id. U7). 
Aerwy yr ytgmydd, the ooUar-bone or dwricle. 
— Ci/ertioff, 
4. a ring, band, or bandlet (in arohitaoture). — 

Uanovtr Ml. 
Aerwyad, -au, tm. a putting on or investing 

with a torqnes, collar, or wreath. 
AerwyU, -on, in*, the fiend of battle or war. 

Omedlfd r lein gmmjai leuTll Iwnr 
Omsw aarfur* vwui «rH>U. 

C^KiMif: U.A. I. IM. 
Afirwymp, a. smart or dashing in battle. 
Ear ur nil penrtwlth aervifvai trmp pobtaith. 

Offf, at, JlirtSyiU : M.A. 1. MJ. 

Aenryo, i\ to put a collar on ; to invest with 
a collar or torquea ; to wear a collar, band, 

Aerwyog, a. wearing a torques, band, or collar ; 

collared. 
Aerwyol, a. rdating to a torquea or hand; 

like a collar. 
Aorwywr, wyr, am. a collar-maker; a maker 

of iMttle-collars. 
Aery^-wn, a. towering in battle. 






Aaa, -aa, -av 



,—BliMgn Fardd: XJi. L 070. 

I, «/■ 1. a flat, plane, or super- 



la.—Dlarll: (U.A. HL 1< 



!Krtid-o.- M.A. 

.' H.A. i. aoi 



Namyn iBWiidcir ni em 
2. ft shield, a fancUer 
Garw rrt nc nsD 

IlBCit rii rgkyiiDar e<a jg cm 
Blu« MudwT Un ■ woleia 
Abhmwt briwhed torrhid ris. 

A llDoet jgpil a DDaetaoc iu« 
A lli»in dllaefl at* uvethrairc. 

i,I{w, at lA^vnl^ ! K.A. f . SUk 
Hot dnm fu len mm aea digvrdd. 

tlafs^Bf/ni! M.A. ' ~" 
Tma ou gTDin Tn^ryd Tywi Tptikd. 

Ot^vc TBJtduwc Tpirch 

Aet TiUrfillw rut mrvriw rwyu. 

Prsdadd Btcha-: H-A.i.SSa. 

A tadd gmwr, Ijwjdd gwrtA. 



^iduniBll oeddyot I 



ddynt o'r rbyletwjt dewr*', 
r, b-it^kuiiu] d«dd m bvm. 



3. a wing ; a bird. 

Gan at chwmi TM DitUm awTT btw. 

If. O. Hif*<- <^-0' ''' 1*^ l*^- >• AM; i' 

4. a cliff, a predjnce. — P. 
Aes&r, ) tm. a defender, preserver, < 
AeMtr, i one of the divine names. 



rprotectoi 



I>IIW< 






', orion, #/. 1. a shield, target, or hncfcler. 

dellt unbellt [al. mm beUt} m mdmva. 



Maaide 

Mml tarui sem Uihei iciijrUiir.— .I.f . ii. 104.) 
.4sHvr yn uflllt ■. U&vyD Tg-iullt dri q bekur. 

2'nlfana ,' M.A. L 11 (of. SI, H. 81 
Drd th Tatrmd ti«in[>r dnuli&w. 

Ch-«Mi«iai: M.A. L 11 
"^ei eu dwT netavr dmn on yAtrr. 

Oimm CgfciUag: M.A. I. 2t 
IJyv yneyu Bynnuynuwr ribyt 
Uiwgoeh y Uromwr o^ookt luwyt. 

£<V^ <;>«-.• M.A. i.M 
For eisaor oetvitDr weiufuyad. 

ufv. oA Ltsrujetgn r M.A. i. VI 



OwT flurKlmm aettavr ynwyt IboUJ. 

^riHiI JM .It Ortfri: M.A. I. raa. 

aiinyl Um, yr bmal «Miiiir, 

Uvch rhod haolven folen fawr. — laian RtUtd, i*r Nef . 

. one hearing a target, or armed with a shield. 
% So Daviea. Th. Richards, and Fnghe: hnt 
in some thirty examples, found in eighteen 
difForent writers, from the Oododin to the 
dose of the 14th oentuiy, I can find no in- 
stanoe in which aetawr clearly appears to sig- 
nify a shield-bearer or target«er. In some, 
pOBsibljiLn several, otthesepassages, it maybe 
intended (as probably in some ot ttie proceing 
eib^cts) tor the pi. oi aa; as is evidently the 
case in the following moder 
GurolioB mnpiu ieaalnt nef gTrsrSynl 
H eb amdayat eirf , ODd rarfle nwrfre on 

" — " enoriun, o.- ' "- 

--'-' iry" = 

). Paglu: C.U. 
Ntek mt bimd 
CalMtiml mrmoury, lUsldm, lutna, ud apemn 
Hong high.— AiniJiH LtM, iT. eta. 
Neu hanou camplmD, rbedioo. nea 
Dno ymwHO, aaawr mrwymp, mivrmiff dtttl. 

W. O. Paglx: C.a. ix.aOfof. rt.B71). 
Bhwyatrmr [dymnnmf dm I'm faoimid) 
A grym naawr gyich y gormniHid. 

OaaUUr tltthat«: Gwnlth,!. *. 

Bo far as the gender is indicated, it is feminine. 
See the preceding quotation from Owain Cyf- 

Aeabar, -ou. iin. a lance to shiver a shield or 

Gwayw ddor bar aetbar wpyd locht 

Gr. ai XendfM: 1S..A.. i. Me. 

Aeadalch, pi. deilch, deilchion, a. having a 
broken target, broken-shielded. 

^°" Dafydd^ C«rfffA.i.4BS. 

Aeadalch, dylcb, «/.=.4>{a/cA. 
Aeadrai, a. having a shield or target that is 
diminished or hr^en; broken-shiSded. 
aiew defawd glyv « 



Buithyatou 



Aeadrawd, drodion, im. a march under cover 
of shields ; a shielded march, 
kyrt kortoTyoD waogaird 
glyw gloyw yitryw ufMiniod 
at oad kynhxad kynhynawd. 

Ortida<B: M.A. i. 23S. 

Aesdrwch, m. j a. having a broken or shivered 
Aeadroch, /. ) shield. 

Oet pa^^och yn ottiTodt drom 

Oet glen lew o liryth y Cam. 

PryiiM B^diai,: H.A. I. S88. 

Aeadrwm, m. ) a. bearing a heavy shield or 
Aetdrom, /. f target. 

Ma»dntnrt(™i"™itxDoh.— /Vjidirdd Jjctan.- M.A.1.38C. 



A«adwii, Tn. ) a, broken-Bhielded ; having a 
Aaadon, /. j broken target. 
Att gjngrwn yiigwD owJmi eisdor. 

Cg-idiUlicj Mol. i. S06 (cf, 1 
Aeaddnr, a. having a steel target or ahicld 
DychrmTBc aiilTytc jnaryHfaentur 
Ae ^led^r OuDdur aj glut dyre. 

7^jiw. ab lAyv)tl^; M,A. i. ,.,^ 
Aeadd7ii,-ion,(m. ashield-bearer; one bearing 

a tarf^t.—P. 
AeMl, un. fO.E. «i«i7, «"»«/, «»i7, ainlle. ateUe, 
f«ille ; A.8. aiail ; from L. arfdim] vinegar, 
verjuice ; anything bout. 
Mar tf yn af»rl pnrud, it is quite vinegar. — 

IVf enllyn «*«h7d : dg; cwrw; 



(^Tniper hen Luti 



- ."MSir™"""' "•""'" 

Uoidsi/on J/jrfJ/rri, fi. 37!l (cf, H, IBO, IBft). 

A«*erw, -ftu, */, a boanl or plank ; a flat body i 

also written aeerui, q. v. 
AMemr, j a. fair, bright, splendid. — L/eun 
Aeaerf, ( Oioaeary. 
Aeafa, faoedd, feydd, »/■ a place of protection 

or defence ; a refuge. 

Hddden di'n ppchod o bob rhpr, 

Ti ydyw'n Duw a'a hari/a.—Da/sdd Benvsn. 

Aeofrau, a. having a brittle target; brittle 
abielded. 

Gorllei^beiBi «Biaii 

Aesfriw, a. broken-ahielded. 
Oeauyrt dy alon <uturiw V»red 



ng-liiild Bsch, 



\.\.!l 



lTg.ls,M Bs'h«<,: M.A.I 

Aeigalch, »m. defensive armour; hamosa. 
Tmt yn nrii/nkh twm rapud. 

Llnwrlgn OrKh.- M.A.I. 688. 

A«Bgar, a. fond of the shield; delighted with 
armour or with arms, 
Ajwwt ulairt antdgwt an^lod 

OyiumjBWK W.nnudur, -c'j(n*fclip.> M.A. i. M4. 
Pughe renders it ' swreadiug,' and clod wnagar 
atsgar, ' wide-spreoding faiue. ' 
Aesgiir, a. inurod to the toil of the shield ; ae- 
cuBtomed to the toil of war. 
YBKor kor Cylnry diffreit j-Bt 
Aaigar vti Arthur Elttiyrt ladyat. 

bl'-ldgi, FanM ; M.A, i. 988. 

A«Boa, -BU, ». a shield, a buckler. 



Aesw&n, i 



. shield-picreing. 
Brtsn ^™-.;, .mvrt. 
lel urWBwr ur liawl orB) 



A«th, p/. aith, aethion, am. 1. [Ir. uutAlapoint. 
apriokle. 2. s.cL furze, goTse.— Hugh Davie» .■ 
Welsh Bot. 60, 1 J3, 

Prauu ncxlwyddau I'm dtddwyn, 

Penfar o mli, pwa u frwyn.~i. i;, Colin, i'r Fiirf. 
Aeth, -an, am. [Ir, aniA] pain ; sorrow ; grief ; 
horror; a shock, thrill, or sensation produced 
by the sight or contemplation of something 
painful or horrid, 

Y DUO yn nru gui ty n jbalon gljTred nen welcd hyny. 
.J«»«eth-seithbri»nyd.— CMMiljm.- M.A. i. «r. 
Mawr «<(* i fll a wBiirth MartJa fain ; 
A phub HJiobairh, h pbawb yn uhajo. 

'■S. /),.y;,jj M,r,.ii,.id, Cyfr. y Boiidd, Iftg, 



Od 



Ac er tiymioa tygjthioa, tc a-riliau. 
Hawr rei hynod o jmrjmmiM. 

1. a. aarioHfiU: Gar.S7. 
uin damn cofladwrurrtb 

Agor ol id ^ftCTKU aelA.^Cawnta/.- QwdUk. ISO. 
Yn Dgwyneb muAas oi uwbeithlodd. 

Bba, Fardd: Oncith. 101. 

Aeth, in. [C. rtA; Br. g<i, tax; Ir. M/fta, n(l 
3rd pers. sing. ptet. of the unused or inferred 
infinitive flu (to go) : went, is gone (L. iiiY). 
Owyrti ludit OsCnMh gm nwr. 

.:<iin.rin .- God. St, 90, IW. 
.:1H* cu-iad t'm lUd o'm llav, 
A golld yw ei fofliif.— O. ali (fujilj;", ooliil. Sfi. 
Pab on a ivi*. pawb yn wtr. 
Arei ddiwcdd, i'r ddiur,— IfUian Uryn. 
rhydedd ein ipv1pddo«ld, 
ef; hiel s daetb oedd. 

G.lyii Obwi,.- O.B.C. l«. 
^FiA ty nholyn hefyd yn Al&r. — lob xxx. 31. 
Dy uiu ■ ihM yn golluch.— £h. i, iS. 
Athnv frwif 'i''^ i'r ^cryd, 
A wiui't getdd yn ikur i ffyd, 

//mw Manu: Eoa Cdjioff, i. 33. 

A«th&, feydd, «/. a place of horrors or tor- 
ments, a horrid place ; torment, horror. 
Diwmod otutdwr ami, er aerh/fi, 

Pu'r wytbfed o Feai.— niiDgmoii, ii. IH. 

Aetidawu, a. full of pain, grief, or horror; 
poignant; painful. 

Dyn ivift(n,CTi du, i npBOUwm, 

Heb iach drFf, I Uuch tTwm.—Cinrnbi/: OireiUi. lit. 
A«tlLlyd,a. poignant, pungent; painfol; shock- 
ing. 

O 8odom wtbtj/d devch ym mlsai. 



Aethnea, «/. [contr. of n^hi/aen (or some such 
form), aeth probably referring to the trembling 
of the leaves : also called cri/*irtAnMi] the aspen 
tree or trembling poplar (Popidus tremula). 

Aethitfii iceii, great white poplar, abelc tree 
{Popu!u» a!ba). 

Afthntn Jwyd, grey poplar, common white 
poplar (/"opiiiiHi cunartni). 

Arthnen ddu, black p™lar {Pupvitu nigra). — 
Jiugh Dai-ifs .■ Welsh Bot, 94, 93. 



Crynedia i'm cpom ydwyt, 
C^Tifa deijen nitlmn wft.—In 
Tw'n olwyn a enaylir ; 



» /I, / /yiU Hir, V- 



A thynu'n hwn aeiiinii ir, Kglariti Fjntnhii 
LUwcn aalinri, o'i gwyn-ddail.— Jfyc. A 
Crynu Ie\ dajl yr oclAgn,- /)iarc6. (5. (f 



FaJ ddlen w'Ann gan wynt. — /. G. Ghrumyid: Gw.SB. 
A«Uiol, a. poignant; painful; smarting; horrific 
Aethrwyn, »m. writhing pain. 

lir M8 or tawl art*™-- uthiswl. 

aVJ<« i^'^yi J/am™; Cyfr. y Belrtd, 80. 



jgle 



AETHUfiRWtDD 7 

Ac yn ol T mmKnelifcu 
Hhuthrai dynion ^w^Udoa f^u, 

T tnrydr flymig, hjrlllg hon,— IVM- Omitll, 114. 
Aethiurwydd, «m. poignanoy i hairiduMa ; 

hideoaeness. 
Aeth-wellt, *tn. andj.cl. lattenosth, lattergTSSs: 
the eume as adtadd and adioellt. Davies gives 
it as s Demetian t«rm ; but it is not now in 
coDuuon use in that province. 
Aethwlad, -on, tm. [with atth -it. Jr. aith or 
alh, as in nif A-rioghium. nt/i-laoch] abaniahed 
or exiled person ; an exile ; an outlaw. 
Tun- ciHT K»*ttn y nydd: bod yn «*id™ililea; tor 
uUwd: a denl yn arMici.id, gtm irsedd n cbyreb gvikd ■ 
AjHmi.—'-S/r-Wiiaii Cyntrii, U. 486. 

Aothwlad, a. bauished. exiled, expatriated. 

Pui nad oedd nn y veddv dlavd, yr hoD a ddtibyn- 
■odd ndrlfld [*n'fticlai(. Hiul! bropUwya Dun, EHm, onid 
dyn^ D fiiird iHwn cM,~£dta. /ai»».' Horn. iii. 11. 

Aetbwladaeth, -au, ■/. banishment, exOement. 

Cydadl Bin la 

nTwdig ynddo. 



•ySd IT yn (twyinp i'l' tyd, J 
m acboK o bob dry^ionJ.— Kilij 



^frd am fod dlffyff cariad ya imtd- 
- *— * — --^tpii*wrt liiinwedd, mc 



a banishing ; expatria- 
Aeth-vladu, t-. to banish, exile, or expatriate. 

At ol i Hyvel artMirfiidii ci evytbr logo, oyiiiiiier.ii [cym- 
mnodd!^ y llywodiBPth btthj Hi him. — Cnradog. {F.) 

Aethwleidiad, iaid, sm. a banished person, an 

AethwyddC^. -ea,/.), e.pl. [see .^e(Anen] aspen 
trees; aapea vooa (Populaa iremula). 

Qtn hi daa yr inrttioydd.— ZKnrti. 
Ar dnion hwy a'u daliant muwa msglati, p« nu a vneir 
obridaaaiUmfdd.— r Gr'al.aea. 

Aewel, -ion, »m. [for addwe! ? d. a^ed, aefioyn, 
for add/ed, add/ivun] a sign, token, or omen : 
the same as Argoel. 
Hi wclaiaj un a«u«V daioni vno.^&hnitf, 
Aewyllt, o. [gwyllt] vnid.—O.V. 
Af-, px. r=am- =an-, q.v. l Ir. amh, aimh : cf. 
ZeuBS, G.C. 893] a negative or privative prefix, 
governing the soft sound, used before I and 
r, and in a few words before n and the semi- 
consonant 1. In afdrwytk (trwyth) it stands 
before d. 
Afach, -aa, nn. [bach} a grapple, hold, or hook. 
Afod, »m. [coiT. of a/uaif] livergreen {Mar- 

f.}ianlia).^Hu^h Daviea : Welsh Sot. lo3. 
A&d, *tn. [?] 

Fleimyod gr^A Btyd lofrat 
Brw y acoiiflrfQ fad oet gauthDt 
Brwydyra ehrwydyr a chiyd arnadut. 

CyMdw: U,A. i. SSB. 
A&eth, -an, on. pleasure; blandishment; in- 
dulgeikce ; pleasant and gentle language : the 
same as Afiarlh and Afiaith. 
Mil yr a/aeth, the honey -moon. 
AM [?]. 

Afagddu, »/. darkness; the place or seat of 
duknesB ; hell : usually written t/ fagddv., 
q.v. ; but the former is probably the more 
correct form. Cf. afory and the modem 



y fory. Also a man's name (nn.J; Ceridwenis 
reput«d to have had a son so called : see ^.^. 
i 34, 66,72; .<1.S. ii. 168. 

Athrti 
Alhaidu, ddyfoai lyndyn. dobya B. 

/. h. Ffraid: CoU Owynfft, i. a». 
AAun, i.pl. high places; heights. — P. In C. 
avain signifies an image (frcon L. imaginrm : 
cf. Zeusa. Q.C. 1072). 
BaadHb onlwyd net gytl«l nfein 
Amyn rwnel yn vrovyr nrwyr Owda. 

ToUhIm: A.B. 11. 170. 
Bydian budd i t«dydd I /a« [afain !] 

Srii^a Brtff^cTch : U.A. 1. S8S. 
Impyn o*\ wraiddyn a red byd a/ain 

OdyaadiJrthd.— 0«>ii(Krlf«Jiohi.- Owailli, LKM. 

Afti.iTi^ a, fmaint, y faint PI jriimilftr ; like ; as. 



such as. 

Afain a wtltetk, as you see,— 
Afei«, im. [from L. avia'\ e 



-Bliunau Owent. 
1 bird : given by 
Davies on the authority of Wiliam Lleyn; 
but where it occurs, if it does occur at aU, I 
know not. 
ACEiith,eithiau,*ni.aneigbbour;akiDsmaii. — P. 
Afititli, eithiau, rm.^A/ofth, AJiafth, Afiaith. 
Ofld dym yb beiyra hacan dalaJth 
" diwed yi bo m- — -"— ■■ 



y dif>fjn y wn gymaint ei n/nirt 
Y 'ngaleud« niDt y' neoleadaith 
T ^n^leuad lad rydid perfaJtli. 



'CyvU^v: H-A. I, MS (US, 148). 
IJaaiiT TBitli aixiih a mrtDydaf . 

Ll^. ab Ufwtlyi: ■a^.i.WS. 

Afal, -au, «m. [G. aval; Br. aval; Ir. aAhal, 
ubhal; Qa. abhal ; Mx. ooyl ; L. malum; Qt. 
p^Xw] 1. an apple. 

Ac Ovdu yn kadv yr ol y ymllt y maroham a FanoMBai 
yr oxolo yn Uy> Aiibnr.—HabimB^. i. SS7. 
Blodau cyn afalaii-tjii.—B. D. ab letan. 
Nlcheira/Upararbnnnr.— /«lg JTm.MT. - 
Ceir pfeled afaJaa ar gangan per goed,— Donisl Ddn, \m. 

A/al Adda. 1 (1) black briony, lady's seal (Ta- 
Afai Adda/, j mua annmunil).—Httgh Davit*: 

Welsh Bot. 94, 153. 
(2) Adam's apple, the prominent part of the 



A/al A. 



.lied. 



Anna's apple ; a fine golden- 
apple ; hence also colled A/al 
yraur.-I.M. 
Ni bu ar wf dd, yn ber ioch, 
A/al Juno felynaph.- 7>a/JliW Sammar: G.B.C. 1S7. 

A/al yr arlwyddtt, lady apple. — /. M. 
A/al Arthur, the drummer?— 7. M. 

iJSS.Aim-^"'— ■>■"•■ 

Dan n/nt liar dltal Inn.— A. ab Omlfn, till. as. 
Heffya t^nlau aur mevn gwaitb ailaa ceifledig. 

Tri tli*r mewn traelli uian. 
Tricolour, tytfalln.—tlmnidrn. 

(2} an orange^^/ol euraid. 

A/al yr a«.r=A/al Anna. 

A/al Avmt, St. James's apple. — /. 31, 

Fy nnwles belt, Fanm ber, 
4fal Ami o feluader,— C at S»fl|nB, slix. ». 
A/al Awil gtoyn, summer pomeroy. — /. M. 



jgle 



Afid y hatiai, Bernard apple^^/'*' Btmard.- 



Afal y Berwyti, the cloudberiTf or dewberry 
{Ruhua ChamatmOTiu) : also called the Barwyn 



mulberry. 
A/al y boten. pudding apple ; a large -fine fruit, 

eaid to be peculiar to Glomorgan.^/. M. 
Afal y brenin, royal apple, pomeroy, pomeroyal. 

—W. 
A/al y frrenin, the yellow pomeroy. — /, M. 
A/al bn'lh F/raiw., red calville.— /, M. 
A/al brith y Dyffryn, backamore.— /. M. 
A/al brith y gwenun, a large, sweet, flattish, 

red-streaked apple, oommos in Glamorgan 

and Devon. — 7. M. 
A/al brifhog, the Bour-Bop.— /. M. 
A/al cadw, a keeping apple ; a winter apple. 
A/ol ni eketdw, an apple that will not keep ; 

an apple soon rotten. 
A/al colon garrtg, a very hard apple, good for 

nothing until kept for a year. — I. M. 
A/al can y gaua/, the broadling.—/. M. 
A/al y cater, monstroua rennet, — /. M, 
A/al adenog, the quince. 
A/al cibog, pomegranate. — Llanover M». 
A/al daw, the clove apple, or apioe apple. — /. M. 

AM ^/ain"' 1 ^''^<* long-stem.—/. M. 
A/al coahir y gaua/, French long-stem. — /. JH. 
A/al cTOCTi hjach, the leatherooat. — Ceredigion. 
A/al tynnar, an early apple ; a summer ap^e. 
A/al chweno, colocynth, bitter apple. 
A/al daiar, I birthwort {Arittolochiaj : also 
A/al y ddaiar, j called agorlly* and hatUydan. 
—HughDavim: Welsh Bot. 133, 153. 
A/al y deru), the oak-apple, the oak-leaf gall 
A/al Deuri, St. David's apple, a fine, biisk- 
navoured, flattieb, and t«d-Btre^ed apple 
that keeps long. — /. M. 
A/aX diweddar, a late apple ; a winter apple. 
A/al drdniog, thorn-apple IDatura): also 
called ineitoya.—IIiigh David : Welsh Bot. 23, 
lfi3. 
A/id Etihah. an early, white, flat sonuner 
apple.—/. M. 
A/fd earaid, \ an orange (Ci'fru* av,Taiitimn). — 
A/al aur, j Ifugk Davit* : Welsh Bot. 186. 

T mu'i vlkd yn cynnytebu BrnytliBn ijMgoroI, M 711 
ikoDldnol a/fUau airaid A gntwowia^ — Cykhffravn, il. ISB. 
AJid euTon, (1) the orange. 
I sylwJ twf cfa llysiaD plydd, nc M 
Blodeiu Ivrn a/al^u mrcm, modd 
Y mers noddian gvj^ld ■ merfais gami. 

W. O.Fvake: C.Q. t.M. 
UaIwid auTuitiwi], a/ai fvriM, euronen, euibwcop. 

M«U)fBn Mfddfai, MSlcf. Ml). 

(2) golden pippin. — /. M. 

Afal Ewiat, a good dder apple. — 7. M. 



A/al y MA, a fine, sharp, juicy eating apple. 



5."/ 



A/al gaua/, a winter apple. 
A/al OeinwT, fox- whelps. 

T gin m gsd gui y gwt 

ni ffWia a a/at <Mn>ir.— /nua Da'r Bilmi : O.B.C. ISt. 

A/al glan y mSr, \ a fine white suhuim 
(holtdd y /oruiyn, j apple. — /, M. 
A/al gronynog, a pomegranate. — P. 
Afal Qwatgwyn, Qasgony apple, the quinoe- 
Afcd gurraig y fy, good housewife ; in som 
places the codling, in others the broadling.— 



Walierl, i 

A/al gwyn F/rainc, white calville.^/. Jf. 
A/id gvn/n hydre/, autumn blanchet. — /. Jf. 
A/al Owdyr, 1 transparent apple : also called. 
Afal yr havl, ] twyll Efa.—I. M. 
Afal haf, a summer apple. 
A/al hdyg, the bitter sweeting. — Pughe, a.v. 
Afalyr htn lor, a fine, teitder eating apple. — 

A/al ^ tarll, a large apple of a brisk flavour, 
ripe m September, of a pippin form. — /. Jf. 

Afal Icstyn > 

Addfed yw y dyngfid yD\ 

01 Amt u a/ai imsi.—Oml^m Trw. 

A/al lUtyd, a fine autumn apple. — I. It. 

A/al y llaelh, codling (used with milk).—/. Jf. 

Afal llvryd y cum, a kind of winter apple.— 
Ceredigion. 

Afal Madog, Bummer pearmain. — /. M. 

Afal Mair, Mary apjje: also called brith bach 
Hywel.—I. M. 

Afal y marckog, the nonpareil. 

yfii^rSSi. iso.d„™.,-,..,f. 

Afal iiarged, Magdalene apple. — /. M. 
Afal Martin 1—1. M. 

Afal mawr y dyffryn, a fine large apple. — /. !£, 
A/al maxor Wndii [from the parish of Wndy 

or Ow^ndy in MonmouthBhire], a fine large 

apple m Owent.^-/. M. 
A/al mtlynhir, "llwaoniCitnu mediea). — Htigh 
A/al melyn hir, | Davitt : Welsh Bot. 153. 
A/(U minamyri, the jenneting. 
A/al modryb Ann, John ap[je. — /. M. 
AfalNonf—I.M. 

A/aloraiU, i „„ ,„ 

A/alorai«i, j "»=■»«««■ 

Pull-uromiffiil eraiu.-IWyii SaKmur: Q.B.C. IW. 

A/al Paradtoyt, pome-paradise, John apple- 



Afal per, a cnltiYatod aj^le (as distinguished 
nom a orab) ; a sweet apple. 

itflMMu irttnVtttfn.—Ci/rimathyadnU, %. 



„C(.)t)i^lc 



Afal 

Afal per Mai, the Jime-eatdiig apple. 
A/alpi<i y goUnnea, the pigeon's bill. 
A/al pomgranad, a pomegrauat«. 

T nue yr a/at voKt^raiuid jm in. h&rdd, ■ riui jn iKwr- 

Afal pryd y gwT, the cat-head. 

AftU Bhobin, smnmer blsnchet.— /. M. 

Afal SeUyltt, an excellent and very delidoiu 
early suuuner apple. — /. M. 

Afal sur {pi. afalaa snrion), a crab, a crab 
apple; ■ sour apple. 
f(U »uT hat. 
T wilding. 

Afai Taigarih, jenneting. — /. M. 

Afal tin gibydd, lemon apple. — /. M. 

A/at HmMl, 

Afoi timgored, 

A/al Turm ah Hywd, snminer pomeroy. — /. M. 

Afaiau'r bird, the berries of the dogrose, hlpe. 
— Dyfed. Cf, ' frudcM-berries ' of the North of 
Ireland for the Bome fruit, and the Somerset 
'pun/ peara (^fairy pears) for haws. 

A/alaa bwt/tatioyt, the apples or beniee of 

A/aiau y ddaiar, a cant term for stones, es- 
pecially when used for pelting purposes.' — 

A/alau pimirydd {»g. afal pinwydd], pine-aptdas. 
J/atoH pnrriidd ; Ayr uron a'r India tBbrg i Srwrth j 

A/aiaa Sodom, apples of Sodom. 

Y M(* lUnr, o KTleh ffluun hwn j Wfii tbjw uron. p« 
Tmi wedj rtirnddfua a oramot Jn Uwu otjmMUieiix Tlt- 
ddTDt ; ■£ y lawl m elvlr A/aiau Sodom nn loflephiu. 

IT. O. Pnghe: COTl, 6«, II. 

Brmia yr afalan, royal apple, pomeroy. — W. 
Cotd a/alau {tg. ooeden afalaa), apple-tiees. 
Ovrin a/alau, apple-wine, dder. 

Tmarfer a^ ef fsl r 1w S^^^TOi V^ ddodJ dyteryn oea 

ddwi 711 Ay iTgftd Tuw k hott ; Ue lus g^ltir ^win, faea tedA 
CBduik, Peu n?D ovi da, Hf gtoin afaiait. 

Mtddygm Mtddfai, ii. 4. 
Prtn a/alau {pi. prenau afalau), an apple-tree. 
UegTi prn a/aiau ym myu prenau r a»d, folly y du« 
fy unrylyd ym mhlith 7 meibioii. — Van. il. S. 

Kaepmina/'o'woainiT'nidfittti'— !**"■" CAarJit, g.T. 
■Afid.' 

^ The entries in the preceding list, with /. M. 
attained to them, are from a ooUection of 
the Welsh names of apples used in Glamor- 
ganshire, made by lolo Uorganwg, and 
mostly, with others, printed in the 'Cambrian 
Journal,' 2 S. i. 145. 
2. a round body; a ball; a knob; a protuber- 

Ltean o bortfor pedeir Ad ymduiAir mfl dvoJ euriTTtli bop 



ta ymdynn ar dnwa 



MiidL- 

A/aiau duT, steel or iro 

Tri K '^'a f g u ynulrech oedd 
jtamBs: gwnva «g afaloM 
tamo.— Q/Frii>>iiii Ctm-m. 

I>ywedut Boroo wrlh y ffledyf val hyn o ymadiDdyon 
dAvrmavl- Or kledyf teckaf a ^loywhaf - • • y gvynhaf 
a Uwdat y dvm o ucwm marnil. ar ^na eunil yn; 
deekan. ao amJ 01 berfl teetaJ aij dwtn 



> AFALLACn 

A/al y gar, 1 the knee-pan. —Jfadino^'cm, ii. 
J/aij,rar, ) 219. 

A/al brt/aat, 1 (pi. afal brefaimau, afal bren- 
A/al breuant, j annau) Adam's apple ; the top 
of the trachea or windpipe. 
OidaboutUoa aialimaaxnBii {el. gmraliombiul. 

CaptUa Gloat. 86 (AkIl Duub. 4 a. Iv. IS). 

A/al y llygad, the apple of the eye, the eyeball. 



ard.- 
A&leulyn, - 

Oedr meddeidd-win a pboetliwui effeitbiairi, 
jUatiatyn, dvn diUyn diityllawl, 

Dtwi Wf,.- Bl.Arf.flS. 
A&leuog, a. fuU of or abounding with apples. 
A&leuWT, wyr, am. an apple-monger, an apple- 
seller; oostermonger. — W. 
Afialon, ■/. Pomona, the Boman goddess of 
fruit and fruit-trees (a modem truislation of 
the Latin name]. 
I FalH, nea J/ilm, eJ threfnhid 
Debycaf nadd, AJain ar Sol rtutg- 



ACaleoa, v. to gather apples 
Afaleugoed {ig. -en, /.), s.cl. apple-ti-ees. 

Fal e^in a/attugotd, — Tudur Alrd. 

Afaloule, -oedd, vm. an apple-yard, an orch- 
-oedd, <m. apple-juioe, cider. 



Poinona,nea 4/11(011, dnwi« y gerddi a'r coed ffrwythau, 
a briodwyd dracoefn k VBrtumnas. 

1. D. F/raii: Coll Owjalx, 401. 
A&lwydd («j. -en, /.), 3.d. and;^. apple-trees. 
AfUyu, Mn. a small apple ; something resem- 
bling a small apple. 

Rhyr ^neoen nen o/aiyn, afel J dene.— Waiie™. 

AflaU, ;>;. efeiJl, efyll, afaUon, #/. [C. avallm; 
L, maltu; Or, fv^ia], an apple-tree. 
My phell ffwyd anl o aoall. 

QoT^umAdAan: A.B.II.M. 



fir. ab Mtrtdyid : H.A. i. 463 (cl. 491). 

U t/lUt THTllUl. 

Bhgt Ootit at, RUcert: IdIo Mm. £43. 
Coed i>/rilt, tie I'D gellir yn d«, aid riiaid gweii am boi^ 
Ud ■ gweitl>loldeb.-/«lo »«. se. 
E/eilt mrion, crab-trees. 

O hanom id eui hutula nid ydym ond a/aiJi tmrion, ao ni 
■llwn ddwyn dim afalau.— Sf. lama; Ham. L Ifl. 
JLCall&ch, -au, </. [C. avallen; Br. awi(en] an 
orchard or apple-yard. 
Erfai Uewyrohm yVt a/aUadiaii, 

A'r tltBoa a llavnion afallenau.— AAii. Poicel: Tym. SS. 
a. rnys -i/altocA, Fny* A/allen. and I'ny* J/WZ- 
on, Glastonbury, in Somersetshire : caJlea also 
¥nyt Wydrin. 



Efa a aeth yn ty« laoh.—/.. 



„Gt>(.ii^lc 



K BaoffOT Wydnn yn T 



b. I'nya Afallon is sometJmeB used by medievsl 
romancers for PairyUnd. 

' ' in ydo«dd ben env GlastoDburr, ond 7 Jfn^ 
"^'^ '"ufenbt yn f^rch 1 brwyddadLii Gvud 



UuU, HT 7 Uaw arall, ft gndfnt fod Mynldin jn^ Dfhyd 
hoU nrcilllon □ \y% Artliul, ya brw mewn luwr drled- 
ddwch JD riij/i AjaOen, yng NgvUd y Tylwjth Tep. 

(7an*auaiiK; Hu. Cym. UT. 

A&lle^, -su, «/. an orohard, an appU-jard. 

AfiMrg, perlliDifftUu.— O.f. 
A&Uen, -au, »/. [tabftUan; C. «w.;/ni] an 
apple-tree. 






An amUni aoed ygkyueli' drwi y pcbyll. 

Efalmllwell tiaiV'<'J(ai.— L. G. (7sMi, tti. xiiiL IT. 

Du yr •>/«"»< 7t>> gyrDdsi*.— Ca>. TilL S. (ct. /«! i. 1>. 
A/alien brr, a. cultivated apple-tree. 

Ac nn mhen eocyd impu pren mil u hyo o f m ■ 
ffwnlddyn. yi el a/rftai btr, neu uniywioo ryirlonatlikn 
ufaUtnan per, . . A bydded fjf^hrttii auIui k rbTVOfr- 
meat rfayngaiynt, hlrbyng yr a/aU^n lorwyllt I'r un ddof 
beniii-Bim.—CiifriniHliyBrirtld, is. 

^/a((en iur, a crab- tree.— Cjt/r. Cjmru, i. 290. 
Trq/aUfrisui-addv^afftlAuper, A^rnpftddadRi&ddTg 
efyg-— *«»■ H'llin™!- Uiwlyfr y LUfnrwr, ni. 
A/ailen uryllt, a wUd spple-troe. a crab-tree. 
% A/allenau, the title of a poem attributed 
to Myrddin, so called from several of the 
Btaiizaa be^imung with the word Afatlen. 
SeeM.A.i. 150; 4.B. ii. 18. 
Afallflftwd, flodau, «ni. the bloom of apple- 
trees; apple-bloBBOm. 



A hlneth ywymetb jmj Q»wd 
Am K«t dH uo debu nfiiU,la, 



m gorrynydli.— FmiorllL gr Et 

A&llg^TT, dI. afallffyr, efellgyr, im. the knob 
or faiot of an apide-tree. — F. 
Vva drfrwtrftwd blawd bloen n/aUg^r 
lAl. van dpiiriotniwd bUvd blun n»Uivr1. 

OuoJcAmi.' M.A. I. IM. 
% The word seems to oceur but once, and the 
meaning therefore is not clear. Daviea (ap- 
parently connecting it with geffll) thinks that 
it may denote twins, which is not probable. 
A&llKwm, gym, am. a knot or branch of 1 

apple-tree. — P. 
A&Uwy, a. [af+gaU P] powerless P 
Tuv'r dryal) i/aUvn 
Yd Dohr mun, nl Dbua' mwy.— £. ab asHsm, nnilL 9 

BfeiU^dd, J («?■ -en,/.). .J)/, apple-trees. 

QtaflanyiOi lleWych linn aiuUisinl kuu. 

Ztmrl* Fyd^n .- M.A. i. 41 
A byn a bair wrddor yn debyg i imptwr yn impia d 

nf y caia alalJai iijllt, yr bon t lydd galMar > clw 
si vvrmidd o'r boll ryvua g/nUvfiid, mo m'i pluu 
pcrllui. — Cg/rinach y Hfirdd, 34. 

AHallwyn, -i, am. [afaU-f-Ilwyn] a grove of ap- 
ple-trees ; an apple-yard. 

Ef d «illia> pen dan afaltwvn ; 

Et ■ dyr ei nllt sfo, Wi drwyn.— £. a. C«ihi, iii. ill. SB. 



I Afanc 

Afon, a. [ban], high ; load.— P. So far m I 
am aware the word does not occur but as a 
personal name. 
A&n (ig. -en, /.], i.rl. and pi. raepberriet. 
A/an cochitm (ig. afanen goch), red raspberriea. 
A/an gwynion («g. afanen wen), white rasp- 
berries. 
A/an duott {tg. afani>n ddu), black Taapberries. 
Bupii, a/an, msfon, meiwon. mciwydd, niHynwydd,mrf- 
ynen.— MRJrfyfon MaJd/ai, mi. 

Lliiiytia/an{jil.]lviymataxi), ) a raspberry bush 
Perth a/an (pi. perthi afan), { or grove. 
Afiutaa, -au (in). </. folly; sillineBs. 

A'r drfHid, fAii Dodd ry ddiweddar, a wlaaanl fSini ea 
divynwTrdeb a'q ha/aivtt am tryttuiw o honyut Itl hyn 
erjoed j'r blfdddLiid.— yt^ JUu. 114. 

Afknc, pi. efeinc, efync, afancod, *m. fBr. 
avatjc : at. Ir. aAtic] 1. an animal stated in 
tbe Triads to have, before the arrival of 
the aboriginal Cymry, inhabited the Isle of 
Britain in common with hears, wolves, and 
ychain bannog, by some considered to be the 
crocodile or the uhgator. 
Ac old «« dylynd i oeb ami namyn I Gflnedl 7 Cymir, 
an ya bwy a'i gofingiuaiMiit gjaui; a chro Do hyai nid 
oedd n«b o ddyuioa yn byw ynddi, eitbr llawu Eiztb, a 
Bleiddiau, ag ^diK. ac VshHin fianUK rdoedd. 

iWwU.- M.A. ii. 67. 
2. an amphibious monat«r of medieval myth, 
which infested Llyn Llion, causing it to 
burst, which produced great disasters. It 
was eventually drawn out of the lake by the 
ychain bannog of Hu Gadam, a feat charac- 
terised oa one of the three great achievements 
of the Island. 

Tri phrif occbcstwalth Tnyi Prydain : Uong- Nefydd StI 

Nfiiflini, a ddog yiiddi wm» a boiyw bob byw ban dona 
Utu Uiao 1 ac Ychain Bannog' Bu Oadam. a InngaMiit 
A/ane J Usn i dir. ac ni tliora 7 llyn mwyacb ; a Main 
Gwydilon Oanhebon, lie y darllenid mmjnt holl frellydd- 
ydau a grybiMlaa byd. — Trinrdd: M-A- ii, 71. 
The following is another version of the same 
eiploit, from the papers of Edward Lhwyd 
(lli!*3), apparently furnished him by a cor- 
respondent, presenting a more localized form 
of the logend, with the story of the unicorn 
and the maiden incorporated. 
Mae'n dcbyg iawn gpnyf fl glywad o bonoch eon ua I^jn 

EAJnnc ['Mae'r llyn yma ar afon 0<>nwy nvoh lawV 
ttw^^Wyi^derbyn ft Chapel Oanndn. Tn ymyl Aberlled cr] ; 
' ' rhaid i mi Ran hyuy gj-mmpr^-d mD*r booi yn hya- 
'" - — -" — -tfyll, Tr wyf yn meddwl 

. 1 ei idarsrt) 8 hudndd jT .4/niic i ddyfoi 
alliuL o'i drigfa {aof y llyn) f^ y rbvymio of i chadw^nan 
{tidau} bpynij Ira yr yducdd yn cywn ft'i brti ar ei i^lm bi, 

(miCnn, a cLanfod beth a wnaelbpwyd iddo, ef a a ^yfododd 

bnjn ei KarCad yn ci Htafnne. Erbyn byn yr oedd yn dda 
fod y did yn drtigon o byd i'w Hi»jiao wrtli yebain, y 
riial a'i tTnaaaot 1 rans o'r llyn. Wedi hyn y tyfodd nya 
bogrn o ymddadleu rbwni^ rhai o'r bobi, a phawb oedd yn 
taeru ddarfod iddo ef el hun (fynunf ryd pwya tnawr ano. 
a tliynu myty □ lawer oa neb arall, gan ddywedyd, ' Uyn 
a dynodd fwysf;' 'Nag e." meddaiT llall, 'y fl,' io. A 
thra 'r oeddynt yMryaon fal hyn, mae'r gair l*f AJaiic M 
bateb nbw, a ^oatg^n eu haul odlundeb, gan ddywedyd, 

Ua« yn rbaid i ohwi ddeallc tod rhai yn r^vaosajA yr AJa^ 
— ■*_ __-i. — , ^_^— -_^. , ^juj in^^ j^ ddiffm njH 

gair milliau'r Afaiui jn «r- 



iryddoch n; 



, — , -i cytbiaul e_ — 

pya gen7f fl rod anifail o'. — 
BaeaoELaeg berer, o blegld fod y 
wyddooSu beta »!■ d— .1- 



»rf.r AUi. 



,)gle 



Wyf Tn Uuh or on t Uyn ; 
O dan Um Hrf^don to 



Ki tiijni^d ban oeth yno : 

1*1*01 trn men nu TcbeD rmlth 

Odd! mu heddfir ynuiUi.— L. O. ITMU. m. t1. ». 

Ibl s/iju TD JmtTfu.— R*i|j Nami»r, i Duv. 

Brad) rrfedd bniebiBD'T a/nu. 

TWHr AIM, i Aitm OWTOion. 

Tri phrif-OFefaot meddvriii arwedyd Hlwydd .' 

WJT r jrrefft; darlliir twyli A chndeoiwiou ' ' 

a tJCTuyivti dkid w nn a/aitr % fu erioed^ 

Wrv. jR». Ui. %i. 

T nue IlaireT o Mm un .1 ^aiu f Uin. k'r fobai bumoK ; 
Ada betti i ddjwodrd un dmjTit. Am yr 



n&Ui o ddfftvi go lam, 



w Bi WD 1 TD Ada brui i c 

afrmc, J dro (rrfredin yw, , 

UpBayA™, otSi ef*. » elwir y befn. . . Ond j m 

rliyfedd fod jr tilth ohwedlsa ym myift y cyffndlL 

diao yn nwr, mi*^ pa biusi etv rjm uuchenOI a taint ; 
%e ?T el taaiji i thid huom, Hid dim ond yr yoh«i b«mog 
> aUiu ei lamca Alloa o'T llya. Ac ODi fayay mi a dybiwn 
mi .ilfbiu V LI'T' jw'i Hlintor. nen tath o^nxsodil, yTlm 
■rdd nr vtffl enbyd mo antthwl ai taints. 

IVb. ffMiu.- D.P.O. i. 6 |1«0). 
Duf B0y dri q tanaq yno a dwir eto Uyn yr AJrne, yr 
hyn B ddengyB tod y fatli twyitfllad ag r/nu yno syBt. 

Aofol tTnaa/aqeolynywceirfDeiiKwaalmdedd. 

Y mac tnddodiBd oter yn eia (rwl^, 1 tn>id db o'r 
yehain hyn, trwj ormod Bonheatt imh dyna yr afaiu o^ 
IIth. dBKii o'i MB. aa iddo tarv yn y [as. 
ju.,™^ m™. /).K*i.H««aOrefyad.4i). 

Ond gan lod a/iuiCBi to, 
Anhapna flinion cpil, 
Un anwHT yn y UyoDedd, 
Diflaitta «■ irnith. hyllie ocdd . . . 
Tr afanc, ptirt g-vanc a gai, 
YrabirydoUaiabiia,— rvid; 0iniitb,UO. 
In the following extract, afanc is regarded as 
f em- , contrBTj to the genanil notion and usage ; 
Ham tynn'r hen afane o^ patad naR nn o^ rhai hyB- 

Elia Wgim: Bafdd Cwag, ST- 

3. Some modem writers employ the term tor 
the crocodile. 



Td yr Alp 
uwyddionaj 



myd^- 
Tr cofrlald drwy yr HgioE, 
Chwaienaat, deiuuant y don . ■ . 

O tiBV DB ddianc ar trfi.—OtcylinliiM, ix- 35. 
4. In the poets a/anc is sometimes used 
opprobnons t«rm, in 
or a mpacioiis animal. 



e of a 



at a^Oym, zdi. SB (at. livL I«). 
ffS^r&vW.- O.B.C.M. 



I lodM wnal la i lane, hlrydoedd 

Briodi hyll o/ue.— RAy> Jomt: Omllh, 180. 

^ OocaatonaUy some late writerB erroneoiuly 
DM a/ancum or a/angcant in the plural, as if 
the aingular were a/and, and apfJy the name 
to the bearer. 

Yra/aiM,<mBdywynRT«dnr priodot i^ mAr. eto y mae 
yn perthyn i'r iwti cyital a'c tir. . . Xitt't a/sac . , . yn 
■na 1 badairtnadtedd o hyd. . . AfoMfm ydynt a amryv 
Aiita.—Trrter/a OnrfiBiliuUi |ie(n}, SI. 

Yallalo'rlinllbfdwiLrtawdioglonywyro/iHiCTm. . . Oi 
qa ddichon Vt a/ffneprm paffaol llyn cyiaddaa, dewiiBnt wb^ 
tadle i Srwi helaeCh o ddvtr yn rhed«ir drwrdda. 

a^^lMpJi, Si. 10 (ct. 11, IX). 
H A/anc and addane (q.v.) are but different 
forms of the same wora, / and dd being in 
some cases conunntable. 
II 



(i), pi. afsn, »/. a raspberry. 
Afanllwyn, -i, «m. a raspberry bush or grove 

[Bubut idruiii).--}{ugh Dati'et : Walsh Bot. 50, 



u (i), am. the mulberry,— /<rfo Olo»- 



154. 
A&nog, - 

A&ns, im. avens, herb Bonnet (Geuni). — Hugh 
Davie*: WeUh Bot. 154, 

f The word, found in most Welsh books on 
botany sinoe the appearance of the ' BotanO' 
logiuin' in Davies's IHotiotiary in 1632, is 
aeemingly borrowed from Eng. aveiu, also 
written avance, avtna, avmnet, and in L.L. 
avaidia and avencia ; but in English it is con- 
fessedly ' a word of obscure origin, and quite 
unintoUigiblo.' See Prior, 'Popular Names 
of British Plants,' 13; and Britten and Hol- 
land, 'English Plant-Names,' b.v. Its other 
Webb names are mabgoll, llytiaa fy anvn/lyd, 
bendigeidiya, and llyiiau betted (^herba bene- 
dicta), which are all sentimental, not de- 
scriptiTe. Though iucxphcable in Bnghsh, 
it cannot be considered a Welsh term, its 
very form, were there no other reasons, being 
against that assumption. It is not included 
in the list of plants given in 'Meddygon 
Myddfai,' 28l-29i : nor does the name occur 
in the body of that work, though the herb 
under another appellation is frequently men- 
tioned. It is not the only loan-word which 
Bnds place in our botanical nomenclature. 

A&nt, -au, no. [mant] border, margin, edge. 
— O.F. 

A&n-WTdd {>g. -en, /,), ».pl. raspberry shrubs; 
a raspbeny brake or bush. 

j4 HonidBrd gWBdthyt 

Nygonasmwyt.— 7>iIi«iR.' A.B. ii. 140. 
Aftw,tn>.[bdr?]^ef; sadness: sorrow; moom- 
ing; lamentation; longing; desire, 
Owflda tnii tzydar ao aiur as anghm. 

TnUtm: A.B. iL IM. 
Ome Di lac galai ac auir gwaatad. 

Oori-Ma MacUtnt : A.B. li. 101. 
Raggalaigarwn/arefritBd.— O«»lc*moi: M.A. i. 901. 

ban, uUgvm Jfns.' U.A. i, SW lot. Wl). 
CriBt ereawdyr llywyawdyr lln da«r a net 

"" Tl^^ lAgfWri : M.A. L SOT (ot, SW). 
Triitwytnwwotnisiad V'"''— ^- "^ QiMi/m. 
Dal llid. gofld, ao V't 

A chaa vrth eHtniB adl&r. — llwiianab Sefnyn. 
0*m afar rhwym at ar hynU 
A hwyliod Ion ty helynt.— /o(n Mori-me). 

Atax, a. sorrowful, mournful, sad; dismal. 

i.us. 



Qalar ac t^/ar goflon, mynydi ynt. 
Han na ghaid ond hoewon. 

Grmut Cawta, 117 [d. tS). 
Bt jnoT bybyr mur BabeL 
NId yv moi fangav nao d^l 
Trt Siwta «/"'■ driatyd. 

/. a. Orirv^ydd: Otdr. M (ct. It). 

L&m, -au, sf. bribery; a bribe. 
Ue boi ni diam twrtai lam, 

Er ofn Qac er auF n/dn. — Ot. Llufgd DaJ. ah Evtioa. 
Ardwyr«fl a la™ [aTWn] (nnya. 

Tatiiain 1 A.B. <i. 17& <ct. 17SJ. 



A&rw7t -on, < 

Sdnllc nT hmi 

YDllaAmaron 



CuiuUrla: H.A. 1. 1 



—OyruUelK! U.A. 1. Wt. 



WyrYwe 



d^.tbUrvtlsn: U.A.I.901. 

% It IB also a pencmAl name, and may possibly 
be such in some of the [ff«(^ding; eztrsotB. 

Afdrwytb, -au, »m. strangury.— ff. Saietbury. 

Afed, a. [=aefed, aeddfed,ftddfed]ripe, mature. 

—o.r. 

Ef ladhei anri ao eiUiaf . 

OonAia KaMtnc: A.B. fl. IW. 

Afel, o. [=hafal (a-+mal): of. /rf for /oi ( 
tna/], dmilar, like, resembling. 

Trnten o iriod ^Tdiui fn, 

Tab Hrwel nft' Ifor.— /ntn Du'r Altcy. 

jl/it pob muum— Z>ii>r(i. 

Afbll, -au, «/. the bosom ; the breaat. 
One K irrUi dmH a' 



Aflacb, a. [iach], sickly; ailing; unwell, iu' 
diepoBed; unhealthy; unwholeaome, inaolu- 



A Mair » vnuCli f manfn Iach.— Ayml SarrdiBa!. 
AflachAu, V. to make siokly or unhealthy ; to 



^ ^ - — _, — -_, , J tnied, T ooluddion, a'r 

cf 11l i*t fioryn. fel 7' true ju i/frcAUu. yn ajryni. u 711 dJ- 

foddio r K*>«i T I -' *■* 



' ' ^ zWft'ys.- BI. Arf.SM. 

Aflacbua,a. sickly; ailing; unwell; unhealthy; 
un wholesome. 
Dufu 1 lawsnedd. Te, tr ol hyn . . ■ ddfr>dd«f odadl « 



mm, heb gruununt ii*i duya I 

Ilt^ydd at OvB^m, dviij. H 
9 mflddirdDd jn Rolchi jr jmrsijAd, yr bmi y% 
f dfall, an vn boddi y Ilnnlkn hyny 7 mHe yn ar 



jnniifedd a fprlybnl 



Aflachusdra, j or condition. 

Yf dvfyr tvym, a hyiiDy a beir chwydb yr atfdMudler a 110 
ytli Icylla.— JfaUf^en Utid/ai, i. 1S8. 

Aflachwst, im. disease ; distemper ; malady. 

Tr hvQ ni chymnmo fvyd pan fa amool ofawant, ei g-jdla 
a iBinw 1 gwfB-t mc lyfacAiMi, yr hyn a bair waew yn 7 pen. 

Aflaith, ieithau, 1 «m. blandishment; indol- 
Aflaeth, -au, j gence; eajoyment; pleasure; 
dalliance ; mirth ; pleasant and gentle language. 
Mit t/T aflaith, the honey-moon. 
Aroa gwartli yr pwrtliod au^ffitl. 

CynddtlK: M.A. i. lis. 
A phaD oeddwn, rwa vyni, 
Ucwn gobalth, o'l hafinOi hi, 
Sygwiu'r tenh.—D. ab O-wilna, dixix. 3. 



Dnv-le erioed i dreiBlo'r iaitb I 

ff.ic JTsru.- Boa C(M(W, L M. 
Uawn ojtatii a llim letanD, 
Ddryw tw^ si cbafd Iloniuib llau-. 

Grmvy QauK, 40 (c(. IS). 
Dringaf, yn Uawn ajlaUk, 
TntK g-logia mynyddau majth . 
/nun Rr^iiU J 



: Gmitli, t S. 

^ The older form is aflaith; henoe the adj. 
Aflaith, ieithiau, tf. [af- +iaith] a solecism. 

JJaM yiiydd tai yn tywyi tna ihyw lediaith. 

Aflawn, fni. wrong; injustice. 

Dan rith diwyirio qrefydd, oylUwmryd Haver o Rnokvt' 

der ac nfitvi.^CarnliviWKc.- Han. Cym. T8B. 

/awn ac afiavm, right and wrong. 
Aflawn, a. unjust, wrong, not right. 
Aflawtutor, au, *m. injustice, wrong; iuiqui^. 

Tr t^umdef rdtwdd qymnieryd tlroedd y maoaiAloKTdd 
a'r wlwyaf, y ibai a arfennt bqcthi y tlodJon. . . 'ii aj- 
iavttofr tua^ at y tlodjoa, befyd, a ^oapwyd yn a] d ^w 
gan yUadiDnsnhDnain.— <7itniAiiauiK.- Han. C!riD.TSB. 

Afiechyd, *m. disease; indisposition, illness; 

Neud t^Mchgd bryd a brydaiiT. 

Or. ah VimlHd,- M.A. 1. 4U. 

Nid ct/inAti and diogi.— Me JTo. aS4. 

iMliyd ieococtyd, afitdtti i™"*^. nr cyini Uairir. 

ittoni. 
Khiwydd i'r pwely ac ebnrydd i godl, 
A yr ymaith beohtid; afrdifd, a t£ladL— /Kant. 
Afleithair, eirian, «m. barbarism, impurity of 
language. 

Bartiaimleita, AfnOiair, o ymchwalyd pwyll, y ffogr boa 
er mvyn Cyiora^ a t^i pan nnarferar arvmu ihd 
aiaith Oynffaecr ur o taiUi anil, muTH o Wydd^a« 
Ffrangaeg, Liaainaag. n - ' *- "^ 



U^wS^Mi 



Afleithol, a,-^Aflxitku». 

Cyflcilbin' m afritluil.— Edward J ma : Dewla. Oan. M. 
Afleitbua, a. bland; pleasant; entertaining ; 
merry ; indulgent. 

AfiiUua pob nuuuinaetb,— Jlidrti. [ W * ili, IM.) 

I'wlhad'. yaamddtfadddynl— SrwiiiDji Oiwrii,, M. 
4;VrirAE(« ddifynpob brodorion Cymm. 

(VjwtiM Biddan, 1. 

Afieithusder, -au, ) nn. pleasantness ; blan- 
Afieithusrwydd, ) dishmcnt; pleasureable- 

Aflafar, a. [af- -|-llafar ; C. avlavar; O.Ir. am- 
labar, Mod. Ir. am/Uabhar] 1. speechless, 
dumb ; without speech or utterance. 
Fletityn aflafar. an infant Cf. C. mab aflavar, 
mfaufl.— C.F. (Zeuss. 6.C. 1069, 894.) 

Tr hwn o eneu plant bychain. a rhai yn mgno, a bcmigt 
nwUi, ac a vikHfimcmt i blaitt afinfar Aj ogoneddd trry 
Itim.—U. a. Oyfralii (Ovyl y Owirionjaid). 
Nend aflawen wyf nend <\/bitiar drist. 

CjiKddtlu, r H.A. 1. tao. 
Ennygion ajh/ar ydynt [y llythyrenaa] yn llafani, a 
chuff bcb ffiuud, hcb fywyd, yn anrain y mcddwl. 

BarOdai, t. U, 



Nld^tK 



dan tywyll nac oMa/ar. 

Isfr Acn«f Qtfrtdti, (Am Be 



.u). 



Ath (od ditban 711 garwrHd too ro fad M 711 nfafi^ 
uewn pool dofltDmc. 

Dr. Jota /)oMM.- UjftT He*. 1. iriil. Ig. 

Tlinunplln u-wimig: ^roeinwi 7a hawddau' ^ dinlln 
yn wyUTigM; u ulwysw yn ajt^ar.—MyM. Anil. iiL SiS. 

2. iiurticulate ; not distinct or intelligible ; baT- 
iiigiio articulate ngniflcation ; inharmonioua, 
discoidant, disaonant. harsh. 

LjUnt, rigKtrydd^ o rrvo^wrtlun lleliuiL yn 
a OB a honJFBl yn afiafar.~\ Cor. liT. 10. 

. -ddA^Ldt dU ftil o't bUea, oddi 

pTth un henvr. yi hwn 11 ddaetb ntst dan rodu Euth o 
gin ajlii/iir.~-AD». gaitrU : DuuTddluCh. BIS. 

I'rydydd afiafar, a hsj^ or inliamiomoui poet. 
— Myv. vlrci. iii, 10. 



, , , ,- ., 1,U. Hf £ni 

i>J»=/«- Dnw.— /oto '- 

AflaCuwlcl, -an, #iR. dumbness; inarticulat«iiesg. 
■Aflftfariaath, -an, «/. inarticulation ; sileaise ; 
reticence. 

Tut bnJnt gynnwynairl build : UsTu ei bwrll lie j 

l^tho; djCa/druT^£AUeikpbi7dym7iii> . . . urnadAloDAjdyD 

o'i (odd vrih mid g^Ud s gvyddogneth.— BunMiu, iL 16B. 

Afiaforwch, »m. want or lack of utterance; 

diinibne«s; inartical&teneg8 ; Hilenoe. 

Ifi afufarmck iscliog : cuTnuit ; dddjg ; H cbyflylos, 

rri»U.-M.A.iii. 1*). 

AflAflUKar, o. dismdined or indisposed \a la- 
bour; disliking labour or exertion. 

Ujnu n]& inrhsilh gwUd : gonao o ddiogi afafurfir; 
odvydd m thwyll mzsyweddiu ; uiglwfrBiUigsrwijIi ; un- 

llwyn; uuubjioda*. — ZfnutrrJfa. 

AJftn, a. unclean; foul, dirt^; polluted. 

Tr fdym ni oil nugyi pMh tt/aa.—SKi. IxiT. 0. 
Bidial ■ iKlsi EidTTll yn <m(iiii cl wiw ft bnthig. « aifan 
u klkeh Id fwyd ■'! lyn.— /sb Ma. 181. 

OuydBflyddl'ritjtH OrmKy OKuia, 88. 

Ytprydiim ajlan, unclean spirits. — Mat, x. 1 
(cf. lii. 43). 
AflanhAd, (m. a rendering or making unclean ; 

pollution. 
Aflanltau, v. to make unclean; to pollute, to 
defile. 
Am iddo roddi n'l hud i Uoloch, i ajfanA^u (y jairmagt. 
1^/. «. 3 la. xi. «). 
Ym mbs !e yr oedd p etflwyB y pryd hyny, p»n ddalfu- 
K^ i bob cnaird u- y ddiinr aJLixhaa a OoTdd ei hun t 

Jfmi Cliiln: IHff. il. n. 
A phetlun («a f^ytninitD aJiiyMtfnI. 

I. II. F/raid: Coll Ovyntk, L 4;i. 

Aflanhftwr, liawyr, *>n. a polluter or defller. 
Aflanweithdra, am. uncleanliness ; untidineaa. 
Tchyd 

AAariaidd, , „ . 

Aflarjraidd, j placid. 

Aflatlir, a. without polish or gloss ; unpolished. 
Dynu fudd ffolni. yn y ISedd gnnrif, yn dyfaln el bun 

— '^- '--■- — ^'-io o*T Hvyr ym mhlith dynioiisidt ivtaUr, 

Idai pwy, nui ym mba le I 

0MU(n- jreetoui : Omith, iL vn. 

Aflathraid, ) a. unpolished; not glossy; in- 
Aflathraidd, ) oondite, rude; not fme -grown. 
Aflawen, a. 1. not merry orcheerful ; uncheer- 

fnl. sad, gloomy, melancholy ; diamal. 

KAint yn yBpydAwt nob fwinwt ^^icoi. 



Huidid euidyl oirZdvn bfinoeUt. 

UtwrthHm: M.A. 1. 10B(of. 119). 
Awyt nend ftfliryt neu aJCaKt7i.—Cgm,diUK: ILA. I. «), 
Uor ddiguiad, mor nJUni*m, 
Ydyw manr'n Ilyn oT ohwurai. 

BUfft ftwAani.- C. y C. m. M. 
i'r nuS ataarn n'l l&D o'i enan. 

Or. Yiad God- : M.A. i. MT (of. «»). 

2. saucy; passionate. 



A tn Uvea lid e«,— ^yiW i'Vr''' o^ ^o"' 

3. untidy, slovenly, dirty. — N.E.W. 

4. extreme, exceeding, excessive. 

A ffw«dy colli un^lcb tf^ mD ofl ffwyr yn drist oJta%eeH 
yd ymcho el i M g m t y gwlat. — BfuI f 7>wjr»fuii, iat». 
Fal hyn, dan (nw e/simii. 
Bine ptuit ored UobiiminM hen. 

l<Ao Morgamcf : SalnuD, I. ItCI. 

Oer aflavxn, extremely cold. 
Aflawenydd, ) «nt. sadness ; uncheerfnlness ; 
Aflewenydd, j gloominess ; infestiTity. 

yw y bMIt bnn* blinder bryt syt >g nfklaBntuM 



(ailon A| 






Afladnaia, 

Uchenaid wedn aJUdnaU 

A'm pair heb ynni I'm paia i—Da/gdi ab ffvilym, xxrii. 1. 
LlDosd <r<«!d>ini tnia a gsiaiant.— JVyi. Arth. L ISl. 
bob edn aJUditais, 

ii-M). 
Da erioed, edn njtMnait, 

Tdr* el U"> ond ei laia.— Wiliam LUyw, i'r Pans. 
Afledneiarwydd, jmi. indelicacy; immodesty; 

rudeness, ooaraeness. 
Aflef, a. voioeless; silent; noiseless. 

Aravon honno. wody ydd a paradwyi. a gerdba yn ^/t«a 

dnry y Trenbinyutb hoiino oil umnd getddedmu 

Tu. Ovlad Ie~a* F-^igaid, (4. 

Aflefbrydd, am. dumbness, muteness ; ulence. 

Aflefti, af.=Afl>^n. 

Aflah&d, am. B displadng, displacement ; a 

misplacing. 
Aflehan, v. to displace; to misplace. 
Aflem, af.^AJlyiH, q.v. 
Aflaudid, »m. undeanness ; uncloanliness. 
rapryd ajtendtd, a spirit of uncleoimess; an 
undean spirit. — Seek. xiii. 2. 
Mae afiendid o bob math yn fllyn cyfaddef i'r ooriT. 

EtU lry«.- Rh. B. B. ii. 3 (71). 
T gvh mawr yn enwedla a ymroiiant yn ddigydvybod 
I bub n^^id a godineb.— Tim. Eiiani: D.P.O. i. 4 |12S). 

Afleaog, a. [llSn] iUitorate, unlearned; not 

Aflanogaetli, «/. illiterateness ; want or lack 
of learning ; want of literature. 



larUk, a Dh^ annoethineb ac aajiedwyddwch. 

Ciifl™LdifBiSrM,a. 

Aflto, a. [for o^erw] untidy, slovenly; uncouth. 

-N.W. 

AJUr fa thrwyn, fa] artb ddnrg, 

Oer ddnryn o'r elddlorwR.— Skp» IW.r, i'r DdyUnan. 

Bbemmwth aJUr o gais Sain OMwain. 



C^Mmtuih OiMan, 54 



glc 



Atlbkv 



Wswr lal bin ; 
T aat't paprr to nodedix a mal, ft'r ugnffmlth jn 
but i^lr.—Lli/rnJiia/IJi * ('cnn-^, 360. 

Aflenr, a. [Uerw] sloTenly. untidy ; disorderly ; 
not neat, tidy, or elegtuit ; uncouth. 



Td riiwfmAn m 



iJhA™- 



pa hyd y jr^irweddi I 



tbiTd 



hydj, 
ycrio 



rodi! 






Aflerwch, ) [r), sm. slavenliiieM, ontidineBs; 

Aflerwd«r, j uncouthness. 

Aflea, -au, «Tn. [af--|-lles: Ir. aimhirtu] dii- 

advant&ge ; unprofitableness ; loss ; damage ; 

hart.— Htb. vii. 1«. 

Ku]^ rmll /« geonytti heb t^r. msnF^ ohuwA jrtU dy 
djCei Doth la nu a« mmna^kf itt. 

CnghonjD.t yw ffwenn^iit ft IhiduvKvar dLyinuedb v 






£f.MFtf ;n*l 



1, 1, la 



Gochd wuffuthnr ajlu i ael 
Afles&u, t'.=^efu, A/Uaoli. 
Aflesol, la. disadTantogcous ; not profitable 
Afleaiol, j oradvantagoona; unprofitable; hurt- 
ful, injurious, detrimental; useless, worthless ; 
incommodious. 
Owelwn ynu mar aJUtoi fn i'a bvnsflaid jvkuiu bwrw 
cyitndd odiU wrtbynt cyn troi at Dduv drwy «UIcirwch. 
(.■*orftj EdwardA: Han. y Ffydd, ace. 
Afleaoldsb, 'Jnn. disadvaatagoousness ; in- 
Afle«older, J utility ; nselcsHncss, unprofit- 
Afleaolrwydd, ) ablenese ; wotthlessness; dis- 

advantAge; damage. 
Afleaoli, v. to render disadvantageous or 
unprofitable ; to disadvantage, damage, or 

Aflesu, V. to disadvantage, damage, injure, or 

IhLir goTtnes yn njttfn 

Elnbynyi feiiua ixi.—TtumvH lArwvifftt. 

Afleawr, w^, 1 tm. one that causes disadvaa- 
Aflesydd, -ion, | tage or damage ; a damager. 
Aflsttfaeth, -au, «/. inhospitality. 
Afl«ttyg&r, ) ct. inhospitable; not given to 
Aflettyugar, | hospitality or entertainment. 
Aflettygarwcli, | «m. want of hospitality, 
Aflettjrug&rwch, f inhospitality. 
AflattyWT, I wyr, »m. a person Toid of hoa- 
AflettyuwT, ) pitality. 
Aflfiu, f . to misplace ; to put out of place ; to 

displace. 
Aflewder, -au, im. want of courage, bravery, 

valour, or heroism ; cowardice. 

Cynfuvb sb RbDu > Uddwyd un el ajhwitr.—late Mn. G. 

Aflithrig, a. not smooth, finent, at flowing; 
not aUppery ; not lubric. 
Diarambpu y frrel pavb mil cwU uhyiradd u ^iKrtW; 
■ tydd el nldnm lelly.— /Mac -Tmsi .• Onm. Cym. u.j. 
At teniT oewydd njfiiVij y Bardd Qaff o Lnsdaliu 

DKfgM Dda Brgri. 



Afloew, a. not bright, clear, or tranapemit; 
muddy; turbid; opaque. 

Eidwfry lydd^ yrtuDuuUf. jnajTM^v^ 

Til. Ctaria. (.T. 'Bnphnttft' 

Y nue Sol yn Uaw yr Arirlwydd. &> g^rio sydd ftooh, 

byny yw. 4;Ii>rs. yn Uawa cymmyig.— G'uiUxli^, ii. 11. 

Afioewder, tin. lack of clearness or brightnca; 

muddiness; turbidneas. 
Aflonder, -au, am. uncheerfulness ; sadness 

melancholy. 
Aflonydd (S), a. unquiet; restless; nneas; 



A'i bwyiid yn tybiud djdd, 

h'ittUUKa afm^!~tl, ai Oici(,i>, oaiii. 81. 

Nid oedd & vrddu ^yn^bor 1 vlad a chmedl tjtgmfdl 
■yitalaeefe.— AnB^btiTMrrwiii: K.A.ii.SU. 

Tb flin u ya ivtni)>iU.— r*mai Ayj. 

Oocbd fad (el Cain aiain, nea fet Bslum ddkbdI)W. 
Den fel Abitophel gy frwya, oeu (el Abenlom <v(cmii^ an 
fel Suddaa fndwr, neu ryw uu(ail drwa. 

Mtrtan lly^: Trf. Ad. U. 

AflonTddiod, -au, am. a disquieting, a dis- 

turmng. 
Aflonytldu, <-a, 1. to disquiet, to disturb, to 

agitate ; to trouble ; to molest. 
Ae o byny ni ajh*ifddiai/d Rbyv ab 



T rt uti lydd yn aJUnfidu'r byd ... * dduthiut yma 

disturbance or disquiet ; to be 
sy, or unquiet. 
AJtonyddu ar, to cause disturbance to ; to dis- 
quiet or diaturb. 

Ny bn o hynny alluyny dydyru hynny nallei ^JUnjr^ 
or Cbynriynuai yn yr Vepaoi. 

riUru lie Carttlt Magmi, ool. MS. 
Ac aJUmyiu ar er gelynneon. 

BfK I Saan: U.A. ii. 090 Id. Ul). 
Pa bam yr ttjton^ddaiti truaft — I Savt. uviii. lA. 
Afloayddna, a, disturbing, disquieting; molest- 
ing; restless. 

Pan edrycho'r Ueuad (al frwa^> y "yrthlo y aer, k y 
10 (»). 



Auiiphwya, nm nfinifiluBdi, yw cy^mi Hmlh yn enwir 
beb acbaws.— yniorU vr £iinM, 16. 
Bbnali gan afiongddicri tj nghaloii.— Sain, xxxriii. S. 
Hynl a (yddwn yn wasC&dDl uemi po^i at njlomyddiBck. 
re>. nm-a.- Bach. Qrin. SO. 

Afiottyddwch gwlad, the disturbance of a coun- 
try; a common or public nuisance. 
Aflo&yddwT, wyr, am. one who disquiets or 
disturbs ; a molester, a diatur at. 
AJIom/ddun- gwlad, a disturber of the com- 
munity ; a common diaturber, 
Oadamant fa ha/o^^wfr mewn meddlant o>n Ul, a. 
bunddm i'w cbwilio. — Gvrnlivi^dd^ iii. It. 

Yr oedd H afioni/ddv)ir yn rby gall i mteathor dim i 
rwyitro Hdo ymadael.— (l'''*^™'". i. 8. 

Aflnn, a. without form or shape; afaapeJeso, 



formless, unformed. 

S«r^awl^fyd^dd)4n<Ddd gw^ a dwfli. 



Aflun, -ian, am. a oarioature. 

Aflunlad, -an, am. a deforming 

deformation, disfiguration. 



jM.V^.(,K»t;ie 



A.flnTiiaidd, a. I. without form or shape ; fona- 
less, sliapeleBB ; chootiti ; deformed, misshapen, 
ngly.— Om. i. 2; Doeth. xi. 17. 

Tori rimsitb f pwumnffm tt*T afianieimia/ o hmyDt, ■ 
C^(/ruuie& jl BlirM, U. 

Om erdgunut unmheii on aV tybtau oiliiniiiiU, ulertli 
ijtt - ■ ■ f e gvuii ni BBfniLu bwrnt yn eanvrth ddipim t 
mesymsD mimliorulwy t£n & ITakIau- — Itremi Own, M- 

Ni rrrvKuwii i nSwyno ertbrl mar affimuuU ac mm- 
mlieifl&tth H hwn '^cb ttah chvl.— JTdiu tFWiami. 

*nh y gair wy. — Kduiarri Samuei: Orotjoa. i 

2, untidy, sloveiily ; shabby. 

CUmw^addynunnwoTdyw. . . d/tfinicritU yn d ddmad. 

Orot^ Owai*, 1«9. 

Aflnniedig, a. [af-+lluiiio] unfonnod, not 

T IMaiar. detnydd tufmbsciir gwag- 

r. 0. P-ii**.- CO. rii. *T1. 
Aflimiaiddiad, -au, <m. deformation, disfi^ura- 

Afliuiieiddio, v, to deform ; to render deformed 
or disSgured ; to disfigure ; to become dis- 
figured or deformed. 

Afluaiaiddrwydd, 

Aflunieidd- dia, 

Afloniei ddi web, 

Efe *. Htyn ami iinjn afitinmdd-^n, a memi ^wag«dd. 

Eig. Xo'taa: Eea.xixiT.il. 
Tm mha on y bydd on Iiafimiriii-drrt dn hunaia yn 
WHtad o flnoi aa ll^ud. 

loi. ToTHat: BuCh. Origt. ST [ct. 1B7). 
A'r faoyv hon, y galluu n Aq/uaieiddiuak ndw pob 
gobothioQ o bricoiLS aiav, oedd yr im}^ eu^hnifllt a gaw- 
nmar y myayddoedd.— flrunu; Nineteh. 144. 

Aflnnio, IT. to disfigure, to deform, t« misshape ; 
to render ugly ; to caricature.— IF. iSaI«a&ury, 

AlKlwydd allDliydd Ei a/inuis. 

anig^M Taad Coch : M.A. i. 886, 
DjIM obwl yn dtooHIori «Ia hiiuUi, gan i^uiu a diadthm 



wlyn digorJVc 
,1 WQBydyn j 



yonrbwdl 

ffuuUfn' JfrrAotn . 



aw»iaj,a 



Aflasiog, a. deformed, disfigured, distortfid ; 
amorphous ; ugly. 
Tm mhUth yr adar cytio^ 
Ar oehr y dryw fel drsoiop, 
Yr oedd dffftaa gT«f , furffynaidd groen, 

Aflwfr, n>. ) d. not timid, cowardly, or timoroas; 
A£ofr, /. ) bold, daring, courageous. 

Hwrt ajla/gr mftl hirdirfyT hoenl. 

CgiddrliB: U.A. 1. MO. 

Aflwrf, m. I a. iUwrf. by metatheaiB for Hui/r] 
Aflorf, /. i —Aflwfr. 

Tri pbett nrwiftie . . . a"i deneys ynddwyfairi! anfaleh 

ynhawddTyd; aA>r/m«irnadfyd; ac yq ddiacbvyil ar bob 

Snltll -Ovm—Mfv. AnM. iil. »8. 

A^wydd, -an, -ion, tm. misfortune, ill luck, 
iU fortune, mishap. 

B4d trnavd ^vaid ar ddiriaid. 

UyKarch Ben : M.A, i. 135 (cf, iii. 1S8). 
Trydy pla Wytyl ajtw/i dihen. 

tfvrf^fvrflA Ursc^Htop; M,A. i, 2TS. 
Om* fl o'r iu(wi>'d si dnuDcoyddair. 

Or, y«jc«*,- M-A,i.8ee. 

Nidd^oit edryih ar d hadfyd yn aydd «i Im/icfM- 



Agi>Bmtrd»enllKfiid.~DafyiUVx*SiB». 



AfLYVOD&ABTK 



The pi. is not 

Nid o« dim dau 

tupddau.—On^gdd Wfnn: 
Ailsitli ao ^wtddin ay ar en ffyidd, 

W. SaittbMrv : Ehnf . liL W. 

Aflwyddiskonua, ) a. unprosperous, ausnooess- 
Aflwjrddiannol, ) ful ; unlucky ; unfortunate. 

Ny iron yn yr hoU vyt un dyn ajIwy^dMvmuitotk na 

dinodyadi no EU.-a. ifr^, )80. 

Afic^iaM^ pob diriaid.— iKirc». (H.A. Iil. 179.) 

Tr hys • borodd en bod mor taSoiioa ac EifuvAJiMnu. 

Tlifc. &»u,' D.P.0. 1. 1 (1). 

eg aitcyddtaniot Inddiaa >ddo ddayua y oylch am 



y drefoolyu 



o gnydan a ufaethaeai. 



Aflwyddiant, 
prosperity; n 

CBWtdroibliryf Caer Wedio blaot 
A leddalat rhag t^/hupddiaitl. 

TtI phsUi a gaiff dya drn annAdwydd : 

•a*l; a pboenaa.-^Mfv, ArA. iii. 140. 
Hi wn 

Jroaedd, 



I,' Amaetliyddiaetti, U 



of B 



m-suuceas; misfortune. 



Uodi; . 



m wn Bjn i^jtwyildiiiHt nemor o ddyliiryn, o gydiadd 
droaedd, a glywn si byspyiiBd gyda Uai a ryttabtuad. nag 
rhaLg<ldyw«d«dig,^<7arMiMiiBdiK ,^ uo. Gym. AC. 
tnisai«dd a dywalltant ladan ar blant ajlvi/dd- 

Aflwyddo, v. not to sucoeed or prosper; to 
miaoarry ; t« fail ; to cause to fail. 

Mid -JIvi/iU alal.— riliuu.' M.A. I. «8. 

Man afloyddisnt noddlant oawdd, 

Hed iddD a'm *aitwv<Uaadil /— jD. ai Omirm, xciL I, 
Afiwyddog, a, iinfoTtiinat« ; unlucky. 
Aflwyddol, a. not prospering or succeeding; 
unproaperouH ; unlucky; unBuccOBBful. 

Aj^eUoD iryimnlledig, a cfawyi^Ti 

Ddychveledigion o ajuiyddcl ffwydd, 

Naootawch.— J.ZI.>/ni>d.' Coll Qvynla, 1. 40. 

Aflwyr, a. iuoomplete ; imperfect. 

""^ C^ndMir: M.A. i. 319, 

Aflwya, a. not clean, pure, or holy; unclean; 
unholy; foul; nasty; dirty; ugly. 

Ni ddylai tudd fylyrio ar unnetti jwael o'c byd ; eef yr 
hyn a fo baa as ajbctt, ac na tytbo duonua. 

ClfrinaeA f Bcirdd. 30. 

Ue ni obai emi namyn ajtwg$ ao aiLan, ao annoetb ao an- 
nwyn ym mhoh peth.— /frfo Ma. 16». 

Aflvytho, V. to disburden; to unload. 
Fan amla Aniau i* ttawf bryw. " 
^Kytlmr a gynnydda addon fwy, 
Hya DB. arbedom idd ela dynu sydd. 

W. O.PtLghe: CO. ».»40. 

Aflyfii, m. \a. not smooth, plane, or polished ; 

Afl«&, /. trough; rugged. 

Ady£ad«r, -au, tm. want or lack of smoothness; 

roughness, ruggedness. 
AflygTftdd, sm. incomiption. 

Tm mha beth y eaif an^hm byw a bywyd 1 Yn ei tansg- 

lon, eef claerder, a goleuni, ac yegafadei, ac afinrndd. 

BanUai. i. S4a. 

Aflym, m. ) a. not sharp or keen; blunt, dull, 
Ailam, /. ) obtuse. 

Hir-iaig a chyllell n/lem.—Dianb, 

Aflymder, { im. -want of sharpness ; lack of 
Aflymdra, ) keenness ; bluntuess ; dullness. 
Aflyvodraeth, -an, i/'m. anarchy; want of 
govemment; misrule, misgovemment. 

Oad leatyn «i tab a nral afirwodratIM, ac ■ fynai lyf el 
■0 anbaddmll.— ArM iWfwrfKs: M.A. ii. BOO (of. SOS|. 



Aflywodhaethoaa 6 

Pft beth H fa ya uvme rhag i Itrjdiau (rvfinwrnig didduw- 
lieth •« af-jmdrarOi jnngynunrKu Rda dynwdd Vjtt- 
dwy K Qafreo !— tVbJtvmuii, 1. 1^ 

Tr iKdd ijfyHvrfRudI luirr J pryd hTn r>> ugabieth 
DDrhun.— Cii>yJial«<U, iii. 1«. 
Aflywodraethg'ar, a. unwilling or disindmed 
to be governed ; disaffected to gOTemment ; 
ungovernable; anarchica]. 

Ue brddo CTTCh msddiriiii. te uiudaiiirn', ■ lUdion, > 
bradwTT, fL phul«iDiaid, & phob rbyv f^rwyiuud a rhodiud, 
A phob drWgw^tbrsdiryT h rhiii i^yin*tdraethgar. 

BanUu, a. 110. 

Afl7wodrftath.ol, a. anarchical. 
AflyrroiiraatlkiM, a. amarcliical ; ungovernable. 

Owdvcb pa faint obechodiLiI, ralcTaaiferoslIrlloa.ST'ii 
uttt adoni^u f rtwi sj-'n byw 'd benrbydd k ajtuiaxlr. 
iwl*ia.— y«aw*n- -■ I>yi«k P»rw, 47. 

AflTWodraathwr, wyr, *m, one that misgoverns. 

Afti, -au, tm. boldueM; couisge. — P, 

Ualhni liifTD u<!b any* vch uivyD 
AllitcrenaUIitfniiutrwTiL.— CvoiUclur.' U^A.. i. Sn. 
H« innild bnndub Che blade orer the matt, am tlie rein 
with the atmioiDg of gore, and the tint of the fluid on the 

Tteislivdd dnd ddnttavdd elod byd ddentn afn 
Tnfii Un c^ al liflafa Uoecr elifla. 

Gr. of JtrrBtfdd; U.A. i. ***. 
AftaawB, a. [naws] not geni&l ; unnatural ; un* 
candid ; impudent. 
Ai hyn, f odd a/iui-ici. daeth r llnavi 
A Q«T)nel wiw-nam mwr.— DimW « S«nW, IS*. 
Afbeued, -au, tm. [of. neued, nrwi] the object 
of one's wishes or deaires; that which is lon^d 
for ; a desideratum ; diapodtiau, inclination. 
Dianhrt j bob Ukwt lUmrel 
E hnalamhaual n/iAfj, — ^lamriii,^ Qod. 838. 
T« deupo DO hendt wy Tfody liinet 
Er^mwya yg wlat nef adef mmfuet, — Anfitria " ' — ~ 
Cyiubaf car oemnyd a/naitil. 

Uaa Bya nthyr afara aflietud j dawn. 

Ciitddk^.' U.A. 1. 1» [cf. 
With Uordat a Nat pan rated ruteui 
A ftbyddereb afn-rtitd. 

UgK. Bb UgtKlyH .- M.A. 1. MS [cf . 



5t Daviea registers the word, but offers no ex- 
planation. Pughe'a 'indifference,' which also 
occurs in au O.V., seems to be the reverse of 
the sense required in the preceding extracts 
and references, which comprise all the known 
instances of ita occurrence. A/- here does not 
appear to have its usual privative force. 
An-. 'A/nved' in Caenodyn (X.A. i. 4S 
may be the same word, but the passage 
evidently very oomipt. Compare the follow- 
ing modem use of neutd, which evidently de- 
notes dispositioii or incliuation : 

I'm qnAf Dwyn yw aven, 
A'i chamrau yv Ilwjbnui h^.^-Iolo Morgnntsff. 
Afiiewidioldeb, «m. unchangeablenoss, immu- 
tability. 

NiB A«Uir byny eithr ar a wplilor yn amMD ou ansbtm 
Duwyn imn«iriuoldB& M V'''"™''oW'*ntod a'i uliHa a'i 
taiitd.--Barildag, i. BM. 

A£aif«r, -oedd, am, a number numberless. 



A&oeth, u. not bare or naked ; .covered. 

Sef y bernir tn delic ef [rcledd] geral 
l/5ioe« y bo, ot- -"-"- "-■--'—■- '- 



i^/itotvt J oo, Qie ueur. aa nu uy^ir, so ma 
byn nadyn na byw twjbod o'rhoU fyd,— 



Afol, am. a dialectal variant of A/al, q.v. 
Afon, -ydd. t-oodd, */. [C. a.w, aiwn (C.V.); 
Br. aitm, auotm (Catholioon) ; Ir. abhan, 
amkan; Qa. abhuinn, amhatnn: Ml. ami*; 
L, amn.-.] a river. 

An ygyt ahjmny llynnen ae «.om«W Wl*" • "^T^ 
(tenofluedd byetand yiydd yoddy. Ac eilhyr ypwofddoi* 
ydrird™t«i.yffreinct«irii«« *™"*^°°^,l7^ P^S" 

Aphril. 



larhyt ydylfryn. aphont awclyntM 

... iir y bont or tu draw yr or" —~' 

guteUdret.— JTaiiis^n, u. U (cf . BO). 

Albuhwntyi-inyiiydyniiieV""- - • Acynaytedawd 
Perrdur racdaw. ac y deuth y dyflryn yr at— 



iryDt awalynt 

(rf. iii. SM]. 



Y bmililD yua ae vilwyr y gyt ao *d 

Tttir n/on synl B rifwyd , , ,^ 

O ddwyfron Pmnlnmoa Iwyd.— fam***"- 
Tr holl o/on»*( a Kdant i'r m«r . . . o-rllo y daeUi jt 
afoHyitd^ yno y dyohw^ant eiJwutb. — Pity, l 7. 

Afonawg, a. full ot or abounding wiUi rivers. 

Afbnawl, a. relating to a river or to rivers; 
fluviatile, fluvial ; of or like a river. 
Criifanc y Mn aftmawl, river crowfoot ( Arnun- 
eulut Jlupiatilu).—Uugh IMvi«i: Welsh Bot. 
55. 

Afondrig, a. dwelling, living, or growing in 
rivers or streams ^ fluviatic. 
Liytiau a/ondrig, fluviatic planta. 

AfOD&Tcli, feirch, tm. the river-horse or hippo- 
potamus. 

Wele, rn «". yr 'Vi^«"*, yt h™ • graaia gj«ta) » 
thydi.— flr. r*. Briiox; llyfr lob, il. IS. 



Afoul (S), V. to flow as a river ; to flow copiously 
aud continously. 



Yr oedd yr a/onig Dhwod yn gymmydoffea holt guiddo. 
C/uotiJer Utdlnim -• Owuth, i- W. 

ofl melni tirefo, Uenlmo tiydd. 

DiKi US" - Bl. Aif. !». 
Afonydd mawrion yn <m thfd. 
Yn bir ystumlaw drwy y dolydd ffaelh, 
Ac VdnwMji yn anulr^jion draw, 
Oan drydar oyrobmit oil tui man. 

Caer/aUuKll: Cein. Awen, m. 

Afory, sm. [cf. biirt: C. ai-orow (late form y 
vuru); It. and Ga. laarach, a mararh; O.E, 
mon^] the morrow, to-morrow. 
I>ynC tl ao of b«b yr iarllu am banner dyd rioort. 

Ac wrth bynny y gwnaf inneo orunet yd af i y boreiivrj 

Paiet Ha Oadam autrf tri emya nryt y redw. a mi ac 

eu ragotaf ar vu bystlyo. — Vam.fau C'AaK^Buvf. 1 10. 
I>0WGb yma atutt^ ohwi a geffwpb atteb. 

Mabinogiin,, it X]» (cf . iiL IH). 
Ac ajorg pridd yw'n ffw«iy prodd yw'n gwelcd. 



jm '^.(.itn^ie 



^ro beb 7 Dur y g'wyeil oil yn f (ur. a gftt jno hjrt 
Nyi dyndat ytt. ooy roddi dy grei u ddihoiyddyKV y 

% Afory 18 the common inediaTal form, of 
which tforv ta a modification ; and the modem 
M /<""y (*°^ S*"!! worse y /oru) is a corruption 
of the same word, the prefii: having oeen 
mistaken for the definite article. Words of 
this class do not admit of the article : of. dm, 
tchdoe, heddyw, trannoefh, Irennydd, tradwy. 
like most other words denoting time, afory 
is often used adverbially. 
Afrad, -an, nn. a needless wasting; prodigality; 

OwvU yehydig gun nd na Uawor gaa afrai. 

Diareb. (M.A. Hi. ISO, IBS.) 
J/md jw pob Bfraid.— iMaret. (M.A. iii. 1*8.) 
Er dangam tHmJ u ladnta.— jr..4. L 93. 
Ni benyw a sTiTW a/rod, 

Bbiimili OtBiiim: M.A. 1. S!l (of. TTB). 



.ynufuddl 



frAdyiuAJsth.— 



iinn I>K Brydj/dd. 



Tn fTodyT, heb ban a/radau. 

GwallUT XscHain : Quami, i. il. 

£^ DuiB a'i a/rad, the wrath and curse of Qod. 
— Mabinogi Myrddin. 

Mah yr a/rad, a lavish spendthrift. 

Tori pen yr a/rad, to eut off mmecesBary ex- 
penses ; to retrench superfluities ; bo retrench. 
AJCradaur, a. lavish or profuse of gold. 

Ifor ydoedd afradaitr, 

(yi ly* oid aibya heb ^Bt.—Da/aid oi ewSyni. ir. 1. 
Afradiftd, -au, <nt. a wasting ; lavishment, 
AfiradlAwn, a. prodigal, wasteful, lavish, pro- 

Y mab a/Todiavm, the prodigal son.— Xuc xv. 
11—32. 

Heb gul y gufa o rod yn nfrailinim, nen jn tnafndd. 

Afrodlondeb, '\ 

Afradlonder, / «m. prodigality ; extrava- 
Afradlonedd, >gance; lavishnsBs; waste- 
Afiradloorwydd, \ fulness; wast«. 
Afradlon'wch, ) 

YmAe Imi yD a/>ad^rw^^ Q beth Bydd wartbfATTQCAclk 
' 'tta^aTd: Holl Ddyledi. Dyi^ tUL IS. 

Til uwyddaldeb diriud '. a/nzdlmdib ; uliywioffriTydd ; 
u T'genJDsdM'd.— Vjn-'. -irch. iil. sat. 
O bab afnuiIimU!tA J penaf yw aesajyd. 

flit if vox; Bh. B. B.i. 1. 

Afradlo&i (0), V. to waste needlessly ; to lavish ; 
to squander ; to waste ; to spend prodigally. 
Bwn A ^ybuddwyd wrtha, «i fod of megya yn ^fra4hni 

Afradloniad, -au, tm. a wasting; lavishment. 
Afradlonisid, a.pl. prodigals, spendthrifts. 

At iffradkriiaid Diwyn ei lai*.— DairitJ Ddu, SB*. 
AfradlonwT, wyr (a), am. a prodigal ; a waster ; 
s spendthrift. 
Er i cfavi fod yn a/miUanwiii-, > ibedee ymalth oddl mth 
DdiMr, ae irofl cybyd, tose efsTU barjd i'cb oyfarfod. 

GaltDad i'r AnngfJtw^edig, 81. 

Afradu, V. to waste needlessly; to lavish; to 

squander ; to waste ; to spend extravagantly. 

Afradus, a. prodigal; extravagant; wasteful. 

Tri phetli ft wnfcnt wr yn uighGnitB : ei vrmig ya Tocitiliu ; 

« dylnryth yn mlliu ^ ac yntAU yn afradvt. 

M^. Arck, iil, 75- 



F^ na bo i ni na tbreulio dn sercbiadAU yn liiy ^radut 
ar giMg bethau, nac elo arbed gormod Bmynt. 

/M, n™u; Boeb, Oriit. B3. 
y pltntyn a/radvt, the prodigal youth, the 
prodigal sc- 



A'm troig], y li 



Tr wyf flnrm n yn bwriadu traetho fr onl 
Fa gu, giredi cbwi 



L Tdrnt debyff i diHisf y 



fvsi^"li. 



yn ei oi wyllya.— fl^i ft«*on(.- C. y C. u. 19. 

AfradwT, wyr, nn. a prodigal; a waster; a 

lavisher. 
Afradwy, a. lavish, prodigal, wasteful, profuse. 

Ti K^lwydd bylwydd bolion nfradu^.—itaan Ttw. 

Ei d^ aydd heb drefn, ei deulnweieien teuLtar ae afradtag 
ynt.— If. O. JVjAi.' E.U. i. a. —o -» , 

Mi dybyg;«o fod yr olwg ar yr haelioni afradaa yma yn 
CTBu hyfi^awoh dirgel.— *j(/i;niij^» Hsrwy, 118, 



Afradgn, genyf fl 
T caffai oil a ddylal.-^ IT. O. Piighi: C.O.iii.loe. 

AAaid, cp. afreitied, -iach, -iaf, a. not neces- 
sary, unnecessary; needless; not wanted or 
reqtured. 

Bag anyd aTmyd nyt mr^U.—Cynddilw: U.A. I. attl. 
Afraid yw i mj y^rifena atoch. 

i ttor. ii. 1 {el. 1 Cor. Til. 37). 
Oferydaitb,iV>aiioedd.— ffiwwy Oini»i,3«. 

Afraid, reidiau, «m. what is not necessm^; a 
needless thing; something not wanted or 
required (at the time); superfluity; extra- 
vagance. 

CU«dyV>w<<lddiagwyld;iaid.— ZHarei. («.ir.] 
TriphHthoy'nIlygrn'rbyd: biOobder; afrmd: agwnr- 

dod.— BonWoj, i. MS. 
TriaAoidbyd; eribiwrmuel; dryoh i wr d»tl ; nbwiilod 

i WT unllawiawg. — 2S^, Arch, iii. 141. 

Afroslawn, o^graceQess; nugradaus; flagitious, 

impious. — W. 
Afraalonrwydd, | tm. graoelessness; flagitions- 
Afrasnsrwydd, ) ness; viUaiuy. 
AfraaiM, a. graceless ; impions ; flagitious. 

7e nwa Bimart ^^ranu 

Bowl* a'i rant ma nobl Syr Bhya-^fpr. Fyaflwud. 
Afirdwyth, -i, «m. [afr, which is not found 
separately, is explained by Pughe to signify 
'a flowing principle:' it occurs as a prefix 
also in a/rddwl and afrllai] ' the impiise of 
the mind ; passion ; ' ardour ; impulse. 

Ardwyresl hael o ha Rodii 



Drod yi^wnn yigiryd dan hanner 
Dntd amgrdtct'* anunryth BmniTer, 

Cimddilw! M.A. L ns (of. MO). 
Eae avrdt^th avrdnl ^yvydcdt- 

Cgmldtly,.- M.A. i. 1161 (of. M8), 

Afrdwytho, V. to mffle the passion. — P. 
AAddwl, a. solicitouB, anxious; pensive, sod. 

Davies says 1 ' trwm, hwyrdrwm, musgreU, 

llesg, swrth.' 

Kin ottai dry hit yn arvol malin 
NEm g'voaei arta ateiriul 
Towimn a in y bmi Tytnl. 

lirmmh ScH : M.A. i. 181 (el. lOK). 
1*811 ostliam ni gan Atthnr i^tniwl rynheu. 

TaSetiH.- \.B. a. isa (al. Ul). 
Ounui klod Hsilia benffla amrdid. 



,)glc 



Cult tuil < molTaot nwl EUori 
CntI «ii netwl a/rrdKl erdi 
Cband f nurwDiid IDAWT drueni. 

Sinim -b Q^atdimai: U.K. I. SW. 
O euea Dmrrdd Dead u r* nuddwl 
Ac OBud a/Mrdd»i oi cwddovia. 

i?^^^ £ci|/V<u.' H.A. L SU. 
Ta da ]r guapm beb gnrmpau yn WrdiJ. 

Lifga* OtBT.- M.A. L SW. 
Rh* afrddmJ 1 meddwl nun, 

l-w lUwn ddaOl m ddl»o.— B™i Wy" .' Bl. Art. 198. 
Afrddvl, -pi. efrddyl, »m. Bolidtade, anxiety. 
Ba kednTD or tri trinhwD 
Tnul Efrei afgriwl Gtowtoil 

% Sometimee written awrddwl by vocalisation 
of the /. 

Et pan iroDu* ffdiuiB fanwl, 

Onawd rv orddJ gtmiad omiMW. — ^rpuvf Omfai, DO' 

Probably the some word is intended in the 

following extiaot : 

GwjrTiyfld dmion df fBddwl, 

Ym nihobtuno th ma ar^tti: 

Xia hairdd b>id pechmwd k chvl.— Xfr- 'f "^' ^ W. 
Afi«ngi, V. [rhengi^rhwigii==rhyngu] not to 
pleaee or satisfy ; to displease. 

"Sy dathoed j nunh&wo yw jt afrti%si bod yr ^wt Uo«d 

r wtell.— S(. Ortal, \ 1«0, 

Afreidiol, a. lumeceaaary, needless. 



OtM. IM. 
1 ef. — Ortm^on Ovtin, 7S. 

needlessoess, unnecessan- 



Afreidioldeb, 
Afreidiolder, ) ness. 

TUr soniua nlfjddTd : Ikitb gTfrng UMclnr; doavutb 
uuhnhiiu ; te aJrtidioliltb.--lltv. Ardi. ill. m. 

Afireidioli, r. to render uimeoessary or needless. 
Afreol, -au, >/. disorder; misrule; disturbanoe ; 

irregularity ; anomaly. 

Tala o Henri Traihin y leirl] » barvnelt y deynu y 
kyfreitben oa ifOHodeu y biu«d yr ^/TMt oe hH4iuwa y 
ry^^toat » Imui orenhln.— fmJ jr T^wgKfioH, 80S. 
Rho'i ml, rhu q/ntd fnitb 
Oferfeiidd. ■ jfu'ii fam^fajtb. 

frr, Fft/lioyi : lolo lbs. US. 
Anbamaf petb yn y bjd yw dJwyvio uniiTTg ao q^fe' 
dynion.— R. £lio»/; IJwybr Hyff. »It. 

Yt hwn a c«yd tj boll bocbodan yn agond o*m blaoi. yn 
«o Uawn bwy*, tbuedi, u q/iw'. 

Or. If »■« .• Yityr. i. 8 (78). 

Afreolaeth, -au, ^f, irregularity; disorder; 

anomaly. 
Y dywededig gftrjn afrmbuikan a beian eyhoaddiu. 

Ca-o-o. KtlM:,tit, M. 
NLd ou dlia banflB am ddim a^wJ«d a tber^ifl a wnaeCh- 
ant droa avDa i dii cfaut o flynyddoedd ar ol iodynt gael 
oauiadlvLidycbuyiiia,— rAa>7Aiim.' D.P.O. i. 8 (Ift). 

Dan Dawdd y torfri^ a'r ^ra0la«f*. dan yr fayn yr smill- 
aKOtyroTuehaflaetk.— Oinauiiuii«.- Han. Cyin. 786. 

Aft«alaidd, a. 1. irregular; anomalous. 

Pertm/ddiaid a/reolaidd, irrepUar Torba. 

Betfao yut ayTwriniilil mawn dwyffodd— drwydaUyriid, 

■c o*D »i»wt»w sa honaJn. — D^ A. Joita: ledtb. ooii. 83. 
2, irregular or dissolute=:jl/r«o'u« (2), q.v. 
A£r«oledigaeth, -an, «/. irregnlarity ; anoma- 

Afreoladd, 1 *m. disorder ; misrule ; irregu- 
Afreoldeb, } larity, anomaly. 

Owiitaii!bietac>tfrvlM,.—K.Cttlm! Diff. (IStS) L 0. 

A&eoleiddrwjrdd, tm. irregularity, anomalous- 
ness ; eccentricity'. 



Afreolua, a. 1. irregulars: ^/r«o/aiiU (1), the 
form more commonly used in this sense, 2. 
disorderly, unruly ; dissolute ; irregular (in 
conduct). 
Bbyboddlmih y rbal ifrcn'u. 

I Tiat. 1. U (cT. 1 Ttaea. iii. «. I, U). 
Yr kn yn iiniit bjau llywodnieUiu afnabu Dhnalia 
gwyniaa dyniw pKhadunia. 

LI. a. Guf^di, Hydd B. RwediT Pa*). 
Piry a ddicbon yn ddiiionol osod allan faint dryRiofu ra 
ffiraled yn yr b«3ydd rfhopdd BTnHnyflogion yn A«eg 
yng nglvd yng nghylcb t^ y tatb wi afrraln, r 

Ed. Inmrs: HOB. iii. WI. 
Oochd fod . . . yn afrroim fd y mflr. 

V.;r^. UK.»rf .- Tti Ad. U. 

Afrsoluarwydd, tm. irregularity. 

Ymdref^n yn dra mawr am Ivyddlant riiyw bloityn . . . 
acbael e[ nooli arol ycwbl,<rwyang h a l J in* bngQqA"^*^ 
rvjnUy pl«iitynbiRiw.— frtrffvd|rdd, v. sn. 

AfrMwm, ymaa, tm. unreason ; unreasonable- 
ness, absurdity. 

Y rheamn achat yo'r -i/Vuvk iiat. 

JTsTjiui Uv^.- Tti Ad. St. 

Afroajrtnol,!!. irrational; unreasonable; absotd, 
preposterous. 

Nid yw and nfr timtl i wrna t(dd nac awen na'i cfayiRVd, 

Ml a at ym nila«fi iymmymnynflnghyNdiyddaiinawm 
Hfrafmol kyn.— 7im« Wallur: I>wy Brtg. 18. 

AAeaymoldeb, \ tm. unreasonableness; ir- 
Afresymolder, ! rationality ; prcposter- 

Afreaymolrwydd, ; ousness. 

Nid ydywrtiesym4ldebDpni}/rrjLnp;ij4&ymddan^t«adal 
ffaiUi yn dditran bob amrna i "braH oea wrUibroa td girii- 
fonedd.— .ItMli/^iU, I, 480, 
Afrewedlg, a. unfrozen, not frozen. 

Hya aydd yn peri i U noSo v wyntb dirfr a fr t m m H t. 

I. 6. (!riri«<,tM: (Mz.ttt. 

Afirif, a. numberless, without number, innu- 
merable. 

Ond Uaoedd a/ri/, nud rpJVi 

A aoddynt mawn gorddrrnder mflc o wyll. 

W. O. Ptplu.- (Pinion Avcn, 14S. 
OanwydqiH^BginMi,— ZinnH*^.* Bl. Art . «a (ef. SH). 
Ea Imflif ITS a'a b«ftaa. 

ftffo rrkiinf (Gwyliadydd, iii. IM). 
A dwyla* nW/ (D-da llafur Win, 

l.D.F/raid: CoU Owynta, 1. 8M let. W31. 

AfH&id, t.pl. evil-doers; malefactors. 
'HjnflBt ymync y cenb 
au maJ pe byddflcb -^- .- 
. toliannu Dyir *n y ^dd it 
.oia: lPodrii.&. 
The original xaxairoitin' is rendered ' dnrg- 
weithrndwyr'intho A.V.,and'dI7gwedtllTed- 
wyr 'in the corresponding passage in the ' liyfr 
Gweddi Oyfeedin ' of 1567 : 

Ac ymddjiprcli ac yiiiwreiddiiit da ymplKb y Ceoetloedd. 
pan yv ani jranjyn dywedrt diirc am daooub, nun 
am adrsguvlhrfdieyr, yddynt aJln . . . roddy gogwUBiit 1 
DdBiT yn-dydd y gorwy.— raw AJ nMdi'r fiut. 

K ' Afiieid,' a variant of ' a breiaid ' in Harw- 
nad Cadwfdlawn, attributed to Llywarcfa Hen 
(M.A. i. 121) may be the same word ; but the 
reeding of the ' liyfr Coch ' (A.B. ii. 277) is 
' abreieit,' which seems to agi«e with the text 
of the Myvyrion copy. 
Afrifbd, a. 1. innumerable, numberless. 

Traidd ci nnth trwodd 1 nen, 

Tfaidd ciritu trwj ddaiaren . . . 

Traidd n/HrVd blanedau, 

Traidd uffem a'r gEthera gan. 

WUiam Wf, C. y F>m, 



ju.v^.(,Kit;ie 



Salmau, ii. xl. 1. 
b1) QvT^Hn, 



3. intolerable, insufferablti. 

?■ betb B drbnrn Di. neu a tin 



a,uiitalclHidd^/.V«' 



!, extreme, exceeding; very great. 

Strt iigrit •i/n/td 

Onin helm BAia^ uel oju s«d- 

(friffyid Li^nd ah Dn/sM. 
Hse rn ddiammheu en bud Tp cynmieiyd pucn ajrijed ja 



if^a f gelfjddrd i'w dugyblio 



eirlyfrh' 



Culled a/ri/td Uvr Mdd, 



Brs^fdd Hi'.- Gmiitb, if 



Ood cynir pwi] afriftd, 
Oer afriftd, excessively cold. 
Yn afrifed, innunierably ; immerisely ; exceed- 
ingly, egregiously; very; greatly. 
Afrifed, Tn. an extreme ; trouble, strait, diffi- 
culty; harm, injury. 

Ac herwydd hyny. biynyddotdif yw duymawdd amser \ 
rn'rWErin oedd niBwik llqdded. neu yin^mewa a/n/Bj, yn 
Fblynyddoedd hTny, yv y Bjlfoa cAdani, 

Qweddlwcb dran y rhai a vnel enJWMi ;• a/ri/vJ, ■Brhtad] 



I. and s.cl. a countless number; 



AfriCsdi, 

Uo^rayB lledl iVr&«j> a Bowyiyd.— rnlluiN ,• H.A. L Bl. 

Afrifedig, a. not numbered, unnumbered. 
Afriflu, -oedd, am. and t.d. an innumerable 
host, multitude, or army. 

I^ Uw oniretedig ft ddnl ju ?a rtiodfta 
Afrijbt 9 trx drwT y nuith euurderati I 

Th. Ubi^ Jmn : Cdo. iMW, US, 
Bdiuai a/rift y « o'r Sortsfen 
Ai obnJUi J gelVn, al anhyll djogedfea. 

Bvrdd y BfirM. UM. 

Afrifb, V. 1. to miscount, to misceJcnlate, to mis- 

2. to miarepreseut ; to abuse ; to a^ont. 

Ni»gelliJ-m«rwoldebn»bodripheth; set jrdynt, bMi** 
aw Dnw : o/rifciH cnw Duv ; u afrTviaii enw Dow. 

Jolt Jfu. 4e. 

Afrilbl, a. innumerable, innnmerous; countless. 

Mae yn hen irjbodiu Tod n/rifiivl eoghreifftian, ae o»- 



Afci&ldeb, J 

■GanBfayiiu 



innumembility. 

drills; 



Afrill, 

broadcast. — 0. V. 
Afrin, a. not secret or mysterii 

Ymdyngcdu ydd «yf yn euw a ch 

imaddai^iHtwydimL-- ^■'— '- 

aa liyo na bod h^d f] 
dya^edo imi, 

12 



Afrinedu, v. to divulge (a secret or mystery) . 
to divulge, to disclose. 

Nil ^ellir beirdd o honynt. ac nie dylid graddan a brein- 
hu with iterdd iddyot. achawi eu bod yn a/rimdu gwj- 
bodau baidd, ac yo ««d ar anuygg "= asnTbodaeOi. 

itlMMT JTt. TS. 

Afrino, V. to divulge (a secret); to divulge, 
disclose, or reveal ; to profane. 
A/rino tnw Duw, to divulge the name of God ; 
to profane the Divine name. — lolo Mtt. 46. 
Yoa/rinnLl>nnjnetrifet.-Cv»Afrf».- M.A.).H9. 
Nid addwyn i dd^rn diddaw, 
A dwng Ksm afrinaw Duw, 
Ei tjm^ i deg faecoL 
Draw*D y ne/. beb ei droJ'D ol.— 5wa Ge^t, 
A/rii/i'a oter ynisl 

£nu> iikni, ac Baen ei dal.— ffyml aA 7euh Onawi'. 
AMnwedd, -au, a/, wbat is contrary to virtue ; 

Hael werth '. ebr Daniel wrtbo. frenln. 



ledd. yn dangoe callineb rba^iol 

Afrllad (ig. -en, /.), t.d. and pi. 1. wafers; 
small tbin cakes ; cakes. 
A'i Bas fel a/rU>ti o m.—Bci. xti. 81 (cf. «xi». i). 
Briollu teg a/rUad hael.— /tyai ^JnjMjm. 

■2. eucharistic wtifera (in the Church of Rome}. 
Ny bydd offririad na bendioto afrUad, 

Kenevinshit mab Vjn bot na phab na ffjryt avrUal. 

Catrntdgn: H.A. i. «». 
Tr ovrUad yVr onswd 
A'r B^rln yw^r gwaedrawd. — tfyv. Arch. i. 93. 

AAll&dea, pi. atrUad, if. 1. a water; a thin 
cake ; a cttke. 



awell,a( 



d, Santuei: OrotiuB. 
Hi ddiflan y lAu nnwyll, 

-n nia gellu" o dwyll . 



aa/rlU 



dwjn ni« gelltr o dwyll ; 
diffydd swynt bynt hTflrof 
jl/rUaJai nen y net.— A. -b Omiym, U. as. 
2. the consecrated wafer (in the Romish Church) ; 
the host. 

S^ yv hAjt atBfffVaden. — Arvyddion cyn Dj/dd Bnstod. 

A. BethsTddynyaantalddaacrateno'rallor! D. Ymae 
TfSU Oriat em Arglwydd ni. gorff ac enaid ; telly bl y mae 
yn y oof. ja gyrtal ja yr a/rllmlrK ag yo y oaregl, wedl i'r 
yffeiriad gyeeegru, A. A ydyw'r bara yn aroe yn yr afr- 
iladfn a'r rvia yn y careffl wedi darfoa i*r yffeiriad gy». 
aesral—MBTf' Clirnag: Achr. Oriat. M. 

Or wen n/yrUadnn ai Llsdin y gwnaethbwjt 
Cort mab Ueir mavr vifinhin- — Hen^rwft Ma. 

A/rUadn o ddeilen dda.— ». "b Gu-i/ff»i, xl». M. 

Fb'q dy^lt maj eu Duw yw o/rK.i l^n -vedt el ch jnegrn 
gan yr offeiriad.— /eremi Oikh, !£4. 
AfrAl, s/-m. [contr. of a/reui, as rhSl of rAeo/] 

Annfi vii* ydoetb Fredrio ombenodyr Buvein a tlu mawr 
ganthaw hyt yn Ru-vein atborri cglwya Pedyr agwueithur 

Oud « ei blant et (trwy a/rtl) 
Nid Int yn ol fy nghyhaiUi. 

Bdm. Prfi: Balm. Iixzix. SO. 
Iteflch o/rdlTntalah I.y, 

I gedyin yn ddmlg wedy.— ifuw Maclmi, Jli. E. Wynn. 

Afroldeb, em. disorder; misrule; irregularity. 

Yr ydya yn Llelain yn groch arnom heddya . . . ddartod 

aidd.— Jtma cyfii! ma. imij t. 



.JM...V^.(,K)' 



glc 



Afrolu* (o), a. [»fr61]=^/r«Ju.. 

Feuwi s Hemriuii eydd in n/ro'"' en bedrid ; let, t'u 
mrnfdiad jn uiw^dsl. — Z/anrrper Mw. 4A, 
Afroagro, o. [corr. of amrosgo, as if am- wore a 
negfttivo prefix ]=: ,4 mriMtfo. 
Aj ol iddTnt aiffo «i Mffym n/rv^s'i- 

Sian Rhsdd'rth (Ojd. Didd. S7). 
T poLkui srdd Adpryn n/tvMgo, v: o funt alftrch. 

Bub. RobrrU : Duu. W3. 
Fob llmiF hfd ■ hen en mvrbitD, 
Tn heiatiu grog nftm^ lawn o wm. ^^ 

Arntbrol tt t bordlefAa d fryuunendwTketh Bydd yn 
diipedain trwy wlad y gryddHU, wtth WFled PU peri-ainpvr 
711 yi^^vyd d es^U ofrotgo o ddeutD pedair troedfedd & 

Dr.'i,. £>fi«inb: Truth. UtD.461. 

A£rugl, a. not free or fluent ; faltering. 
Afrull, a. ilUbend, niggardly. 
Dyn a/mil, one veiy much to himself ; a nig- 
gardly or penurioua ■petaon.^QweiU. 
Afrullder, em. illiberality ; niggardlinoaa. 
Afrwydd, a. not easy (to be accomplighed) ; not 
actmg freely or easily ; difficult ; enton^ed ; 
unproBperoua. 
Angeu a/rwydii, lingering death. 

Agfaeu JT eneid biircld aunegl 
A dav uu buchjBV ambKhriryt. 

EiTiion ab OiraMmal: U.A. i. BK- 
Ni rjdd (niM'B K-wUrdd *i giwith), 
Wilog aj-mu^d, le i ^yfisith.— tfrvnwj; IVniii, loe, 

Afrwydd, -on, «ni, a difficulty; strait; mis- 
fortune. 

ArchiTD in ted nefevl ei 1^ 

O rodd deQwng ^^w Bn'thda 
Bhag Bjraiii£x % tind Bu»on, 

OorddoAaa MyrMia : M.A. i. SSI. 
A rhvydd fjdd cy wydd y Cyw, 
Ac qfrayitd atrl ci gyhyv. 

(■■n,/. ;,iBj;i* D-/idd.- lolo Un. «e. 
QuTd (pndl lAHd a/rwydd.—Iabi Ma. »K. 

JAwvdd-der' ' ^m- difficulty; entanglement; 
^wjddin^; ) ^Propibousness. 

Tri afivrj/dd'dtbKntHitf: DDSwaiClk ferwUwuwg; jirrach 
•nhunawg; sdu lom Usfar-ddrud.— Jfj/f. Arch. ijj. 140. 
A/rvi/dd-drb yn dy bertsdd !— />io«». [i>.) 

Aft w y ddiadf -au, ^m. a maldng difficult ; a re- 
tarding. 
Afrwyddiant, *m. obstruction. 



Tair Uwvbr at 
tyn i ywul ; Uw; 



.—Myo. ArA, iii. M9. 

Afrwyddo, v. to render difficult; to retard; 

to hinder ; to obstruct. 

Blug Dfn i hyoy rwyntm m n/rwifrf*! »ordd jr Efengyl. 

Manu Csffin-' Diffyn. i. 7 (of. vi. Ift). 

ji/rwfddo Ufimr o ddmv fwiudau a chynUwynuni y«- 

trjwgar.—H. Llvgd: Llwybr HylT. MS. 

JUtwTddol, I a. rendering difficult; entang- 

Afrwyddua, ] ling; retarding; un)iro[ntiDus. 

A ndo fiwydd i/rwjiddatel 

Y gyfnith dditfuth i ddiaw1.-/nui> Lliftd Sitffrai. 
Aftiryddaf yw Ei imWion, 

.4/rWf iMu dd' fn rodd Hion.— XAyj Csia. 

Afrwyddor, -iou, im. an obstructer or rot«rdra'. 

TatyriaiD, nodais yn avr, 

Y freudd*yd i*m aJnrgddawr.^D. ah ^vil^n, cexllz. ftS- 

Afi-nyddwT, wyx, »m. aretarder; anobetructer; 
an unfortunate one. 



Afrwym cdiga^th, -au, »/. unrestraint; die- 
obligation. 

Afrwymol, a. not binding or astringent. 

AirwymgfiM, a. not given to pomp or sway; not 
forward ; unambitious, unassuming. 
Tri brodn boddlouleb : hMlianiu ; aafnelhai ; mc •/■ 

Afiryn, a. unsubstantial ; uosolid; frail, weak. 

AInUd i briddyn "/i-j", 

RJiaf H Duw, fnint fu rtiyf dyn, 

Ue rhyfsdd i talcbadd tod'.-(}mlfm <d Sr/nfi,. 
Afrya, a. [af--l-br7s] slow; tardy; lingering-. 
HwrUa ar ffir brli u- (ryi, 
VoBm ddwfr, u fydd a/ryi.^D. oi GwUym, Ixxy. 19. 

Afiysadwy, a. [ihys : of. dyry», dadrya} inex- 
tricable; intricate. 



Tn n/rf Mdotr, nm ncth anehen dinit£. 

»: O.Ptfhi: CO. *.««. 

AfkysMld, im. slowness ; tardiness. 
Afryw, a. unnatural; oontrary to natnre; not 
of the same kind ; nngenial. 

V J \teDJW a afrfKttaA.—SiaiBn lit On/on: HjL.i.SK. 

Ban a dwtr, bwiiid a/'*". 

Bi dad er b'i boll daid oedd. 

/. Ek. ab Itwa Llm^d : lolo UH. SB). 

DyinB.'l' difrod a aihlyrandd, mor alasthni, md-tnt 
ffwrthwynebwyr an (rnddyi^, — yn Oymry aftyv, ^ym- 
buiDt aff yn Suaon «ddiffna. 

Tat. ah Tola : CosltHHI J Beiidd, U. 

HWT a arftruant o'u ben trad a>D twTll, TT hyn Bid oedd 
afr^K iiAynt.—Itanft Ceitfdtofdd YngM Prgdaix. 

Nid a/T^w 'r glfinaid garv'r dyfredd. 



Aflywiad, -au, sm. a degenerating ; degenera- 

A£rywia«tli, -au, if. degeneracy ; degeneration. 

Afiywlo, I'. 1. to degenerate; to decay; to 
grow or become harsh or rough. 

2. to denaturalize ; to deprive or divest of na- 
ture or essence : to debase. 
A/rywio mw Duw, to deprive God's name of 
its essence; to profane the name of God.^ 
lolu Mil. ij. 

Afirywiog,^. 1. degenerate. 2. harsh, rough; 
_- — jss-eraincd, untractable; unna- 



tural; ill-natur 

Pafuddgaahyny y'rli drowyd 1 1 

girlnwyddini ddielUirl— /cr. ii. «, 

Un ydwyf , baa bwyf heb v^ 



Od OBI wJt i dryrfoe. dra*, 
A/rfy.-iog, i'n diftlair.— ffroi."'* Oieam. 87. 
Ac dIh vw dir achoa . . . ydylidbaruo hnmafrritioatit 
gano.— ci/"""!* y Bcirdd, lOS (of. K). 

Tri drn B fyddant mor ben a'r ffoidd U.-WI ejn j malcr : 
oelwyddog; p/ryviog,- acbybydd. 

My,. Arc*, iii. iS! (of. ITS). 
Tywydd afrywioy, inclement, severe, or roogh 
weather. 

TmdrHha riiyv ychydig o bonyut tod yu brfioeDnol ym 
mbobgwasanaeth eglwyBlg, byd y nod ary tywydd mwyaf 
iifr>™?.— CVifAjimm.U.W. 



3. improfter (as diphthongtt). — Dr. Or. Robertt: 
Gram. 24—32. 
Ftonld Binlaniii Owrnedd yir honao, u aflyming j bid 
■ gvOiIat. . . Otfriiu wuill u Imfuiud a/rnaias deirilsf 
Tdjw r liui h^n. — Ltonmur Mi. Ab- 
A/ryuriogiatd, t.pl. non- congeners ; harsh ot 
roogb ones. 

Tna'r iMOodiiid g, c; joA't afrsunoiiaii, nid ungea, 1, 



AfrywK^i^ I 



to degenarate ; 



i^n, V- to degenc 
rough or harsh ; I 
make barah or rough. 
AfiTwiogiad, -au, sm. degeneration. 
Afrywiogrwydd, irn. degeneracy ; harshness, 
Toughness, sharpness; rigour; indemency. 
Fu velodd Haocabcua (od Nicanor yn afryvioiAch wttbo. 
a'r ffrfeOljiah srleroL yn ddrengAch, efe a ddeallodd da 
ddi^ yp ^rj/toiasrwuM hwair o'r meddwl goreU. 

m CrutiTB peri addfwyo- 
tmnb : Hu. J Ffydd, 238. 

Afrjrwiogyn, »m. a surly fellow. 

AAywiol, ,n. degenerating; degenerous; de- 

generato. 

Aflumaidd, ouudd. cnwaioD, 
4/rf ■n'an-J, bollHl bjUiou.— Tigid ; Omitli, M. 
Ata, -au, «m. [C. qui, avy; Br. afu, a&u, eAu, en; 
O.Ir. 00, Da, (H); Mod. Ir. ao, aodk, aeght ; Oa. 
ojUa, afAu ; Mx. aane] the liver : alsocoUadiiu 

Cmfn yr V yi oedd.— /™i» BriiifiU Hir, hf. 
O glrn nm dyn wlUi ri uaen : kymer t bore pui grootto 
jr MdI Idiui guin dy b«der) y gyglennyd. 

JUnMyyun JVv^li, I. 108. 
Dod belh o gBloB r pywodyn oc o'r o/i amynt. 

roMfiJ. IS (at. TilL 9). 
Y HiHC Virgil yn dycbymmyv fodadoyD ilwiEHlH ya OQai' 
aeyndryllio ei n/" eJ bobdydd. . . A pha beUi yw'r aj«, 
•™ y BTiliTbod gnofliu a plioenng bob amwT ! 

Elv Leteit: Dr g xe l ina, 30. 
A/a gmyn, white liver. 

Yr (Kdd dpwrder rr hea Fryta&iaid meffyii yu dd r aa p 
jigag ar m *«/» fylh.— TAm. f.-.iM.- D.P.O. i. a (IS). 
Llyiiau yr a/u, livergreen {Marckantia).^H. 
Dame»: WeUh Bot. 110, 154. 
H«paticB, ywenllya, Ugtiau'r a/u. mterliya, olnstyr aaeo, 
tyngfooydd y &n,—M«ld!itVH X^dd/ai, 38B (ol. ISfll . 
The name is also given to the liverwort (LirAen). 
Uassa #r a/n yw ea hymbotlh penof y pryd hwnv. 

GKsliatsdd, i. SH. 
Afiisd, -au, am. 1. a diBt«niper of the liver, inci- 
dent to dieep; the rot: also called dwijf yr 
a/.. 
IWthi dafad yw blith ac o<^ i tod irentbi ; s'i nirfod hyd 
" " " ■ ■ ' ■ ■ '. anad] yn j gaffo d thalt 



AAiaidd, a. resembling the liver; hepatic. 
Y llieifth afuaidd, the Order Hepaticae (in the 
Liniiman system). ^/fuy A DuTta : Welsh Bot. 
109. 

AAiol, a. hepatic, bepatical, 

Aftrch, ffin. r=»wcb] 1. the edge of a tool or 



2. sharpness; vigour; livelinei 
ardency, ardour. 
Yd ei a/uWi y brenin a yfai 
Onnod o ddiod. gwirod a garai- 

Atwtn, a.^Adduyn? 

Un afiotti [al. aT a«i. addwyu] o uedi glaear. 

C/nditlii,: VJl.. i. HS. 

Aforlad, a. expatriated, boniahed, exiled. 

Pan nad oedd gan y wsddw dlawd. yr boa a dderbynlodd 
" " ( bropliwyd Diiir, Ellas, ootd dymaid o flawdmewn 
e ychydig o oel mawn ydl^. 

Edward lanKa: Horn. iii. 21. 
a exile, a banished or ex- 






Hyayi 



Afivlad, -on, am. s 

patriated person. 
Afwladaeth, -an, tf. banishment, expatriation. 
Afwladu, If. to banish, exile, or expatriate. 

ke yn ddlweddat oU d yra allan o'i vlad, a'l ddeul a'i 
a/wlada yn dragywydd.— Mimird lamfa: Hom. fii. 12S. 

o/wiadU ['aelhwladid, ddoolid, 
EdToard /unci: Horn. Ui. IM. 

Atwf, a. sharp ; vehement ; ardent 

Bid lew uDben a bid meg vryd \at. bit avwy unben a bit 

A bid lUidd ar Tlaidd ar adwy 
"Si cheidw wyneb ad na n>ddwy- 

Ron aoael atewg rugyl oidwy ortrud. 

CynAMVo; H.A. 1. t». 
Bu niwed yna arfau a Cvybl^t. 
YsdgcDt a malurieDt idd eu aawdd, 
A beiraj a/wt oycb, a l]a«er och. 

W. O, pHflu; CO. Ti. 730. 

Afvyn, -an, «/. [L. habaia] the rein of a bridle ; 
a rein ; also written awgn and Qtwnj. 
Afvtgn ffrwyn, the rein of a bridle. 

Ac yna dodi aomo ymarchawo arlloat ywaew drwy nirwjfa 
ffrwgn ry march.— JfffMiifffuH, L 10. 
IJatlirei lafyn ueh aayn vch auw^ q. 

CgmbltlU!.- M.A. 1. a*7. 
Hyipya yw gennyfl y deuy dl ae ef hecwyd y a/iojrww. 

AflMl, a. [af-+ffael?] unfailing; infallible; 
certain. 

GniJtydd ab Rhya gair ajfart 

Gwyitfonydd, hoew brydydd hael.— (7f. lAwnd tia/gdd. 
Affiun, «.p2. [affan ?] conflicts ; troubles. — F. 

Lilt T mywn tyn-het tnridet tralb ameiu 

A Bleidut gorllwyt eoreu a^riti. 

Ttl!fii>, : A.B. ii. 170 (of. M.A. i. 96). 
1[ An obscure word. Pugbe (in the 2nd edi- 
tion misprinted a/am) oonsiders it to be the 
pi. of a/an, which occurs several times, and 
gives it the above moaning; but s. v. * Bleiddyd ' 
{afain in both editions) ho renders it 'retreat.' 
Afain (q.v.) comes in the next line but one in 
the same stanza ; so the two words con hardly 
be identical. 
AfEaitb, ffaithiau, -ioedd, s/, [L. afferfio, affec- 
fu«] 1. the affection, disposition, or motion of 
the mind; disposition, affection, emotion. 

yatyr pob affaith y tardd bam. — Jfyv. Arch. fii. 110- 

2. (^efiaith) effect; consequence; result; pro- 
duction. 

1 gymryd Hoyd rhag poenan uffem 

Ac ajfiOt pe c hodau. 

Ornf^dd Ynad Cull! M.A. i. 41X1 (ct. 0,7). 
^eftietflt went aJfam ^eUA Bathaa. 

Ciuitodfn : U.A. i. «28 (cT. «I7, 388}. 
a ddicZbon yaprydoZ nertboedd, ac nia dlmedir 
'"■ — .--. -r ojaUi wedl ei ddwyn 1 



hwynl yn (tweitblo, nee gWBled yi ajhU 
bm.- Ct. Sd,raTd,: Han. y FfyJd. 81-i. 



,)glc 



T gistfdd honno «T'n miiIvti rliwyig sriui, a/ni<* uf hd 
ydyw.-ij, s-.m.,;. Orulius, -i. 1. 

Het anffhyna- 
. B. H. ii, 2 f-MI. 
3. in the Welsh Iiowii, participation in the guilt 
of a crime ; a being accessarj ; guilt of an- 
other man's crime : accessariuess, privity ; ou 
aocessaty. See Lega H'allicrie, III. i. — iv. 

la.^ agmth dimytLof nor tilr piTvi't ar tayr pcn'ft iif* 
UiT kyntaf . Uyuu jtAhun boneniif vo jr fyffailk yr Uoff^ 
fdieth mwrmf ryd t dwl madanay. 

NsK ijfnilA (taUuH a oaw ». 

Or llftd umyueiL dya. himiiv yv y Ikmrnd ny dyly bod 

Defny d hawly Tyd y rieni y Ll&d«ilic hwnnw Ae g\i Btti-> 
fnlion ar yr affeithwr hwnQw luaa rfynt hwy y Iplir wJ 
am affnlfurn a ^wad '.tm loTiydyaelb fiefyd ydjnt ac yr 

dm affrmieu kaiui US dyly ken«dl namyn taL unlanait athol 

nitii advcid mae y rieoi acliid eltifrdion y bidpok y "-'-■- 



Felly y tyni ymalth tfmih j gim*d BwWon o'th fy«g. 









4. an act in which Bcren;! penons participate; 
a plot ; a oonspiraoy ; a crime. 
Oni t»i vybod o h<mom ni oavl o OTist «i hun. a'r Apo«- 
tolion, ac aneirif o bobi dda, s Chrudoiu^D frynt , eu cuiu 
a'u cenOniiu am rr on afaiih^ 

M. (?!(#..■ Dilt. iT. § (rf. Ti. 8). 
Acacd y rba]*ii, girtdirbaith, 
I nffe™ •aelod lyTnii*.— r*. /Vj«. 

9. affair, concern, businera, matter ; case ; pre- 
dicament; ado. 

Dan yt un affaitk hrfyd y mac Uyfr Bdeyrn ; ar ht^yd 
pob un arall ei gyfryw- — lola Morganwff, 
Yt ofdd yntau yn yr affaitk, he too had a hand 
in the matter ; he was concemcd in the aflair. 
—Dy/td. 
6. kind, sort, quality. 
Tair . 
«digl;g 

Afftlith, (life, neither, much less, atiU less [negue, 
nedum)=Ckji^ith. 
A*r ffydd Orutionogawl bon, nid oea Da chan y diaw7, oac 
affaith [* chwaith \ ^on un dyn, yr hwn yn ei KjHen oddi 
allan ... a dybyiru' pi UA yn wir Givtion, a'' I'lo pydd yo 
ei fyiryd a'i veitiu'odo&Id ni yrnddaiuEoa i'r frrrr jinraeb. 
KU.hnri: Huin.i.BB. 

Afbn, »m. I . the nether world ; the pit of heU, 
KynnkyednddacarkynD'i/on. — Ai"prin-- Gododin, SUG. 
CroM Crint damgan 
Rag nnermyfiiB.— J*"'".- M.A. i. 1B3. 



DyD wji glan tffoH cdFcn 



>: M.A, >. HH. 

i: u.A, i. aao. 



A to drwK a diig yn ddidavl 
Yn uhocrian ajfdq uffrroawl. 

StidirSaU.- Ujl. i. SW (cf, SSO, 8IU|. 

2. conflict; uproar; trouble. — J'. 
Affiui, a. infernal, hoUish, tartarean. 

Tiymder LucUTer ae loes affmi. 

Trot y gam arvaeth ItyDvaeth kwyDvao. 

Cunodsn: Hjl. i. US. 
AlEuiol, a. relating to the lower regions; in- 
fernal; abysmal. 



A»FWY8 

Aifknolion, >.pt. those who are in the lowest 
eondilion in abred, or the realms below. 
Ag^'no'u"', rbai yn inclfaoedd abnd. wf yu y Bgweni, 

Affor, 8111. intent, purpose. 

Jr affar rnyned. on the point of going.— Owrni. 
AiFeithiad, -au, >m. an affecting or effecting; 

u partici paling, participation. 
Affeitbio, I-. to affect, to effect, tfl work upon, 

to effectuate. 



Ar yna y gcUir fnrybot dy vat ti yn n^fit^^aKl j alaoaa 
y VDE-wyaaU] pevyndenrbeuyt.— sVf. *Jrrtl, \ 41. 

Snyddau fo^lad »y heddywglutf. 

A mrydd (vlwj^ Kyitl fiKlon : 

A phob fyiTftiih n^-'tkvm-l, 

A liw dyn, acth yii ILaw diakl. — lonrtrCh Fgnslwfd. 

ftia nad o** yo ffy^FuHlino] ddim mwy "ff-^ihiol i ddwyn 
fwTi'ruQrfi^.-;..'-.ir/«rJ.- UoU Ddyledwydd^L^ 1. 8. 

Affeitbiolaeth, -au, ■/. the act of an accessarr ; 

an effectuating ; effect. 

meitys y jml'^unday nefol, na Ibanu jwlh o'u Jn/wilmloM* 
ar cieb imflaiJ.— fi./. Hama/I.- Holl Ddyleda. Dji. Cyfl. S. 

AffeitbiwT, wjt, im. an accessary, an abettor; 
Dctnyd bawl yjd yrieniy llaiiwlii- bwmiw ae gid «ti- 
AJTeitfitcs// yw y rhai addawo gyflog n Uadd dyn. 



A<«™UeydTly»jrMU«T 
or dsniyd ydyn Had mrreb caum, m 
atal yr njfnthtcr yna nor lloffunid. 



fVWi<*«" Cirinni, i. 604. 

. [of. tmfffriK] affair ; c 



H Affaith (j) may be a corruption of affrrlh. 



Affleu, -au, tm. [allied to ga/ati] a bold, grasp. 
or grip : possession. 



tljiu-. 1* Llm-'lst: M.A. i. -iSS (rf. M4). 
Due amiiilb rttctn yny "*-i. 

tV«, n» &M/<5M,ii.- M.A. i. 981 (cf. 818, 3S»). 



I> <^.t,l y i^lh -in fy ujW'-u. 1 had hold of the 
thing; the thing was in my ':rasp. 
AfBiw, -iau, em. [tf. ffiiui] a particle, an atom ; 
a bit ; a whit, a jot ; a spot. — N. W. 

Eonill arian boll T^mjb. 

Aphiaoupob"j«iiru'n pao.-Wi™ B'y».- Bl. Art. US. 
Aff«7«, tm. [Gr. and L. abyatut ; Ir. and G«4. 
aibheis] an abyss; a bottomless gulf or pit; 
the deep. 

A*Trein ynteu gwody hynny )^ llawn o'r dwfyr, oal y 
l.yianlt rf y uynyd y tynnei hiuiea ef yr ajftutje. 

Diagynnwyi en agwut dn fbiai.—A nmrn .- Ood. SIS. 
Hyt pan daljRWie Criat lieithliret 

O dvfyn aeia affvut abn( Talifiia r .A..B. U. 110, 111. 

Rbuddfedel ofir^i [uichi, A.B. li. les) 
HhiiddynailIyQwy*.-ftlH^».- H.A.i.40. 



A'i uffeni eitltai affie^M. 

Am iTajA yindduiEnA 
owch ben (t nffrni dirtn.— ftiWIjraicii, 

GwEUf i'r awen . . . xr y n ei pfaen i nnmoli gwcithred- 
oedd K darddent o*r agv^a gytlumllg ddjfiuf 1 

" -'^— '-ih ojfjlch clywai'- ------ — 

I uffmi in™n by 

/. D^/^.d: CoU Qwynfft, ii. ■» (cf. 1100. 11*S). 
( '/"Ti affwyt (^intemorum ftbyssus), the abyss 
(if hell ; the infeTnal pit. 



Tn nffem. (TTin nffiryr.— H'itujm tfynn, Cyw- J Fkm. 

f lu the first edition of Pughe (n93-1803), 
hut omitted in the second. In ' Coll Qwynfa ' 
{1819), whereit appears several times, be writes 
it aphwyt, adoptuig Davics's orthogmphj'. 
and apparently his curious etymology from a 
and pvryg : ' y man ni bo lie i ddint i roi ei 
bwya amo, ond bod yn rhaid iddo tyned i'r 
gwaclod.' 
Afhrya, a. bottomless ; fathomless ; deep. 

Dw pU poeni kTD m bodi 

1iaatajy>)',— TiiUiini,: A.B. ij. 170. 
I^ntb ^fif^l, p«rth anhmar, fAn iffvjft, 

Bafu uffem jaUTWgiu'. — itAxtin Luffn: Cuiiadan, W. 
k^, prep, [see A 2] with; by; towards: used 
before vowels, as d is before consonants. 
A cbyt ymborlli ac wynt ynj ocdyqt tr7nDi?tlji Of- ef . 
Dug burnt hJIsb a^ aiiui ac aar.-Salm. cr. S7. 
Yokdrefih a;«f, ebeTAlienn. — loio Uu. IW, 
Ao T deuai efe ag ychwuug o w^ yn irymhorfJi iddo- 

J-Aw. Cm...- D.P.O. i. a («). 



iweddftu hyn.^£d. Sirnuj; <^Dtiu^ t. 

IW aj e"jn, to out with a 
r Aberieiji, ii 
a Cardigan. 
H Some circumflex the preposition aq. leaving 
the adverb and the relative unmarked, from 
which one would naturally infer that the 
vowel ia long in the one canf and short in 
the other ; but the quantity is the satno ; and 
as g final is always long, it is unnecessary to 
circumflex the vowel ia denote its length. 
Ag, adv. as (aft«r the equal degree expressed 
or implied) : used before words beginning 
with a vowel, and occasionally before some 
particles with a consonant initial. Some con- 
sider o^ or a in this position a conjunction. 
See^ 6. 

Cgital ag an, as good as any. 

Mor ddtwT ag Arthur, as brave as Arthur. 

Cynnifer ag y iyrld yma, as many as are here. 



belled ..f 



r dvyrain Jddi inth y gorllewia. 






T Due faoD yn rhan mor vjhreddol a nodedw o wtr tfydd, 
ag Dad on dim u^T fatb betb ag y dichoD crefynd Uvd a di- 
naat fod yn J dyn fawuw. 

/amn Bryd^dd Ulr: Png. i. 77. 
la fn eriocd y 



tath rrenln -v Arthur 



-rs«. J5w..; D.P.O. 



Ag, pr. rel. that; as: mostly used aft«r such 
words as pawb, pob (un, dyti, peth). y cyfryw, 
y fath, y aawt, yr un; and fi«quently foimd 
before the substantive verb. It U much more 
restricted in it« use that the rel. pron. a. (see 
A 4), which precedes consonants and vowels 
alike ; but it is sometimes employed couver- 
tibly with the latter before voweb ; and often 
occurs before »y or tydd, which a never does. 



A Thanvyn a yasritenwya 1 blaen y Son ag oedd yn al 
lair y geuianhyn.— Jo/o JV«f. 107. 

A bod yn dyfod oddi wrtho of aneirif o belydr a ^ofei^ 
oedd o rlnmdd at bob o^adur ag riydd nac yn y npf, oac ar 
jMiiiBX.—Dr,J,Dat:ia: Uyfr y Bee. 1. TiL 8. 

Tr on Dnw ag ndd JV gwabardd dywedyd oelwydd, ay'ii 
gommcdd i ti aDgboeliu'r ^wir. 

CAiWm gauwnfa.-.Haaoa y Ffydd, 340. 

Nen wfryw no aydd mor anghyflelyb nc mor ddireawm 
nad all tod modd i'w ooeliii.— £l. Samntl : Orotiu*, vi. S. 

Wedi ei ddyfod, ale a'r Ulam ag oedd ya ci ganlyn, i'r 
bryn dioddef . . . Alban a rodieimodd yn ddfgyffiti ae A 
iryneb nriol, yne mrhyd A'r dyrfa ag o^ild yn ei innlyn. 
ibentwynr — ' — "— "'" •' '"•" " ■■ '~^' 



YmddeniryA i mi fod un erthyg] yn au cntlo, ag lydd 

ddisonol i'm Lladdioa droa fytb i ymddiried i'w ffyddloo- 

deb.— /cu. Hanit: Oweith. 63. 

Suddaa iradychiu ag oedd, treacherous Judas 
tbathewas.- rAeo. Emn*: D.P.O. i, 4 (104). 

Plajtt y fall ag oeddynt, children of Belial that 
they were ; cnildren of Belial as they were. 
1[ The relative and the adverbial or con- 
junctional senses of ag often run closely into 
each other, as is the case with (U in some 
English phrases. 

K Ag is sometimes found redundantly em- 
ployed, especially after inegyt and raal {fat, 
/el) ; as, megys ay yr oedd (=megys yr oedd), 

M8gy» "IF yr ydym munau I dim.— 1 TSiu. iii. 18. 
ydd aa gwauaoa-^Brutug : Ninefeb, B. 

In these and similar examples tho particle 
adds nothing to the force, clearness, or ele- 
gance of the expression. 
Ag, -au, »/. [If. and Ga. gag^W. gag, oilmen] 
a cleft, chink, rift, or dbsp; an opening or 
aperture ; a crevice. 



Agal, i.el. the spoils of war. 

Nyd nu o^i augau ym bannnvyd 
Tna^lgotaldynaldyfrwyd.— Ui™/t*imii: M.A.I 

Agalen, -au, >/. [cf. ocoluin (Ozf. Oloss. v. 43, 



Zeuss, O.C. 1062), calen. kogalen; C. agoian; 
Br. igoleit] 1. a whetstone ; a hone. 

Kjmrjt agaUn aleiaaoraa Eei y dan y Beaoai]. 

^MnogioT,. Ii. m. 

2. a lump, mass, or print (of batter). 

Agalen o ymenyn, a lump or jirint of butter. 
Agall, •>». [gall, gallu] might, power, strength. 



-O.F, 



,)glc 



Agsrw, pL sgeirw, a. [garw] 1. rough ; rug- 
ged; uneven. 

Tir agarw amiid^frtvye, a mgged wot ground. 
Kyiiinieu»welol»ijafnr>«d»nfcucheleithyrni(ir"»«ii- 
dffrwjd iiTTTW«lafli aryont y gytrjw. 

2. stem ; hsrah ; severe. 

ir w«Ih kestjl] Bnitiu u luMtcu u pebrUeu- 



E!i 



ly edrfi-ii jd nfanc bansw nr hriuir gl 



fampau CinrJ^maeitt \ 100. 

Agarwedd, «ni. roughness ; coarseness. 

Da T* nc bolwJ»L u rm ■yrthr"' Jimllt, m im dvtd 
chiMen, a tbHrrUwch llTe«t. n nc asanrti unnimeu. 

MeM^gn Myid/ni, L 13>. 

AgaUydd, adv. [a-j-gad-f-hydd] perhaps, pec- 
adventnre ; msy-be ; almost. 
Ao jn hTTinj agatugd sf u* idl« idaw afo vynet ar T 
chnre ^netluf .— S(. 0mtl, ) 111. 
Medflyso Ui.ita' y maoit, u dfainyd t idh porth odnut 

HwTDt s'n Urngcynt ol] td tr* ofOi^iM . , , 

T>wfr a'n Uyngcai aga^ydd o^ diwHld , , . 

Eia henaid a dirviuiHwdd dnry gtmwg mniawr ei llif 

A drywanawdd omtt/iiiM dnry diTwn' tnacldaf . 

J><i/ydd hd. B;„.ddyg: H.A. i. MS. 
An ai daidion, o^bI/shW, bod nmjr ng hvny o iytbyr mywn 

nn riUat Ormtaeg,— vjr. /. /), BA»i.' Omm. 1"' 
GvOU oedd nndda yni rd lyfr i'r byd b 

pjwn. na'i adael mr-i ■"--' • -' 

agaffnAtl, na adawa 

Agtttosdd, adv. [a+gad+oedd] perhaps, per- 
adveuture; may-be. 

Kanys a^ aaaed ne collet ar daetboed ydaiv. a? yutea fa 
madylyair am y wrac ivyhat a gard.— XdUnoniin, i. 3M. 

Arbavch ycbydic heb 7 (fwr aHiawcb. a^rbMtA y vnic 
yisyd yim llewyg-u. ^^edy woor. ao dt wya na dattlewycoo 

A pfael nu ymdittyoaei y nyi et, y lyfrycbanel y nn' 
nat agaufitd. txwj J gjnAtrtia ar wialen eur oocd yn j law. 



d ganddo yni d lyfr i'r byd beb ei «wbl (u^ 
la£l mcfrya erthyl ar el ol, ya awyUw rfayw ra], 
', adawaent byth iddo WBled RoJeri haul. 



■*O.Y„M 



y; 



A ^edy anbom udunt yn env Duw. i^ff'^mrl wrat a 
dywHant vrtbywrh. Agaitotd hep meibOD y piwirydl 
WTthaw yDteu yryaprytaaennertb. 

Lli/r Owyn M^iMerdt. 
DaDgw tiym y lie a elwir Caluaiia. heb bj. a minbea a 
baiaf y g^auban y lie. ac nccaUotd ncaSaT i tt damnnet. 
]' GroilUK ) n. 
Ageiniad, a, [oain P] SfJendid, bright, lumi- 
nous, brilliant ? 

Afitiiai olenni yr eglwye. oymai gledhyf <ly Tonhedhic 
dauawl. • Ihrycha eoel y gonynnan ydhwyfl yogcyueUyotn 
yndbunt-— liid(/ar, tWV. 

Agel, ».d. [^agal] spoils of war. 

Nid iawn arllad ladd, neu [yfel ac aiuhaitb, DSD o 
agA a chjfiKrwid.— ffoiPtrf Jfa. 
Ai ti Daniel, agtl o 
Wuctbygswl dyliryth lago I— ftuan tir, 

Agen, 

9'^'] . - , 

crovicQ 1 a chap, a crauk ; an opening. — Etec. 

V^ ham Dad ydych chiri ya eyweirio d^jmbV tf \ 

Owdid, o glDft bwy t^ydd. 

DdaD ben yr agen a rydd. — fTrvnwj; fhenin^ t£. 

Ageoaidd, a. like a oleft, rift, or chink. 
Agendor, -ion, -au, *m, [agen+tor] a gulf ; an 
abjss. Also written gagendor [from gagen). 

Pan [0 d'enaid am y do, 

A myn'd i'r fawr diwwyddol fTt>, 

Oea bri* wrth uor cUy dder, 

P«diiiT..j-~.)orfyddu;-^'" "V.,- Bnidd Cw*. «l. 



Yna tmHynea asnwrn 

Y dorf i'r i-r^aiin iwta.— H". H'yii". C. y Pani. 
Cyrododd tlnoedd irymylaa pigfain . . - e'r agautor 

yog Qgwaelod y ddisffynfa-— CVcAframf, ij. 1^. 
Ageniad, -an, *i7i. a rifting, slitting, or cracking. 
Ageuig {I), if. a small chink, rift, or cleft ; a 

cranny. 
Agenog, a. full of clefts, chinks, cracks, chapB, 

or slits 1 deft ; chappy, cbappied, chioky ; 

crannied ; leaky. 

Y mae y llecbvedd . . . yn lied inwdiait. ac yn bar avencw. 

t}wiliid)jd, \ii. 811. 

Agenu (i), V. to cleavo, chink, rift, slit, or 
crack ; to chap ; to become orannied. 

Fy Dghrcien a o^nrHU, ac a aeth yn fflaidd. — Ivb Tii. 6. 
O blegld agrnii a'r ddaiai, am nad oedd girla« ar y 

Ager, -au, am. vapour ; exhalation ; Bt«am. 

A^T trwia o'i gro a i»'d, 
Fal gTrynt Ml y gyntaid. 

Tidur Atti, i Ffyiuun OiraibowL 
A byny a arwyddod dwymder yr agrr. a irvaed berwodi^ 
yng ngUyleh y gaXon.—Urddgg<ii, Mfddjn, li. 801. 
Joegraya^ 
Cglc/lifniioit, ii. 1 . . . 

Pariant agrr, a steam engine. 
BwTw ager, to give off vapour or steam ; to eva- 
porate ; to steam. 

i[ .J^er, inTalie8iii(Jf.^. i. "8), appears to bo 
a proper name. 
Agerbeiriaat, iannau, rm. a steam engine. 

Tr oedd chwibanogi yr o^drinrtanl o flsen y gertydrm 
ar y rfaeilffurdd, Tel yr oedd ya dynfim at Oymm y waith 
pynlat, yn iwnio cnul mamolaetL yr hco iatlb, meddent 
biry. — fSw. HiratiXog {CymDirod<n', vii. 11}. 

Agardd, -au, »m. vapour ; exhalation ; steam. 

J^fTdd yntjnnofEfgiawn.^Z>. d& Gir^^m (cf- xxzix. 48). 

O'I bartb yn nyfarth y caid. 

All agerdd Un o'i lygaid. — Onmpg Ovain, 7. 

Yr un peth nndda weithio t pbeidio, ond eael dlfon o 
agmU I'w gynhyrfn ; ae nid oee neb a ddisfpry] iddo gyffro 
hebynvfl^gotyDol.— /iwj>*»arru; (iweith. t9T. 

Pfiriant agerdd, a steam engine. 



'biuti 



darUenwyr yn 

Binrw agerdd, to emit vaponr ; to evaporate ; to 
Agerddbeiriamt. iannau, tm. a steam engine. 

Nis gellir piiodoU bpJ na oblod I'vymddygiad, mwy nag- 
y gfjlir i <v°nUMrin-.i.— An. Harrit: Qwaib. 291. 

Agardde, on. vaporous temperament. 

A'r ardynuiyT bvn a eini Bhyg Feddyg 
acbog alter y bem ameylob y nloD a ">■— ~— 
Tacwaiyu.—Mrddsi,- ■• VydJ/ai, ii. 801. 

Agerddleatr, -i, «m. a steam vessel.—/. O, 

QeiHonydd : Gi-ir. 98. 
Agarddlong, -au, >/. a steam ship. 

J^mMluiijrwygygwyrdd-li.— CufTlfriM.- Can. 17*. . 

Agerddog, u. vaporous; full of exhalations; 
steaming. 
Llawu larth ac aser, tartbog, mygdartbog, ngrrddog. 

»^f(.-fi, a.'. ' Vaporoui.' 
Agerddol, □. relating to steam or vapour; 
reeking ; vaporous, vaporish ; splenetic. 
Hefyd. y bobl a fdnt agertUaicI a ddyapant yn Ibiwdd, 
nchon Mrymdor y geri.— W"t%Ba« .Vnil.l/iu, ii. MOI. 



AOERFA. 



95 



AoURIAt) 



Agar^, teydi, faoedd, «/. an air- vent ; & vent 
or Tent-hole ; a ventiduct. 

Agertad, -an, »m. a steam boat. 
Ag«riad, -au, vm. a steaming ; evaporatdon. 
'^bir jn *wr j DynDyrchir j f^orachion hyn nn ng/riad 
nrjT hykiflff a gonTdd ft nuwiio^dd u- djwydd poelh, 

/. D. Ffraid: CoU Owynfs, *0(l. 

A^rlestr, -i, «n>. a Bteam vessel ; a steamer, 



WBlhiiLn trwyll yn erbyD y ^wynt 9^t 11& 
T pwfT ofersiJelas lu lu thybiol dirI oi 
dfem y fall oedd, — Qvjiii^gfld, t, ff73. 

Agerlon^, -au, «/. a steam ship, i 



* ... nil tnllsi 
D aUyllon hf U- 

steam vessel, 



a steam packet, a steamer. 

Dyweardd nn bairb ym mbutluu goitlewliiol y t>|r- 
wynvBeui Pjmd ulyippd bod agi^rlong nenyd"" ""' — " 

Agem, c. to steam ; to evaporate. 
Agerw, a. steaming; foaming; being in a 
fenneot; vaporish. 
Meirck agtrta, foaming steeds. 
Amin belyTn rn chwyn chwerw. 
i. uuchogacUi •wVci aatnc—Ioio OdcA, i B. Horttowr. 
Agerw, -OB. nn. vapour ; esbalation ; ferment ; 
ebullition. 
Bedin urdyriut en ofenc 

Hyniiirc Unydawc Uaw cbwenr.— ^■miria .- Ood. 714. 
Cyt Ub trwy wwi tnry aomo 

Odhyod tiTFTOD]rT&v.--CViiU<t».' H.A. L MB. 
Ammhuredd a betledd berw 
Cyll* dgteim cell agmt.—OnffgiA Orgf, 

Agne, -au, tm. [a — hS''^] wlou'i tiitt, hue. 

AeiH. Hi*, gwnrt.— o.r. 

Agofft a- [ag] full of cleftfl, cracks, chape, or 
sfite ; cl^ ; chappy, chappied, crannied. 

ed yn (V"Bj ; af eheiddediid 

an, im. 1. a wash or lotion; 

AgaUk, QufDllyn & olchsr dolur u of, brvd nen oer, fil 
y bo prfyn.—JfBUy; on Xnid/ai. «£. 
2, iwill, slip-alop ; hogwash. 
Agor, 'i V. [ag, «/. ; C. rsery ; Br. egori ; Ir. 
Agori, ! eochair ; Oa. eocniiir, t'ticAair.' cf. Gr. 
Agoryd, ) ilyiti] 1. to open; to expand; to 
unfold. 
Agari Idb nun toad yn tal y panntan urnB j wrek. a 
■byoDdl ffwmfl pcogryidi mdyD ohonet. — JTnAno^wit,!!. U7. 
Dynot ■mn J portliBWr ao i^on y poith. 

Snr didlawt U« nyt nnr datlau. 

A&iavdin.- U,A.1.UE. 

A'n Hygaid bwynt B owncvf. , . Onld oedd tin calon ni 
ynQoigi ynom, ttn yrydoedd ofeyn yrnddlddAO A niU' y 
Soidd, atlnyTTdoeade(eyn<vi>r(rdJnl yr yagirthyna t 



Sn iludd, Heiatt Cine, ebr 0, i I* l^ mu'r drnan yna 
yn tgaf i ■ maant yn aaor, ebr Tnbiii, i Dir Auvnof - 

Blii Wgnn : Bardd C«^, (H. 
Ckavallon . . . 
Tb nwr by balch yn agar bylcban. 

O^Uur MkI™, : Omith, 1. 30. 

Agor pen, to open the mouth ; to gape, to 
yawn. 



Agolcb, 



2. to open ; to explain, to elucidate. 

Fel nM nllRi n«'r dy^tswdwyr agar yn dduron unlirg yr 
b^a a evyllyiient, na'r rvraudawyr eu dwEl. 

Cfarlii Bdviar^: Han. y Ffydd, 9ia. 
Bliynffodd bodd i^a QwynfydadiR lachawdwr agor/id i ni 
y ddanuQQg hod mewn modd naillduoL— /erfmi Ov*h, IS. 
f Agori and agoryd are older forms than 

Agar, -au, -ion, am, an opening or aperture. 
Y ptdwar agor, the four limbs ; the four legs 
of a quadruped, or the legs and arms of a 

Ar a bedwuT agor, on all fours. 

Cu Dad oedd aaa aeboa nao eUen, na rtiydd MdyM ■ ■ ■ 
i wneuthuT hyny . . . mwy nag a«dd yn rfaaid i ddyn o 
bercben tracd a chouau duiam ^inaH«T oenlded t$l ei neu 

Agor&d, -au, *m. an opening, an aperture; a 
gap, cleft, or chasm. 

Agorai, eion, sm. an aperient, laxative, or de- 
obstruent. 

Agvrawl, a. opening; expanding; aperient. 

Agor ad, a. open; expanded; unfolded. 

Agitnd y lya y lea eavyon hji.—CgtMila: H.A. 1. «0. 
A dnra y pebjrU ao«d yn agi>Ttt.—Ualii*Bgiait, i. *88. 
AO o agfyndiggon DTcbyniaiwa ybarbuthra. 

BnLl Or. >! JrUur <B.) : H.A. U. SSO. 
A ffwedy na wolfla y drwa yn agoffL mbi affori a cmc. 

DotUtimlthiffain, ill, 
Badd agaml yw «■ oeg.—Salm. t. B [st. Shut. Hi. 13] , 
Ag wyjieb agared, with open face. ^2 Cor. iii. 18. 
Hvxk agored, an unspayed sow ; a young sow 
kept for breeding. 
2. open, frank, candid. 

0*r tQ anUl. y maa gwit »fl^rdd o yrqayd agortd a baal- 
Twydd. — D. Davit: Byryd Ihiv. 9. 
Caion agored, an open or liberal heart, ^fi'twiuy 
Owain, 240, 



lEoled.— B. foicrb.- DawTddiaeth, 13(ct. II, IG]. 



Agorfa, feydd, fau, «/, 1. an opening or aper- 
ture ; an avenue : an orifice ; a gap or cleft ; 
a crevice ; a vent. 

Eiatfiddaiom maim cvir Un^ a chlodwyd DJ i'T agor/a 
aydd yn arwaln i ganol y Dlawdd. 

Cflckgraxm, 0. 191 (of. 131|. 
Ond yn awT el hlng tnf ewnol a ymdrecba am n^^ir'/ii. 

2. the crater (of a volcano) ; a chasm. 

Givaalodyrojfor/'aTddeddynfaollolvafltad. . . Yragor/a, 
yn al y f am ammbazvaith a allwa i wnmOior, ydwdd yii4f 
nghylcb tair milltlt o g-wmpaa. Ifewn peithynai i ^roan 
yr agar/*!, yr wyf yn maddvl y geUid ^wnntUxnr byny. 

QrfcA^rdWu. i. 75. 

Agorhau, v.^Agor, Agori. 



Agori, v.^Agor, Agoryd, 

Agoriad, -au, tm. 1. an opening, expanding, 
or unfolding ; an enlianoe. 

Agoriad dy aiiiaa a rydd olminl.— SbJw. lii. 180. 
Has yn ag-lur, mewn llao'TYKTytbyriK lyddynrboddi 
a^snnifam) d bonan, y dylld aTddeall y Dordd yma. 



'8" 



A././riad yen 



. the opeuiug of tlie mouth.- 



A'jurhni 1/ Sfneihl, the oin'oing of parliament. 
Agfiriad aililiildii, tbe opeuiug of a place of 

% a key ; that whirh opens. 



L vy K^Llddti nj 



i Dafydd. jt ti 



.ydd jr 



Vr fdym ni yn dyvedyd nui ngarindaft A*t Thai y it^Uir 
grytLyrau. — MorutCg^n: DiJf.iuS. 
A chwiip u hynj, dyw droi agoriad mewn rlo. 

ffu H-y""' Build Cmtg. M. 
3. an opening ; explanation, elucidation. 



Agenad byi uTf .'di yr Arslwydd.— 0»yii«;i«M, 1. 464. 
A^oriadol, a. opening ; aperient ; deobatruent ; 
explanatory. 
Anntrckiad agoriado}, an opening or inaugural 
address. 
A^riawdx, iodron, im. on opeuer; one who 
or that which opcna ; a davigcr. 
AgoriawdT n*/, the opener of heaven. 
Agorwr, wyr, fin. an opener ; one who opens. 
D»ttod y crocn u wnaoUipi'jd, k aimQfod o'r aiomir 
dal mab. us h ddynod wrth Elphin, Llyma Dalicnn ; 

^a.u ]-aJu>ix. M.A.I. IS. 
Agoryd, -.^Agor, Agori, Egori. 
Agorydd, -ion, «mt. an oi>ener; he who or that 
which opens. 
Yd Ue agoTf/dd pab ooth . . - y cyjumoaiB hwync i mi. 

Affom, (I. [C. agoa, ogat; Br, r^M,* Ir. agtu. 
to«M, toctw. /ocu*, a.ee;__Ga. /w,m ,- Mx. 

osjw*' f^ggn' ; G^- *)^''''. '«7X'' *y)^] *>•**■■ 

nigh ; coDliguous ; proximate ; close. 
Fn 01708, near, nigh ; nearly; hard by; almost. 

A cbodeir eurat o«d gn ayot yr drvs- 

HaHma^i. (. ase <cf. U. 10). 
Chiri swyddocbfod yrhat^ii <tgoi.—.i/<u. xar, M. 
Gymmydiigioa agog ydynt, they are near noigh- 



i AOWEDD 

Agosaol, u. drawing or advancing near ; ap- 

prooehing, coming, approximating. 
AgoaAu, I r. to draw. move, or advance ae«r; 
Agosi, ) to approach, to approximate, to near. 

Agosdu id, | to draw or come near to; U> 

Aijotdu i. ) approach. 
A^aaw], a. approximating, approaching. 
Agosder, 



nighnesa ; close- 



T^* J j' n''** : contiguousness ; proxi- 

O bmydd (ud it^mdrr y vMh y mM dyn )fO g*"t, yn 



A cban V ^wn4 y mo^mt yn «i oddi'f yu «u ttagotrwuid 
mvyuF id<fp, m&e ynrluiid eulxhl d ddf^fn^rdd mwy durnn^ 
na^ eiD daiar ui.—Hob'ri tii^trt* .- Scryd d ia e t h , 13. 

Agoaiad, -au, $in. a drawing near; an approach- 
ing; approximation. 
Yna Pie a ddiagwyl yn amyneddgar am anorind y pyi«. 
6»^l«dsdd, Ti.. fa. 
Agro, n. sad ; pensive ; heavy ; depressed ; 
sorrowful. 
Ao^crd Uryeo ya agnt geanjf. 
Can ettyw vym pwyll gan wyllyon mynyd 
WedBclirivabrvLinii.— rj/Bsn J(jnWui. M.A. L 138. 
Ki chyi^f gtibwyllaf om diwdd 
Owlaa yddym ys cjarw ei maswr-dd. 

ff,. v,^ r^*.- S(.A. 1. 3M W. IW). 



Agvedd, -au, -ion, 1/. [gwodd : Ir. and Oa. 
dfl/iaii/A] 1. form ; fashion, shape, figure ; 
a ^^abit; attitude. 
(,'n agteeild yw, it is the same ; it is much the 



A^al.tm 


r to. nigh 


to; noB 


r; 


.ontiguous 


Agi^i, jto 










.^=W 


yreiebrenhi 


i??.I 


Ttii 


lamyndwfyr 
M.A. ii. aw. 


b.biii^aji.'ss^no" ■ ■ * 


»iu dda 


."^ 


yaa»«i'tt 






m-ntjoMJ 






Sothlirydd.— b 


/-. Lnci,: Drych V»9r. 


101. 





cliadd neb dynlon ax y ^daiar atnfteuacfa manteinon a cb 
Dorthvyadau naif a gaWBom bi. — /trtmi Oven. ti. 

Agos, adv. nearly ; well nigh ; almost. 

A't enw a emii mtuaa a halogwyd agot.—i Etd. x. : 
Ca«l bir nycb ; mlbau'r d« ; 
Caul mavr wg ; wcl numi ai/ai. 



Arglwyd K^trchwyR^dic yw yn duwym ni. aoh Daw ofawi 
■y inulam ysyd yn kyiDhiill y eawl ToDedygTon hyn yo ynb 
™ylly> chwi yn yr ay«,d h^^.^^ ^ ^^^^^^ ^^ ^ ^^ 

Ai framl ffydd fytli a tydd j-n n^n-nU diint. 

(.WJF. n» JUrrrdi/M.- M.A. i. 138. 
Triplu^ a ddylid aylwi'D benat ar bob petb ; askui ; n^ 
ipniJ ; a gwtitbKd-— J/ju. -*'f.A. iii. 7». 

Drwg yw drwg ym mhub affwvdd.^Myv. ArtM. Iii. W. 
.V chymmycirn i'rbitaLaaVbarlyaynUDifKvvUairiwd. 
Mid^ygon Mydd/ai, iL £27. 
Y prif1IriAt'noffianafama«mtyauaiawa, maS'r agnftdd 
o«tyu»iddiaf a rFHJdai'r riaii"^id ir>'Dimvradwyaf . 

7-1,0. /,««..- D.P.O.ii.SlslO). 
MenuiaE, tnryddai bub agu'cd-lion 
Uiiu duar ugy'^i Ibuw dvr eigiiin. 

Agtvedd gwae, the form of a servant. — Phil. ii. 7. 
Aguiedd y geiriau, habitus nominum (in rhe- 



a fyOd pan girplyiier 111 



iriau d cbyffclyb lyncwlni 
■urn Ug/r CcrddwTiaa\.i 

•1. appearance. 

1 bellenniffwyr bwytl ud afu-edd. 

iladns Thriigraig : M.A. i. 4 
lawn arial Wsawa Uriel agard-l. 

;,/,«,!,. ««■* ,■ K.A. i. H 



3. inoodorincide(iii gi^mmar). — DoipartkijSaith 
Gdfyddyd. 

Agwoddiflau, «/. [gwedd^] 1. the dowry or por- 
tioa given with a voman on her mBiriage ; a 
marriage -portion. The Welsh Laws coDtttili 
many enactmeiits relating to it. ' It is also 
written Anguyeddi, Eyweilili. and Eitgvmidi, 
Og Wn e aeythupt TiillrdiD «leKannll)ilery1ue*iif"nJ4 

Tq)t afiaiiiii kermlhraul cwiit ; offird^ meroh brenyn 
pvdcTT pubt AT nitikeTDt . . . iffvt^g menh Kurda t«rr puut 
. . . ofwrdg tiKTcb mabeyllpunt.— CjiA""™! fgwr., i. so. 

d crchls yiion . , 

re wrvhtb idi niMi r 

2. a gift or preseut (iu general). 

A g»rt nyt Bdwjn n^u*H nyg krrt. 

/./jr»- -I* £i^fcv/yB.- M.A- i. :S1. 
Agweddiad, -au, tm. modifieation ; habitua- 
tion ; dispodtioD ; form. 
Dyttol offweddiad, huniBn form, anthropomor- 
phism. 
y nue priodoliBeOuiu creill ■ luddir i IMuw u- gjeelyh- 
iuth, jLc fn ommhriodol, ja yr YBgiTtli)rtai] Boncuidd, 
uiTTi (trwy dduU jnwlrodd, aet AatlLropomorphosLA. 



riuBr>Tny<aiwl 



}■■ Bsidd. iii. i 



•»/>, ii. 

Agweddiaeth, -au. if. form, fashion; style; 
appearance. 

Ac si irelid yn mmuD o'r b^d kuMI ei rjVeljh o biirUi 
unC. ■ gUn BDuwWiofiA, ■ ffwyoh pyflrriiPth, to mbob 
Rth > bntbrn i if >> wi^dai rnoarcliog niddolkf ugtivi 

Agweddlol, □. having a portion or dowry; 
dowered, portioned ; dowager. 

Euk« nj Iats ^iit«t<^ iuc o Wdhlud nu orod at vrcynt 
dugiicdhjr nuoen hjit cpea e wyili blenet hc nsl if uritjiaiil 
bfl^ open t tejth bleaet sUui,— (VrdMimi (>nini, i. 88. 

Kjtreiih adrweit gwedy bo oforiiaiDl rimic, y dyly y 
kntoC Tot wrm y ^wt y bo iffvt^wl guituw. 

CtfrriMaM Cl/umi, ii. St. 

Agweddol.a.relatiQgto form or fashion; modi- 
fying ; f ormatiTe ; modal ; habitual. 
Agveddoldeb, am, modality; habitualness. 
Tri lyrtJa y aydd br bob Omfod : aaiotddoldib ; cylchiadol- 
deb;idiuD«ai>ioIdeb.— ir^. .^rut. iiL201 (of. TO, XII). 
Agweddu, v. to modify; t« form, shape, or 
fashion ; to habituate. 
Uu^snald 



1-1, i. 



ifottr eoiVotol dnn smser. 
MoTfai Uvid: Cyf. i'l Cymty, 11 



Agweddtu, a. modifying; habitual. 
AgweddwT, wyr, im. a modifier; a fashioner; 

one that oaluttuites. 
Afwrdd, cp. agyrdded, -ach, -af, n. [gwrdd] 

strong, ^w^ul, potent ; stout ; robust ; 

li^y; vigorous. 

Hot mr agwd gmt inor yr fli^you. 






RkatM^: TAJl. i. <SS (cT. SS 
'l^iddtbo. 
Mmifid: U.A. I, «4« (cf. MM9 



Oyni ddoe ag^niit ddlal. 

Ae yn lUiiyfyd y duth « 
•rcrfi— IP. SBbufcir:^ .- -Art. 



O bal'n aprrid besbmnip, 

Ni chato glod Bortod y gamp — tfnmioy OB«iin, 1 (rf, V) 

Aavrdd yw undeb dwy^mijjc. 

a. M->*an : Onith. i. i1 

CerJii agwrdd, a vigorous poem. 
Homsr, h'I gerdd hoev-ber, agtonU, hybanh. 



Ebel, 'Celtiu Studies,' 99] a rudiment; an 
element ; a principle ; an alphabet. More 
usually written egwydihr, q.v. 

OvyddAi a^tr^ddnr FUtholl, 
Gweddaidd olyiuidd wyl lun- 

<l,,al, Da/gidab Tadtr: M.A. 1. «79. 
Bby [wbgsnaidd im' yma «n pa fodd y ^wnair pob fdllal 

Agwymp, a. [gwynip] fair ; fine ; beautiful ; 
gay; smart. (»p«.) 



Ag-wyr, a. [gwyr] obhque, awry ; aslant, slant- 
ing ; askew ; crooked. 

Drwg adwmd dyeiod a^ieiir, 
liuggm lion, a'lIlwBr yn llwyr! 

n. ad Ou^jim. IzxTl. XI. 
O'l Falcbder paa, adgoe yw^ 
Ac o'i rwjd, agKUT ydyif. 

Ich Morgans^ : Salman, i. K3. 

Agwyro, If. toalant; to become awry or crooked. 
Ag^rya, a. [gwys] deep, profound ; low. 



Agyrddol, a. [agwrdd] strong, stout, vigorous. 

Ac nld oedd raid i'r euraid wron 
(2«isio ttgi/rddaJBt In gongorddiofk. 

/. O, aiirUiiiidd: Oeir. W. 

% The digraph or combination ng (as in angeu, 
angladd, cangtn) is a mutation of g, and st^ds 
in the same relation to that letter as ch does 
to c. Its order in the alphabet is next after 
J, and it ought to occupy the same position 
m dictionaries'; but iu most of them we &id 
it treated either as n-^, or as a derivative of 
n. and placed after that letter, the result in 
both cases being a considerable amount of 
confusion, and no small inconvenience. 
When the negative particle an- is prefixed to 
the nasal sound of c or j, and one n omitted 
for the sake of euphony, as anghyfiawn (an- -\- 
cyfiftwn), angramadtgid fan- -f gramadeg), the 
combination should, lexicographically, be re- 
garded as a simple n^. 

In compounds like gogangerdd (gogan-gerdd), 
(?ynij«d(teyTn-ged),gi«iii3(ir(gwia-gar),j(ifa- 
hanqlvnif (gwahan-glwyf), uuiongred (luuon- 
gred), II and g are two separate jotters; and 
in such positions a hyphen is often placed 
between tbem (n-^) to distinguish them from 
ng, which represents a simple sound. 
Ang,a.open; capacious; spacious; large; broad. 

r ardrom ang, annberfyn, rhagoT nydd. 

Ang, -oedd, -on, sm. space ; capadty ; extent. 

Hardd yr adall yn er balfb 
Onsilad, w d Sangatdd fDoithion ar 
El lloriau Uyf n gaa ddrj'sau a amlyot^ir 
pDJl yr agoraot ea dalcnan pre*. 



,>gle 



AindTnigiawdifjiiljidirT i 

Dvrtli □ Def RTHADOedd gwittoAd, 
At Bil iJTblia y declinuiidd, 
A thrwy ajtg mc nwd efltTi»dd 

OfnM i»itb y Ud.— fMr/ottm* IC.aM. t. 1M). 

Aag&d, -au, >/. the hand; the gnwp or palm 
of the hand. 

Ef llitlirn wydgn oe d-if ta( Amuru: Ood.311. 

Pom » borthaf yu aekat fj Uaw. 

LlfKartA HfiM A.B.ii.M6(tt.te*] 
A,«^„™,n-e~ro,=^^^^^^^ A.B. ii. t« 

flamdrtirwjiwroMjoi Vfii.— jr^nMin.- m.a. i. isa, 

Neum ba oe aaoil mwrndnd met. 

Or. itSKv™™.- ItA. i. M* icf. mi 
RydkngiiTiiinidaeuftiii.— CaiM)^^.' U.A, i. US. 
Dioa dehm ulwu oth aaffod, 

SiHian ab Owtom U.A. i. SU (cf. SST] 



AnptU»dig, a. impoenble; nottc be effnctod. 

CrfTuu^ud o dduiHii a drwg yw vob bprydoVtm men- 
wedig, > hjnyohry nenlaiherwjddeugiiddyn yrabred, 
o>aurw yn ayfiuvd uinirfn. hyd y byv yn eidufnod y 
dainni I*! gBllFdjnrth, hyd nk bo llwyr anjsil'ifij I Ddaw 
« ddvyn ym mh^ach,— 5ordfiu, i- lUO. 
An^Uuadwy, <i. impossible ; not feasible. 
Aiig«r, a. probably the same word tm anghar, 
q.T. There is n poem ascribed to Tuiesin 
entitled Angar Cyiyiuliiu^d {M.A. i. 34) which 
bos been truislated/nttnica Con^ederatio, boe- 
tHo or inimical confederacy, by E. Uiwyd, and 
his espUn&tion has generally been adopted. 
It also oocuTB aa a man's name. 



fire. Pugl 

heat, hell.' The same word is probably in- 
tended by Llywnreh ah Llyweljn in the fol- 
lowing lute : 
Eiryofd dy in; cur unwd dyt ugkev.— Jfyc. .Ire*. 1. KS. 

Augor, a. infernal, faeUiBh. 

HwTot yn ea cyiseflndeb ?wyll y iwfa 

Thc« in their duk niUTltT the d«ep 
eiisll yfald tu, pniK'ouit with ii^fimal Ouoe. 

I\inidiit Lou, Ti. t§a. 

An^wd, $m. a holding or containing. — P. 

Anger, *n>. See A-ncr. 

Angder, -au. »in. capaciousness: space; ext«nt. 

l>ideifyD yw y dyfnder, conrs mi 
Tv hwn s lum ureidToldcb. chmith 
NidKw»gywnBj*T,-lV, II. Piiiht: CO. vii. 19T. 
Angddft, a. spacious; wide; extensive. — P. 



u rwy Dynnnwy dnrynwyn glyn 
O Uon hyd Uynyw Ujrv llu agae 
yryd y dbryf dpe onfydawr 



iif<imrjt<ui' uiv^'ri : K.A. L see. 
^ Oocniring but ouc«, it is not quit« clear 
whether wc should read anqdde or agde : 
Dayies sng^te the former, and Pughe adopts 
both, explaining the latt«r as denoting ' pun- 
gent, penetrating.' Whatflrer may be the 
precise meaning, agde and angdde are one and 
' ' e word, and must have the same mg- 



t AnOELYsTot 

An^l, pi. ongrlion, angeUon, engji, engylion, 
tm. [Gr. 'etvytXoj; L. angeliu; C. ail, tl, ad. 
fyl (=W. A : It. and Oa. aill ; Br. iJ, tal, <ui) ; 
Ir. aingiol, aitigd ; Oa. ainjr«a/] 1. onangeL 
Favb ■ dabreynt yuot Tn ig'l kuilurthw^. 



liu gurin guMm aUia v*'!' 
Qma amffjflion torn nym o« iwiied. 



Mgv. Ar.*. i. 



ffw' 1« 



Llj,^ 



• iLlawtlfn: M.A. 



1 Icf. *n). 



Yn* y tynnwyi b( y bmn dtmcheuen ■[ yr ayrf . . ^ 

yd sTbifl ^ a^r'/ yuv odrych drbrhcueb yiuywti y welvt 
path«u oeill.— JT/Vnyy/ .ViVddFnyi, tS. 

Codyanei ef yr 'g^t</i* ya y nef . . . di«ithrvyt yntod a 
t«ynkUH yr egv^ijon. -H'lii'g Ponliua I'iliilmt. 1 11. 

Ygkeinadttsef uwt'ffflfsn.— ryu-Mslv: H.A. i.nOL 

Drwy ■yonyedifru'th J dyveit ef nOi ei tugfliom, > thrwy 



)ji i^th y dyiuocL — LifUar, )& 
>wddyi 



Dydd 

Nidoe 



.,..__. -tub. pa lawl oi«r- 
^0* yinydd yn y nef ! — //wfu, 1 4. 
snllaidd iLdiiwlpentJUi.-ZJurFt. [ILA. iiL147). 
a hvich o't diwcdd fry 
lliliw fy agwtij.—Trtbir Al*i. 

I pui ^uio delyn. — Dafudd ab SdmKM. 
Yng dgoleu gwlodd nfgl glln. 

tfro.„, Ow.i,^ 118 (ef. ISB), 

In Mabinogiim, \. ti3T, en^f seems to be used 
for the singular, with the pi. atgylion Tegul&rly 
formed from it : 
Vy niMin heh y Peiwlur brth yw t nl imdio. Bfgrltct jnt 
Ty mab beb hithm. llnu Ty ityd hfb y Fundor ydtf yn 
rgg! ){yt K wyat. . . T mun hob ef nn •^fUsii oed y ret 
gyanea. ouiyn nurchoflyon nrdalyoa. 
Angd golami, an angel of light. — 2 Cor. li. 14. 
Angtl geidwad, a guardian angel. 

A rtiAg I'd i^ydwybod wenieithja i ni, nn tod heb wybod 

rbtLi boi&u, yrut fe fydd ein han^rl andwd yn rtkifvyll a 

chyhuddwr.— Onyf. H>iiii.- Tstyr. i. 8 (SJ]. 

2, anangelorministorof acburch. — Dad. ii. aiii. 

Ni ^lasom Uwer ^wefthiwr o*r muuu y tniQCit. I^t« 

V B«ftf stynt hwy . . . oedd y ywoinldog-, yr hwn h ddnr- 
Ilnui y gveddbu ; yr hwn. un ei tod wedi a ddewii yn 
^nen ac yn ^omiul drrwtynt nt T>duw, a alwent . . . anfti yr 
e^ywjt.—Tkamat rkaria, *.-r. ■ayragng.' 
i[ The pi. aiu/el(<m is not, as is often assumed, 
a modem innovation introduced for the sake 
of regularity, but it is common in all periods 
of the language. Not only it very frequently 
occurs in medieval writings but it is b1«o 
the form adopted by Bps. laorean and Parry 
in their respective editions of the Bcripturea, 
and by other equally early writers of the 
modern period. Both forms will be found in 
different recent editions of the Welsh Bible. 
The ordinary pronunciation of the preeent day 

Enffyl and aigyhim are forms now mostly ooa- 
flned to poetry. 
Altg»laidd, a.^Angi/iaidd. 
Angelawl, u. angelical. See Angylavi. 
Ang«lea, -au, */.-=Angyte». 
Ang«lia«th, -au. if.^Angyliaeth, EngyliattK. 
Angelyator, -iaid, tm. [contr. of ^angeluator 
(q.v.J, from Ii. evangdixator::^^vaj^eluta] an 
evangelist. 
Ypediaar angdyttor, the four evangeliste. 

Trwy y petwnr ffwmr gwirot«n ngor 



jm v_.(,K)t;ie 



Fedwu- cgliir pednwiion 

Aw^^tUrrgtrmfrtMon- — lot 

Ai^ell, pi. engyll, */- 1- 

Pom pcDiliwnt ourU 

A jmbluaa}iUa.—Taliai* 



pinion or wing. 
M.A. L U. 



Adar ■ gkid u 7 njiit, 

O'iii-wjamfdlidiAimgjat.—n'ibir AlMl.iW^i3i. 
Ob hwnt mlch, oorwrnt ■ hrll, 
OmCuigag', cryf ej tngiu.—Ti^Mr Attt, 

2. an arm ; a foralimb. 

TmudTwreugdl 

Bw^^r^mh] bod « law idiiw 

Pntrmbsllox^.— ^Hnrl.,' Ood.MM. 
Angellog', a. haring pinions, pinioned, winged. 
A&gen, 9b.-=^Anghen. 

Angerdd, -au, engyrdd, am. \an- intens. and 
arth: cf. li.angor; "E.anger] l.beat; atren^h 



olence; ammal 



force ; vehemence, ardency ; 

OweUii anaini ri ng Cisig Owydrr. 

ffMfc*W^ M.A. i, IW (rf. 196). 
O lUT zif anaerd o luw ttt fu. 

CgniMa: M.A. 1.310 (cT.lH. HI). 
Ef A velei flUm yn djuot drwy 7 ifsiLaiji 711 wlimcb 
fuiwath DOT bnil ii*D ud wrhif 7 hanftrd 7B dUBTD u 
TTiH&vt.— Si. Great, (TT (<4. IW). 

"M anfferdd h barut wallgof a rwEllbwyll ar ddTn - 
anftrAf ohl : anfirMmii me aKfenU tetcb. 

Xgt. Anh. iii. SM. 

HegTi 7 diddyniir oetfd tr«T boetUyra mi ekM gwna. 

£U. Samnil^ Orotliu, i. -a. 

Angerdd tSn, the violence of fire, — Heb. 



. X. 27 ; 

Angerdd Hid, fierceness of anger ; fierce anger. 

Ltid ae angerdd, anger and vehemenoe. 

Ao aiyncQ aomc Arthur ou o lit ac ttngerd. a dfll«havd 
Salttrwb^.—Brul Or. at, Arliar: H.A. 11. MS. 

2. ardent dispontion or natore ; disposition ; 
pecnliaritj, characteristic. 

Td «fcr< a Berl7iiiaai.— Sialm )fai>: H.A. L SS7. 
Owimui Brniunn OTinial7n angert. 

Cim<U<Iii.-M.A.I. IM. 

Amftrd oed ai Oei nav noa ■ naw diwarnawt hrt 7 an- 

ad^. T dan dirfvT. . . Oalv aonic Arthur ar ITedwyr . . . 

. . . Anfferdd arali 

1 naw ffwrthwan. 

•ogim,% 318, 114. 

Augerddol, a. vehement : ardent ; intense 1 

violent ; vety eager ; extreme. 



dl aafdei 7117 



:.■ M.A. i. IM. 

giTwglengKiaoa 
>,iT-*i Muaji onatrMiro^ 

Cyiddrlii,: M.A. 1. »0 (cf. HS). 
Ac nal 7 b7d7iit 70 kodet ii«1]j W7nt a9l7W7nt twr7f 
mawr angi^T^vl.'-MabviogioTt, 11. ]> (cf. 67). 
Ki firwvr sydd faivor iBiiU7d, a ffiam a,v<''d<I<,I fi^^ot. 

Y mae anadliad pythrrmliaia 70 7atiiiio UTgredlgaflthau 
mcddwl dTD 1 ehynliTtfaii •agrrMal. 

ak. Edwarda: Haa. 7 FfTdd, Bl. 

Angerddotdeb, | (m. vehemence ; ardency; 
Augerddolrwydd, ) intensity 1 violence. 
Angerddu, v. to Eteam ; to expose to steam. 
Pfordd hawdd a Aad iawn 1 angerddu doroa. 

W. O. Ptifllt: C.P.T8. 

Aagerth, -an, tin. a by-form of Angerdd, q.v. 
IUiariitnv7ffTddaaTflHg7naaant d«7Tna»edd . . . addi- 
foddMm anpf^ 7 tLa, a ddianoiiHija rhng min 7 deddyf . 
■■-- «. Datiet: Heb. il.ra.S4. 



l«8W»g7«nM 
,.ge,a Ajlti.- 



.. [C. , 



;, aacow; Br. 



anlceu. Mod. Br. aTiquou; Ir. fag. tc; Oa. oofl 
lerally personified); the ang« 
1 : used almost eiclusively i 



etij] death (genera 

of death ; death : 

reference to human beings ; while Tnarwoia^h 
denotes death in the scmse of extinction of 
lite, and is applicable to all things possessed 
of vitality, whether animal or vegetable. 

A d^ndriiUit oed bop d7n 700 a cbjn bei afhai fupop 

t>. T Kawi ba beth 7 d7Wfldir a-^gau. 
ohwerwedh. Deu J gmin damait yr anal 7 
ttt bwTm 7 daeUi angm obonaw. Tri ryw a>*vL.« j^jx,.,. 

cbwerw. mena on 7 d7uioa ieuainc- tu anga aniaoawl. 

P)r eawl anglim a ddaw 7 ddTn I T mab a dd7wat mas 
bi moAni. CTntaf hoii7nt 7W oMglm, bydawl niavdawl. 
. . . Tr ail 7w anj*» kTwilTddiis. . . T tiyd7dd «»»*« 
7W anjhtu a ddel yr neb aj chaflD g^7fiumiuiu o weftbnd- 
oedd leoau Qriit.— JjicMiii. | IB. 

Brjr gwjllt ai- war geUtTdd, 

II|d 7iii««] pui dd«l si ddTdd I 

A ddwv aiidAj'n ddiv7iwbor : 

Y b7d oil. bfi dnUwn, 

A'r 7 g7dd, a erys hwn.— iriliim U<^n .• a.B.C. SM. 

ITwch pob dim iwaer >i>««.~/dIb Mh. «w. 

Ni cii« 1 fawr una. nad dyma & yng iwolwg allur (awr 
araw7dua. 11a rwelem y brenin dycnrynadwy yn traflynca 
-- -'— - " - " ,.„rf, o bot twU. yn ei 



tdCwi«,fie. 



.'ffisrfi 



hyn a ddloddelaaant yi 

llawer a oddetaaant cn;c>.~f<H«J Oum, ? 
.Iri^ni a gynh, an nld mUsc.—Diarei. (el. M.A. ill. 14S). 

Angeu Coch (1), Bed Death, the name of the 
sword of O^rndchinai ab 0-wyar. — lolo Mor- 
ganwg. 



Cech yn iug y air.-ltif a<u*, i OylleU Oved. 

(2) According to the Bruts, the name of Cnsar's 
sword, the wound of which always proved 
fatal. In the combat between the emperor 
and Nyniaw, it was taken away by the latter 
hero in his shield or helmet, in wbich it had 
stnck, and was eventually buried with him, 
Ao 7 ^yt ac 9t [yyniawl yn y bed y dodaaaant y dedyf a 

du^aaaey yntea 7 Ean Wikammr pan 7mladade7 ao ai. ae 

east oed enw y dcdyf hwnnw Aghru Coc*. kanys pwy byn- 

nao a cprchollyt ao « 117 b7de7 b7W. 



According to another version (B) its name 
was Angeu Olai, Blue or Pale Deatii. 
0sf o#d mw y D]od7f Aget^ Giat aef ochawa 7 g^wlt TeU7 
Br^ Or. ab Arthur [Bl ; M.A. li. 1T7. 
Angea du, black death. 

.,Jn9#u9liu(l],paledeath. {2)SeeAngeuCoch{2). 
Angeu Mdim, Yellow Death (Crocea Mors), the 
name of Julius Ctesar's sword (Caes. Comm. 
iv. 4). This appellation may have suggested 
the unusual epithet in the following couplet : 
Orlat a lyiuwdd angeu nulgii, 
Crlat a d7iiodd flwnd ei »>l7n. 

RkytPritJiard: C. yC. Tffi, Sl. 

Cytgod angeu, the shadow of death. 
% The following examples, in which Angea is 
treated as feminine, are remarkable, and are 
probably owing to association with L. mor* ; 
for the Welsh oonoeption of Angea is in- 
variably masculine. 



ASGETJACH 



Ku ay wnyr o^t'u ubct j npp «» ■ •Ifulh o dynyvrt 

A rhTW aitgir JWmnc DT wiu dhrwc TT en&it nuDTn ds- 
0« gullii ■•jd. Iwrfrt yr as^" *o"" T wrtbTf i. 

AngeuRcb, ». [for angeuolnrh: a substantive 
used as an adj. in the compaistive degree. 
Cf. atiumKh, urddutaf; and also ' arti/ru lnr4 ' 
(for angnwl loei) of modem hymnologists] 
more deodlj or fatal. 

Mi ulodsf loir diuput or dnra j porth hwna. hft luba 
a^iffhnafS impeiui Pakgm«d yu^keniFW. 

An^uaetb, -au, a/. deadlinesB ; mortality. 

Ang«u&idd, a. deathlike ; gloomy, dark. 

Arddelmd tywj-Uiroh > chJTKOd -..j-i-W ef. 

Dr. n.Brii,.^: Uyfr lob, ui. 8. 

Augeugftftth, a. bound by death ; bound on 
pain of death. 

At hw] iu>drych j aolwi. tr u^ttt t ly?ut «c m kiw. 
anghtriffatih iclnw. ft^wHHaiuetbet rei a ruehn K<'rv*u^.it- 

1[ Some read ' aageuaetk ' in this passage. 
Aiig«uo, V. to render deadly, fatal, or mortal. 
Ang«uog, a. doomed or subject to death; de- 
MTving death. 
Ang'uag K Bnghyirir 
A chOBf WJf, o ckuuf wiT^—Ioru-^rt^ Fijniflu-gd, 

AngAUol, a. deadly ; fatal ; mortal. 

Hrt pan ■llcy rodr una*'""''' ilynuiirt yd»w. . . Y byd- 
ynoed rn ymkyiDyKU tw ynnewydyawH/ajfl^flo/^pndrniod- 
jv^.—Brat Gr. -th ArUt«r: M-A. il- 176, 170. 

Yna adMbot Bonir T uiai^hiwr duawi lygsffel dyraiwt 
aitghfumel o bunaw. — xabinoffi-itt, i. 13. 

Ac yndluw ]rnt«u Ihe ditp A^Hrrvf ujt unift^ Qfrern. 

Syrthio i/n tuigemil, to fall dead.— flrtrf ftr. ui 

^rtAur'(B): M.A. ii. 317. 
Arfaii angeiinl. deadly weapona ; instrument* 
of death. -S'llm. vii. 13. 
Damumin nngeuol, a fatal accident. 
Angiaolioa ivflUiu, mortal wounds. 
Angeuolaeth, -an, >f. the state of being fatal 

or mortal; mortality, 
An^uoldeb, t »m. deadliuess, mortality' 

Angauolrwydd, ( fatality. 

C^iiAntoullygHidrhBg fwtlednr.i7f,oM-l-B.i Fwympl 

OwireddBK B ellirei <itlur broflyw , tod cMyJsii yn lIcilMii 
yn raddul, yn ou mynychd™ n'u hniiii""iM'K pr J"in ddpr- 
byniixld j trelfyddyd iMdyirDl y diwyllind n bnt'tmodcl mul 
yrmw O^iyddgr.— '^j'rAi;«u'n, i S3. 
AiLgeuoli, r. to render fatal, deadly, or mortal. 

Anghabl, mi . what is not calumny or detraction ; 
praise. 

Dnm jtyw^ir onj/mU-Bir yonhwhledd. 

An^babol, u. without polish ; unpohshcd ; in- 
condite. — It', 

Anfflmdaru, pi. anghedym, a. sot strong or 
powerful; not firm or stable; weak, feeble, 
unfirm ; unstalile. 

Tri axghadiri, lliiwa : sn^hydloldeb . . . rnddroldsb . . . 
cyfoewidioldeb.— SnrrfJiw, i. IM. 



Nyni y rhsi «d jm n ddlypn 



ANaHAETHt: 

An^hadftmbftd, tm. non-oonflrmatioD. 

Anghadamli&ol, a. not strengtliening; noil' 
offinnatiTe; weakening. 

Anghadamliau, i'. aot to strengthen ; to be- 
come weak or feeble ; to weaken. 

Anghadsmyd, t am. weakness, feebleneu ; 

Aug'h&d&mwcb, j impotence ; instability. 

d fynycli * 
~M«dat>a'QmaUur: H.A. i. 404. 

Aughadr, a. not strong or powerful; faeble; 
weak : impotent ; inflnn. 
AglindifT yw uy myv ny nuid hebdaw. 

BUd^fn funU.- U.A. i. SOS. 
Co* yv aitf^hadf lUudisn. 

D. t Cotd, i Bkiulr Owy : K.A. f . 08- 

Anghadredd, am. want of strength or power; 



„ . ^ iri&im, ryu y «^lLirei ndyitawT. 

C^u. Ii,«mf3 (Y OraO, m). 
VrH jot* aolfrwylliJoDa'r moddyifi niflp t hmn. nn myihad 



i. to disclose or divulge. 

Triph«th yffydd.acundiiayiit y^UbuddrindmiTfaTd 
ym mben y tHir biyudd. . . TVydydd yw wyhaav ei rfn. 

Angliadw, a. unkept; exposed. — P. 

Byrt kyrt txidw aokadw ukyurcdth. 

Cs-J^Vk.- M,A. L SIB. 
Angbadwedig, a. not saved or preserved ; on- 
saved, unprescrvcd. 
Anghadwraetb, -au, «/, the Bt«t« of being un- 
saved or unpreserved; an unprotected con- 
dition. 
Augbaead, ) a. not shut or closed ; unshnt^ 
Anghauad, ) unclosed ; open. 
Tsnt ym srgluyd antledyr at ■ Umryf 

Y thcnyii ar ffyulnd 
KlotvBur lUut Uau ohvinMl 
KorftorttcrryKoeiiKliiit,— C'yiHMrlv.' H.A.i.Ml. 

Anghaeadol, ) □. not shutting or closing; 
Aughauadol, ) unindosed; without a lid or 

Anghaeadrwydd, 1 *>n. the state of being tin- 

Augbauadrwydd, j cloned ; openness. 

Anghaenenu {i^, r. to take off the surface or 
coating ; to utim. 

Angbaerog, a. without walls or fortifications; 
unfortiiled; defenceless. 
ft'niMtingA'ifro^, an unfortified nrunwalleddty. 

Angbaeru, v. to deprive of whIIs or fortifica- 
tions; to dismantle. 

Anghaetb, -ion, a. not bond or captive; not 
confined ; free, unconfined. 

Ni bllrai nhwy> pendeflglDn ntE vjnghar and >f y pethan 
n Mflni iKwu )7a num y Unuddi^on; a bon«ddig ydoedd 

Angbaatbiwed, am. freedom from bondage, 

captivity, or restraint. 
Angbaethol, a. unrestrictive ; unrestrained, 
unconfined, free. 
Ufl bua^ rynt yn rfaodio . . . ynrbydd nHtfAadUdvf, hab 
wybud ps beOi osdl dwyn tryTaJirTtli y cutb-ftti^b. 

Anghaetbu, v. to oeaae confining; to liberate. 



Jm V_.(,K)t;iL" 



Anqhafpakl 11 

AsfrliafGwl, -ion, tm. privation; short-coming; 
vsnt of good luclc or fortune ; ill-luolc ; in- 
conTanience ; misfortune ; want ; iJistreBa. 

Ui welat jn Birr lamr a angtajacl na fednl* gnfln ■T' 
nyot ii« bod yn rhy biryr.— Oronioir Owota, SSI. 

Onid gtBwn > gsluTu Uwn f od 7 giwr eywrein tot, go- 
diduat. a faetWild Rwlad Grmm crioed, yn y oyfryw 

Lie T bD mewn onf *<^^l eiilmi Ui 

Angrludbeliad, -au, t 

Ai^haia, eisiau, tm. lack of attempt or en- 
desToor ; non- attempt, 
(kin cyncwyiB— gTTlith am bath, 
Gsmid anfluit y tyd bci nerth.— Jfjw. Anji. Ui. !«■ 

Aiighaled, a. not hard; inobdurate; unsolid, 

Ma«T ged o»*aJ«( ygkalan yonawr. 

Qni*fclli: M.A. I. 2H. 

Anglialedrwydd, im. inobdurocy ; insoUdity. 
Asgh&ledu, II. to render inobdurate ; to soften 

or mollify. 
An^halondid, tm. heartlesaness ; discourage- 

A'r dotald mewn darofn u angluxlmdid a teddyliagaDt 
mai gaJon Sfrale y E«frad oeddynt y bleiddiud. 

AnghalnTii (j)), v. to dishearten ; to disconrage ; 

to deject. 
Anghalonog (Sn). »■ heartless; weak-hearted; 

sjBritlees; timid; disheartened; depressed. 

Ahjnnyo wyntoirfllMbiuin'wtilMiiaKwooad^^ 
Ni Iwyad i aAghato-Ks.—Icbt Jf«. 2M. 

AngbalonogTwydd, tm. discouragement. 
Asffhall, a. imprudent, indiscreet; unwise; 
iSly, foolish. 
As^u y J ^ynny 'J«l y fT* , „ u . ; «. 

Ai y ff«t goreo a aned.— ZJjijml etcw- K-A. 1, Sis. 
A glyirsisti a gant gnt kali 
Yn liyBhori guaa ayluHI 



1 Anohakcbabit 

Angliaiiiftt&u, v. to disallow ; not to grant. 

& y bniuant ewyllymi i aMiawaMii y pdtti yr oeddsnt 
* wBled yn eySwidd I'o haohodoD; eto gim eu bod 
Bdi oaoiada ' " j-« - 

thwyd. 

LtwH a ¥rya: Haddenaiit i-r EdU. IS. 

Anghanlyn, «tn. non-sequenoe, inconsequence. 

An^hanlyniad, -au, tm. a being without fol- 
lowing or sequence ; inconsequence. 

Anglutnlyiiiadol, | a. not following; inconse- 

AnghAnlynol, ) quent. 

Anghfuuiuiwl, v. to disfo^se, to discommend ; 
to blame. 

■Wmwljd y 



enilghim j; Clyuvd: U.A. 1. 1' 
AtfiaU joai dall a dwyllii.— Hturrft. (U.A. iil. 117). 
Trl pbetb a lanwaot wagder : dadwrdd an^AoU yni m' 

f^Kgi diwerthinBBj'ioi/ galonirf"-- ■ "•'■^ t""!"-] 

mnm ffynnon wng.^Myv. Arch. 111. 



Pan aflth Nicvtaa ymaith, 



T «gob daloni 



IT rbynyddo ac efe ^tmn ya well, hc b anfffinnivtkKl'i 
inamB] gyndynrwydd. — SIuLrmt: Drexelina, IS" 



Yr ydym yn Duuno] ddoifod iti waJuirdd ad 
and jt ydym ni yn anghattmoi iti en tori hwy. 






Ang'luuunoliaetli, -au, ■/. < 

dispraise; disparagement. 
An.gh&noctid, ) im. need, necessity, want; 
Anffluuioctyd, ) distress; poreri;. 

Ao a dan kwynair j ukyvnerlh a« agXaiieeiit yn y md 
honno ef a dosti byt ye- Sarytya. 



Ymbaratown ni] 



Pwybynaca ■ 



rt ad Dawar- 



a llaid budreddni 



Anffyddloi 

Ou a dybio ei (od yn gall ao yatan yn angiuUl.—Diarrb. 

Angliallder, j $m. imprudence; indiscretion; 
AnghaUedd, j foolishness. 

Kata<.B*a*feriKryndydyiiikKi^t, - 

Gr. ab Mfrtdffdd: U.A. I. 475. 
A'gtiMd^ y goobel y rhy bcchawt yny ■yrtbyer yn 
Utlh.— Ymlxjra tr SaaM.iU. 

Tri aaai^tOtr sail t dadin u angbaU ; rmgyTKnaw ag 
ughall; a oteiilan gjta Byberwyd a mogagarwch ar 
ugbaU.— J^yv. Arch, lu, jifl. 
ABghaUlneb, tm. imprudence; indiscretion; 
Quwisdom ; want of caution or drcumspeotion. 
Angbaniad, a. eonglesa, without song. 
Anghaniadaeth, -an, a/, inharmoniousness ; 
want of melo«^ or harmony. 
A'd galw r^y am uu gfUir pemiiU cyfarddim emyDt i 
y» et rbas dJatadled o'i rhan ci hunan a'i Aon^imiodMlA. 

Anghani w'^" ■^'^, a. inhannoniouB,nnnielodiouB. 

Eto to "Blif weltbiBa yr amiafaBUBeth yn drwagi, w yn 
riiy aagbylUia. a UiFyi a-ghaniadaldd. ao anghyfaniiedd. 



Angbanog, a. [=anghenog^ needy, necessitous, 
indigent, poor. 

Ovelt aaotainiwa mOr nog f naAdnntiy mynydd. 

Diarci. |U.A. iiL IN.) 

Anghanog, -ion, sc. a needy, indigent, or poor 
person ; a mendicant. 
Anghancgimi, the needy; the poor; almsmen; 
mendicants. 

Hflb ytflulu ay gnyr da ay gueyeyoD ay kardhoryon an 
ojAanDfjjoo.— CKfr"""" Oimru, 1. S. 



Anghanonaidd (a), a. uncanonical. 
Augrhar, $m. [citr] unloveliness, unamiableness ; 
discord. Bee Angar. 

I>ydwytb drdyMawt 
O dyfynwedyd gwawt 
Neut anfar kii<ii/i«laml.~A,B. ii. ISO (Of. Hoi. 1. H). 

Angliar, a. unlovely, unamiable; discordant. 
O garchaf anirar daou* aa duo 
O gyrle uigbBu an jAar dut 
Eeueu rab Uyvaifih dibauatdi drat. 

Ji«>.H>. Ood, US. 
Olt en^ytth yn bypt oet aghtr 
Oct ya oet uf heu oakymliar, 

lAiri^rtlt nb Ufntlfti.- M.A. i. itOS [et. 28S). 

Angbarad, o. unloving, unlovely, unamiable. 
Mao a woman's name. 
DyKiKan dslint o aafrai dyhed. 
'^^ 3?(i«in: A.B. U. »I (cf. M.A. i. eit). 

Angbarant, ennydd, *m. want of love or charity; 
discordance. 

Er amara awTtbeym genhyn a Ktbnmt 
Nicbefflrawirnndiiiiii^Aaniil.— ffoljulitiin.' M.A.l-lsa. 

Angharcbaru, v. to liberate or free from prison 
or confinement. 



,)glc 



} almsgivhig 1 



Ang'hBrdod, -au, on. want 
wast of charity. 

dnuhinuil v d^w pob tjmia «c i uirh iUl J i« ■ phob cybfdd- 
dAwd A chWbdd&i], A phob criuder a chnffdcr, ft phob 
Mi g h n n n d «c flx^Aa/ddiid, m phob rmddwTii uihwil mo kn- 

Anghordodawl, a. uncharitable. 

Yb yr uiuar hwnw, Owj Tipnd uhoddHfrAr us mmfkar~ 

4adal, drnoeUiirTd 7 clsddjT giiUdal gm otiyn ]ir TbukOI- 

dnwyi.— CanvtuMKi,' Hu. Cym. 78*. 
An^hardd, a. not exiled or bmiishad ; not dig- 

Oud atahard ung-lMB ■'« paMkat 

Cki ocdBU osdorion ninuit.— Ci>~Mil<i>,' M.A, i, SOT. 

Lffliarddawd, ddodiou. nn. a being tmexiled ; 

1 being undisgraced.- -P. 
An^harddTiiia.notloTingiiian; misanthropic. 

Nid UfiolwrwT, ond nlTn jvlaa pob crefydd ddowlairl ; 
Aid ymryiQUwr. eithr llkwnidd auokarddn. 

Br,ri Arri: tgl. FfT, xxzUi. 1. 

Anffhftredig, a. 1. unloved, not loved, onbe- 

Dyn anghartdig pan bawb, a peraon not loved 
or liked by anybody. 
2. unlovely, tmamiable ; without natural aSec- 
tion; unldnd; not obliging. 

Dyn anghartdig, an unkind penon. 
Bjdd dyoioa . . . jn Bugharodi^, yn t ■ 



Na fam yn anfj^ratfif uiuf flmun, oi dy^wjdd Iti 
mled yma rrw bethao n* ffit Iwyr foddlon Iddnit- 

rt<n~u a» /</»» (U.A. ill. «]. 
Angharedigol, a. unaffectionato; unkind; not 

loving. 
AngliarsdigTWjrdd, rai. unkindnesg ; disaffeo- 



Y mae yn Arwyddociii y dlyvtyrwch 1^ 
anthartdiafiDadd mwyAf A All tod i Ddnw. 

kd. Si-til : HoU Ddjlsdi. Dyn. It 

Angharedd, -au, *m, disooTdance. 



Adyn opv*a«ii 



»y«Bilid,.' 



Anehariod, -au, tm. want or lack of love oi 
affectdon; disaffectioui uncharitableness; dis- 
like. 

Drmd iml pa (odd y mUIt bni o garisd 
.j: '—'-id ArSy '--■-'— -'-' 



■rwyddion ojighariad A 
A dAikgAwi he^ I 



cuirAaruJ SMltld.— Cc/HiHK* V Briritd, * 

CofiAbyUi Dad y 
ond help 1 fuJchder 



Ly dr^l ya Abnd. 
it oedd afighariad gfireu^pryr 



jynoul pallao 
'stld rbAl anOl 



Baidq jt ydych obvi yu anghariadd. 

Sob. LlK)d.- IJwybr Hy«. K, 
Ajighariadoldeb, am. unlorelinew 1 unohari' 

tablanoBs. 
Oddl wrtb . - . pynfl^en. dy^uedd, a bwriAd dnrg, a 
phob aHffhariadoideb, ^VAred ai.— LI. O- Qgffrtdi* (litAiil)- 

Anghariadua, a. unlovely; unaffeotiouatei un- 
amiable. 

A-fluiri«d<.t pob dittaid.-fl;..rfii. (M.A, lii. H7). 






Augh&ror, -ion, rat. one who doea not love ; a 

discordant peraon. . 
Angbartraf, -i, -ydd, *m. a place that is not 

one's home. 

Oil ddedwydd yn ei Addfff , 
CaIa diriAld pob Amgkartrtf, 

Donh ni r"g»r I'i yrtirf.— Jfjw. Arch. lii. M. 
Anghaxtrefttg, a. not at home ; abeent &om 
home ; not attached to home. 
Na dn DA dm d1 IwyddAnt 1 an^liaTinfawf - - - fKnn o 
Kutjefo^ioD T <h1t ffwiAd s ohmMl ; ac o w 
bervyr, a dlfnird, a Mimefl, ac ymdrm, ao i 
ddellg.— JTvB. ArtI,. &. IW (cf. IJT). 

Augbam, i-. not to love ; to cease to love ; 
render disaffected ; to dislike ; to hate. 

Tri pbeth da chAred neb a'u li^nohart} : tIuwIad t man 

ioni OulUMh; tChtOAdAT.-jryr.^n:*. lii.Ul fcf.tie 

A*r WTAig A ^ATO weled y cyotef. nil akoM^t j ddau tiwX 

Gba tw anghifu ATmlh dnry rybiicbAW drwc ydhAv. 

Tm^KTli ir Enaid.V 
8ef y dymid y ^lomoi oi bod yn angham mthcltilAw 

AngluLTuaidd, a, unlovely ; unamiable ; un- 

A pboii dyntt«l dan Aoori y lAfyn n^i Iwa fdlfl bwn 
AIHgllu aglmrueid y dy*ede[.— Ann n ManHni, {31. 

Y mu yn AnhAwdd cwympo mevD nAriAd i^wrthddrych 
A yinddfliffyi i nJ meVD ^rfidd nwr ubyfryd ao da^Jhom- 
i»dc(.— A. DavU : Bywyd Duw. 95. 
Angharueiddio, v. to beoome unlovely or un- 
amiable ; to divest of amiaUlity ; to render 
unlovely. 
A ngharueiddrwyddi I tm. unloveliness ; on- 
AngharuaiddwclL, ) amiableness ; unkiDd- 

Anghatholigion, t.pl. Non-Catholica. 

AnghTdali^on, am AighHiitlteum (LlAd. AattolliilJ : 
aiir oyffredino] at y flAvIni nhorthynaDt i symmuiidHh 
Egliryi BhutAin.— tfKyililciiua/ar Cimrrig. i. 118. 

Anghau, a. not shut or close ; unshut, unclosed; 

Angbauad, a. See Anghaead, &c. 

Aughauadedd, j no, an unclosed stale 

Anghauadrwydd, | or condition; openness; 
aperture. 

Anghauadig, a. not shut, unshut; open. 

Anghauol, a. not shutting or closing: unclosed. 

Angbawr, 1 a. laa-+<Mwr? Cf. Gr. 'ayX"} 

Anghor, j niggardly, miserly, covetous, sor- 
did, penurious ; illiberal. 

Cybydd anghawr. an arrant miser; a miserly, 
niggardly, or close-fisted wr«tch. 

Cobirdd amghaier dan env ooddAwr, 
Yd gmrtbo hon, hoew-ne hiaon. 



r, a niggardly wretch, a 



Tnoria Owlail It 



n FhtdlfnU. )8. 



EiDiri mwtor dan goryn 

Tn Nudd Had, nlnddAi byn.- 



jM.v^.(,K)t;ie 



Anouavrdeb 



Boediir 



Id gybj-adBigod,— Onmicji Owaix, M. 

Tri dTn 7 BTdd ni vyddya pa nn KTntaf o hoDfot k I i 
idilirl: tvyllodnu; tnlch; H iiii;llor.— ^lannur Jfi. U. 

Tri phetb a ddeDgjs d^^ Aau<r ; rtun Tti drist aflaweta ; 
rboi ni hVTT nn hlr ymAtOfg ; a '^■■^ff*" bt gyhoedd a 
loddvyd.— Jf^. .4rr:k. fu. Ml. 

II In the following quotation ang/iawr appears 
to be used in a contrary sense, not synonymous 
with but opposed to cybydd : 
yid cyiwhAlfl cybydd u rtngkawr, mwy n&'r tmeb yn y 
bodrcdd a r gog gimUd^iu' or y guiffeO' — /oJa Mu- IAS. 
Asglutwrdeb, ) tm. niggardliness, penurious- 
Anghawrder, jnes»; ixivet«usnes8. 

TruetlieT belhach un AnsawrAcr %l niD^lun. Angawr- 
** ™ tTB gopmodh chirant o draphypydhiMCh y gynnolhaw 
4& ttydawl heb dbarbot pa iredh y caphcr, m« ^ryniu] yn 
aupertfeith beb Todhi y ^^tumfxlhum yr tlodioD. on galng 
ubymlboc ywydli y an^Aoimfai,— K-ilort* »r aiuiii, IB. 

Fymhet pechawt Duu-inii>l. ivoiffnfn- a obabrdnetli. kI 
yir unny, hwennytba o dyn. neu geiam da bydawl mwy 
■O d%aini.— SoM ftcAmnl jramuKl, 11. 
Or H. eymer HaeUooi yHydh wMhwyneb y ^Mmn*(. 

I'miorU rr Euid, g IS. 
Ooddineb, aflcndid, infad-wyn, dmrcbwant. a shybydd- 
dod ['oKyAdin^t}, yr hwn dalw^^ldoliad. 

W. SairalKirt: Col. ill. S. 



Anghe&ioctid, ) *m. discourBgement ; look of 

inghetaootyd, j support. 

Anghofiiog, d. un8iipport«d; withoat support; 

infirm; oiling; discouraged. 
AngheftLogi, v. to discofusge. 

Mid MB dim. ebe'r B«ab Seber, ■ woa fwy at lySath- 
sriD dawn syimaud. oa dlya^ru ac anghefmcffi Uu gyn* 
nwynol ^um. — Cplchgravn, i. 288- 

Angbebtogrwydd, *in. lack of support; dis- 
oonrageiueat. 

AuglwfiiagwT, -wjt, «m. a discourager. 

Angbeiiider, tm, lack of beauty or elegance; 
inelegance. 

Anglieiiuad, -au, »m. a rendering inelegant. 

Angbeinio, v. to make inelegant or nnbeauti- 
ful ; to depreciate. 

Angheiuiol, a. not beautifying ; depreciating. 

Angheinmyg, a. unrevsred; iirererent; un- 
hallowed. 
Hedw medlyB meliu en megtiK 
Melriaa angau •ngliiiat,,^ dTarT. 

CtniUdK.- U.A. 1. too. 

Angheinmyged, 1 tm. lack of 

Ajigheinmygedd, ) honour. 

Ajigheinmygu, v. to dishononr ; to disptvage. 

Anglieinwedd, a. disagreeable to the sight; 
unsightly. 

Angheithiw, a. not bound, capti' 
unconfined, free. 



; dia- 



Anglieledig, a. unconcealed. 
Angbelfydd, a. imskiUiil; clumsy; awkward; 
inaccurate; improper. 
QwaeUt afttlvrd laurth.—Llfwanli Htm: K.A. i. IM. 
stnbd 
V- 
BMdfn FanU.' It.A. I. MT. 



Toa y dywetpvyt j witic Huiteid « dwit MaTtmtlla bot 
yD afikelugk yd aiatedei ar y pienn kyaK^redic 

£/<n j^l JVic«fe™., 1 10. 
Gnaird dial ugbvbl no anghtiftdd. 

^ * ^irtb. IM.A. ill. IflT). 

Daeth Dafydd ab Bdnnrnt yno dan ddallu beiidd oAgMf- 

fddl'ingonbenlim.— ftiimrd AV^iU: Cyfr. y BsiMd, 8. 

Bbyw angJvJ/yiU brydydd bran 

O Biflanydd wyf flmuiD.— JMr PanU: iSil Awen, 79. 

Ajighelfyddrwydd, tm. unskilfulness ; dumd- 

Anghelfyddu, v. to deprive of art ; to deprive 
of skill ; to make devoid of art or skill. 
Nid iawQ 1 gyfiaith anwrtaw g;wr, neu aightl/tiUu odt- 
yddyd.— jr^. Arci. ih. SfO. 

AngheU^irddyd, -au, rm. lack of art Or skill ; 
unskilfulnesB ; artlossness. 
Hya, mal liaWar o wrthebiadan erefll yn erbyn arferiioi 
buddlol, a dyfa yn llwyr odd! wrtb muH Ho angfittfitdd]/d 
y rtiaiyiiyddynewyiio.— IC. O. /V*«- C.P. 12. 
Ac yntau fydd fnu el fryd 
I taddeo f aivM/W/d.— Dl«( Wfn: Bl.Arf.S08. 

Aagh«log, a, unconcealed, not hidden ; dis- 



Ki ddylom ajigfaoflo ychwaltb mal anghtlteiddio y Dywy^ 
ogaeth fydd y caolyniad.— Oofcuod, Oorph. M. 18J0. 
Anghelu, ti. to reveal; to uncover; to bring 

to light 
Anghen, -ion (c), »f. [C. anAen; Br. anam; 
Ir. ifxn, eigean, gann; Qa. figin, jonn] 1. ne- 
cessity, need ; want ; destdtution ; poverty. 

Br aadnabydlr bcth Twyf yn of Aflin ae da a« dr4c. 

Si. Or«i,HS. 
Owahcdwyr idaw nydd yrel bynuy ym pob gwyl ubomlc 
oaybei oawr agliauon yit «u \hiaytA,—iiabiivfis*, iL G. 
Ovam Dnw dy Q.glu:».—Ct/nai JfynMii : A.B. ii. 120. 

.. gygboT kwbyl or nirer hwnnw e perit i 

irto areluamb k j awi S ' U Arthnr en ncnhin. a dodi aona 

ben. kanya ni hamrnn oed yn eu kymholl. 

Bnl Or. ai A<Viur: U.A. U. IM, 
T llall a to yn waatadol yn gynuorUiwyin J mi yn fy 

Bboi aKfkit on rbvng y naw.— i>nn Wf*: Bl. Arf. 100. 
Anghen am, need of ; necessity of, 
Anghen o^ Anghen am. 

Anghen yn artgkat, neoestdty in necessity ; a 
tlung most necessary. — Legea Wallicae, TV. 



Dyrrtoardi 



Cymmergd cynghor gan anghen, to make a virtue 

of neoesdty. 
Plant atighen, the children of need; the sons 

of ueoeMity. 

2. invincible necessity; fate, destiny. 
Kyfarcbalym nn 
T yrtyryaw aweo 

KT - 



Hydyr nam kyn oaVH aehm. 

frgdgSi Bgc*n: II.A. L KB (at. *»). 
I. extreme unction : also called olew ac anghen, 
and olew, as well as anghenad and anghenan. 
& medyoynaetlm meit dyn^or aslth beohawt m 



md0d kyaaegndiL 
AlOrra I'T yipryd Cell o'th bl«n'd 
Cyn pridd a gveryd oia ffftafandaw 
A dHiflaal >attn « sin. ^. a pileni a Ue 



kynunyn. penyt. offgitetv 
-Sailk ftdiaicd Mancamt, \ I 



{of. «H). 



glc 



lin CDflf CriM, me offii- at aghf,. 
t 7>Ky»iii'.>rt, ISO (cf. IM, 1S8). 
^t drn or flelth p«^wt rHKrwiiirl 
-■ — rr eglwyn nrt amscn jut. 
t yD fryutBr oil a noriyiii, a 
ra cyaflwredig', a phriMaA. 
A.lFKrl J(i. 350. J16. 



J rod™ Du -' 

bedyddanj 
■cSTrfyg, |>«D 

(.'onudjiii.' M.A. I.43B. 

Mi* Tachwed 7 bu ii»nr Owrin Owynfd . . . TedTkymrTt 

pflijt ■ chtiTca KF nlinnncrh ■ chymun linwaleu aarll 

Crim. K o'™ Dt air*ii«.— *i-iu y rjTtjrMyio., aos Icf. iMj. 

Angban, a. necessary ; ueedfuL 

Cjm dfddiir angeu ao^ni dnlkvd.— JT'i/ii-.- U.A.I, IM. 
Nj thmirdbebof aghof afJtn,— cynddilv: U.A. <. ISO. 
Am Tftl Kint craiiidyT nef r* o^Aab 
TragkreiD agkrel jn fgrlohyii. 

EliiWSoii: U.A.i. SM. 

ISIheSi^' i "*" t"")- */• exlwme unction. 
T bammed ■untsn yw^ alew, a slwir angirnad ; ban a 

roddir pan fo dyn yn tmiiru. iwfjfl — "■ ' 

oythraoJ- — Llg/r tJw^n Her^ttt- 






Ja^hnmi glaf-waD jlwyfawl, cwyn Ingiu, 
Cyn an»n errbylliair]. 

Bbag bacbeU a dJcheU diawl.— 0<i«r<> «> /'ui J^n. 
AnKhendod, -au, am. neccssitoasneM; necesaity; 
a state of privation. 
Lla Tap Coe] ... a acbwaocgTB rodyon o lyr a dayar ac 
eiatedvaeu acaholl rydyd eii bMycbuaceu kaditnhau. ac 
eu haidyrchats«] trw; bob rydyt y gtn y bnnynaiil aiahm. 
ifiiwf.— Ami a, ai Artliiir: H.A. ii. I9H. 
UaJ nlfpDtyn ff»g\efidated nwn rhyw wlad amUinigar. 
Heb law i'w gytncrtliii, na biuD a dsiml alar. 

Aaghenedledip, a. nnbcgotten ; uugenerated. 

Aiighanedlie4ol, a. imgenial, not congenital. 

Angh«nadlog, a. ungenerated. 

Aogbaneddyl, -ion, im-/. [sngheu+eddyl] a 

noceBsary quality, characteristic, property, or 

attribute ; that without which a thing cannot 

exist; an attribut«, property, characteristic, 

or peculiarity ; a requirite ; necessity, 

Sri y talr llythyroi tin, anryddaw tair aiiir*m'<M#' Dow 
a wnint; iiidHjng«ii,<Anad,fifV7boda«th,a^w]riofifdd. . . 
Ad wrth nyn o dr^fn ac aiuawdd y dodwyd lair vsgwt radd- 
aw] ar fcirdd Ymjt Prydaiii, ar i bob -an o'r tair, braint a 
blaCD a gorcit, parib arbenict«r ang^fneddgl Hug y ddwy 
erdll, bynnae o ba rai j b6Dl : d dair onyi/naWjl Dow y 
tardd pobgolla agityllyaadeddf.— SanM™, i.ai (cf. sao). 
Triphri(<injft-n-*(ulDu«; aylwcddipwybod; agallu.— 
^i pbiif anghfnfddtft pwybod : t«tmlaa (■ynwyr) ; dc«11 ; 
ag fwyllya (ymgalaj.— Tri phril aHfAnnlYyl sylwedd^ 
dafyuydd ; anaawdd : ac ymmod. — Tn pbiif nn/hfjieifd^t 
Sallii : dfiad ; bryd (ymgnia) ; a tbnfn. 

BartUaa, I. 18! |cf. 870, 180), 
Tri a-giratddel bodoldeb Dnw: aylwedd; bywrd; u 
jrmmod. — 3fyv. AkK iii, 314. 

aa diobon, naa caia, a^ na* ewyllyiia'r 



Gan nad oea diL_ _. 
TriaKgH/sAldi/lhyiryil: i 



». LIS 



I: gni; ymwybodoldcli : acyouDod. 
Mfv. Ardl. ill. 214 (cf. 318). 
Tri chyatadgasUi hantod : aef ynt, tri anf «n>»U(i l>nw ; 
Did amgeo : oflrUk ; givjbod i a obariad- 

U,v.Ar^.m.n*. 

Angbeneddyl, a. necessarily inherent; exist- 
ing by necessity; necessary; inherent; re- 
quisite; indisfienBable. 

Caoya aajimnMjr; iddynt gynnal a duuhinhaa awfr, a 
heddwob, a ieddl.~Tolt> Mi. SO. 
Tri nod aiiQhairddtl fwinoDfdd. 

/tanUat, I. 840 Id. 180, XBl- 

Anghen&int, a. of TWt bulk or sixe; huge; 

monstrous. 



AnohehmanfoD 



Anghanfbiut, rm, vast 
monstrosity, 
Ac ■» yw rwrakbionm o frwi 
yma, belt fjfdd fi ii«^*f n/nj.i o t 

Anghenfll, ) -od, *m. a 
Anghynfll, ) and morally). 

Trnddangoaawdb j mait y Saial 



Ar arib adywedTntaarwydixvapiy ryw nd^ynviV o gawr 
aymladelaoef.— Sml Ur. st .IriA.r (Bl : M.A. u. 334. 

Td amaer T Morydd bmir ydaNb i n^tijCI mawr arucndd- 
awl pedair adciniawv 1 Fur j Wi^doo, ar a ddarlh i dir 
yo Nyfed. . , Morydd a (ynai ymladd as i>f, ar a'i llrfmyi 
yn wrawl, eithr jr anskftijil a'i Uaddca m.—Joia JVh. at. 

Oai byddai j fatb betb ya angh^Jti aofprtb T 

•WO. ebi ynlaa, ti a iret b 
amgkntJil yma wnb ddjchwvlyd. 

mu H>«».- BarfdOwaB,84. 

inlhviifll' i "■ ™o°«'™'" ; enormous, huge. 



□ cSwyditof, 1 



cu ffwneathur i f ytyrlo ar y ewiriuk , . ^, ._ 

moTfawragogoneddua !-/«•. r-fuu: Buch. Oriit. 7a. 
T r hyn , ytgattydd, all tod y 

lauiait anftrnfil.—Iai. Tomai.- Bocb.arin.^ 

Aughenfllaidd, ) a. monstrons; like a mon- 
Anghynfll&idd, | ster. 

Hi chaiff y llynid ea blino yn nnig- gan dtn yn daflo, 
ood hwy eiot befyd eu poeni 1 Uimiao dycbryollya aa^jbat- 
filauU.—Onff^id H^tm: Tatyr. iL 1 (181). 

Tr oedd y OigDlloo yn Anteioedd yn nglan y mdr, 70 
aylwi ar y llongau fel cynnffar □ anB-henfllDd y dyfod^ - . - 
ganddliBwyl vi cjwioiiangArnjiiaidil (yi:ychM)gyiDm«yd 
fldyn a ffoi ymaith- — Ufuad gf Oea, L S3. 
Anghenflleiddio, ) v, to become a monster; 
Angbynfileiddio, j to make a monster o: 



gbynfilei 



AugbenflleiddrwTdd, ) »n. monstrosity, mon- 
Anghjmfllaiddrwydd, ) strousness. 
Anghenfllea, i -au, </. a female monster; a 
Anghynfilaa, ) monster of a woman. 

Bfe a gafodd fywyd blio dnH boll amspr Hari ; athr wedi 
manr yr angliejyfilti bouuo, fe'i badlerwyd i'w eglwya. 



plentyn diniwed wedi end o 



m, ef allal, wedi cad .. .... 

nghmfil'M yn dwyn delw dyn. 









Anghenfod, -au. 






a necessary being; < 



1. necessary being t 

H let. 11 



that necesBarily exists, 
Rbal o'r ben athrawim a ddalieDt dragwyddnl hantodiad 
dwy c^wyddor, da a drwft ; a dau fod, y da a'r gdyn, ffJ 
anghei\fo4/in traffWyddu], un yn rfanddwT bob daioni, a> 
llill yn dad i bob ahwydd. AMniydd, i. 1S3. 
Anghenfod, a. niM^ssarOy or unavoidably exis- - 
ting ; being of or by necessity. 
Drieg anghcii/od, evil that necessarily exists; 
necessarily evil. 

TmmbobcyflwTaphwnco'rabredgoriidynoldeb,drw^ 
an^Aem/od yw pob bywydoUen, a rhwym nmfhntfod wrlb y 
drwg o Iwyr anfodd ae aoalla- — Bantdas, i. !]Q{ef. 3^). 
Angbenfodawl, a. existing by necessity, 

Ac wrth byu y gwelir graddaldcb oDghmfod ar bob han- 

fod menedig, nn ddecbre'n aa^Ae^/odavi yn j mdd iaaf. 

BanUaa. L MS. 

Angh«nh&nfod, -au, am. nocessary existence. 

. Triffiij/Airr^AdtiyinJIajighenDrfDd, anghenhenyd}I>uw: tra- 
gywyddoldeb: gallu; a ehahad: art a'u getwit angheo- 
henydlon l-orfodion) ao^ naa gellir Duw a'u liamnn. 

fianldia, i. \m. 



Akqhenhknyd 

Asglienheiiyd, -ion, em.^Anghenhan/od, q.v. 
Asgheniad, -au, am. & necessitaliiig. 
Angheniadu, v. ro refuse leave, Lberty, or per- 

AngrheniatAd, odau, im. disallowance; non- 

permisaion. 
Anghenistaol, a. not permitting or allowing; 

Dnpertuitt«d, disallowed. 
Aagheniatau, ) f. to refuse license. or per- 
Anghetinat&tt, ) mission; to disallow. 
AnKheniuid, -au, tm. non-pemiiseion, non- 
allowance ; the being without leave or license. 
Tnii caeth^lud y sydd; geijTi f orfodediit ; ft ^villiaid 
tifwdhebfrauit.liebgeaDad.— ,lfyv. .iroi. iti. 2%, 

Anghennadedig, n. not granted or aUowod; 
disallowed; prohibited. 

Am priodiw muAninnlerfij;.— lucirfni-. ) 78 [of. BO). 

AaghBrmog, a. [cen] without scales, scalelesa. 
Anghenoctid, \tm. necessity, need; necesai- 
Anghenoctyd, j touanoss ; distress. 



Anohenuiieidiol 



athlodlrwnutlir 



drgl, Dio4}d J lie] 
II Otfrrdm [Owe 
Tneinboll otthfymdera'n »anjA«ioei«,— 1 Thea.iii.7. 
Aii{fh«nofyn, -ion, tra. what is required of or 
bj necessity : a necossaiy requirement. 
M phrif ^rfrnmodaliDQ cylch y pwyofyd : cftriad Iml t 
ho a nnghtnn/.vh ; trefn hyd niB ^rrdiir rrell ; a^Fvrboa hya 
y gellir meddirl a dinmd. — BardJat, r. 192 {cf. 200)- 

Anghenog, ) (e), a. necessitous; needy; poor; 
Anghenus, {indigent; destitute. 
Kyn Irayf oHilowur anghenwar. 

Ci;>uM</>»; M.A. i. 349. 
Owdl bedd lu buchedd nnjAtnniiv.— JdId J(>t. IS3. 
Efe a wwTd yr on^ A«n0^ pan wofddD. . . Efe a arbed y 
Uawd a'r rheddas. ac a achao eii«idiaa j rboi aij/An'UJ- 

Ni *yrU8iini gwyn angSamif.—Iclc Mis. SS7. 
Hirchwedl ongimaKg.—riiani. [M.A. Ui. Ifl2). 
Angbenog, -ion, -iaid, k. a necessitous, needy, 
poor, or indigent person ; a beggar. 
A nghenogion, the poor, the needy. 
Ac y doethant yn angluniisnim jr Dinr. 

aucAaW MnTSTnl: C.B. Sainta, MO. 
Ydaa vyonaaaewch chwl y rodi y mi. rDdvch y 4i^Anioff^0n 
yr kaiyat Duw-— ^H^jm a^c Amiy, oof. 1067. 

Drwy dwykw vy melbon i y rodaf y a^dirroFsron. a 
gwTBged BTredw. a meibon ymdiuoit. 

BurJIaU Hnir. iS (cf. S). 
A bwimw a wtia kyuyawader a i^roned nc agtifnogyan. 
Praphmgdolvitlh SiWi Bdo«M, J B. 
CaDya yn wairtat y keffwcb ag/unnoff^im y gyt a ohwy. 



Ermwynaar 
foa, y cyiodaf.- 



WK/rS 



[i.6). 



Ootca d*fAflifi^uf geifr. — Hiareb. (M.A. iij. 1C7}. 
Anghenoges, -au, »f. a poor woman, an in 
gent female. 

Arglnyd lettywr caredie. cadv di dy anghtnnooa 
iLwiat.-tJt/T ««■»» Khsdd^r^h. 

H 



n. necoasitousncss, needi- 



Aiigh8iiogi' w y dd, 

Augbenusrwydd, | ncss. 

AiLgh«nol (e), a. needy, necessitoua, indigent. 

Girall bedd dd buchedd anjlruo/.— /)wr-ft. (M.A. i. 1891- 

Angbenor, -ion, $m. a nooessitous or needy 
person. 

Gwyr a a«th Gatraeth ^aa vawr 

l>™ymyrrwB eu huet eu hnn'tannwr [aL hBLDgnnaxrT, 
haDgenawr].— .:<BBi.nii ; Ood. 91. 
Anglienorfod, -au, -ion, tm-f. inevitable ne- 
cessity; cogent, impulsive, or Gonstraining 
necessity. 

Tri anghnuirfod dyn : dioddef ; Dpwid ; a dewis. 

B-r^dat, i. 1(W (M, 868). 
Tair anghraor/od y aydd ar fatdd urth raid ao achoa gwir 
a t^hyflaimder. — Barddaa, ij. M, 
Ajighenorfod, a. inevitably necessary; indis- 
pensable ; essential ; insuperable ; inevitable ; 
necessary. 
Tri ^wahoniaeUi oRgfintarfod rhvne dyn, a phob byw 

Anghenrhaid, rheidiau, iin. necessity; need; 
a necessary ; a requisite. 

^ni/AenrAeiiJiau, necessities; nocessarios. 
Aityhfnrhtidiaa natur, the requisites of nature. 
Angheiirheidiau bywyd, the necessaries of life; 
requisites for sustaining lite. 
We dy radnmbau caatcll LLaa Ymd^fii o wyr ac aru«u a 
bwyt, a phnnanuaT ac ag/ifnitiUu orcnlL 

Xid yawn draetbu or ryw betheu bynny. narayn pan y 
kymello anghtnreU. — Brut Or. ab Arlhar: M.A. ii. 27& 
Dau ryw nni/Am'-Adi' yasydh. — l.tieittar, 160- 
Canya felly y trysori i ti dy buD wobrdaiannsErbyDdydd 

MetfYB pe fOBodai effl nyoi taa angh^nrfi^ut i vmeutbur y 
peobo^n ag y mac efe yn ddialwr amynt. 

anghenrhaid, of necessity ; neoessarily. 
Ajigbenrhoid, cp. rheitied, -iach, -iaf, u. ne- 
cessary ; needful ; requisite, 

^f A'-nrfTf yv y bop dyn o myo kaffo] ywbyt. a KWarvt tra- 
n'wyddawl oo eneit. ki«du kymryt o If«au Gnat an Qar- 
glwydd ni ouwt ofi eatit dyn. 

Crrdi, SI. JUancmoi (Hengwrt Ma.], SIS. 

P^ fai mor angh/nrhaiii i ni ymddar^roq ger bron 
tywyaott daiarol, ag ydyv gmeuttiur ela hytahJlJAU o flocn 
gareeddtaiocyrtiad.— Erf, Samuel.- Athr. ytEglwya.aa. 

Mi a vyimwn htb y vienhinM y vot ff yma kanys ()«d 
mor anjIfBrni ytb yma di wrthair cf o hynny. 

a.Ortai.ilM. 

Omil cfldw fy migian i wailh aN'^A"'r^r^OllFA. 

Ajighenrh«idio, v, to make or render necessary; 

to necessitate. 
Ajighenrh«idioI, <i. necessary; requisite; need- 

Y mae yr Yagrytbyr Lin yn cynnwya pob peth iinshrn- 
ricidiol i LlchawdwriMlli.— tl. <l. atiffrtdin (&Ui. 6). 
A'r hyn a fyddo nnjimrfs/dio/ i boelh-offryman Dnir y 

A pbeiiiaunao mtlmrliHdiat Vt gelfyddyd. 

Ni allwn, gaji byny, ddal aylw fad ailenodiffafrth yn an- 
hfheorol a«j»'«r<-WW.— W™. T.tri': lirjrhYfJ.X^. 



,>glc 



AjfOHENBII SnilOLD EB 



1. necessity ; 



Anglienrh«idiold«b, - . 

AnglienrheidiolrwTdd, | necessity. 
Anffhearheidrwjrdd, 

ness; requidteness. 

0' FodyTmsunpil nn a elv 7 pfTW>naf^hjiii i irtel eiioddl 
•t adgyvario J biwrdy, oa fjyddoi atyhettrhfidrwitdd. 

D. Ptit: Hsdm Crcf. 408. 
anghenrhridnvydd, of necessity ; necessarily, 
AnghenThddruffidd unhebgorol, iudispensablo ne- 
cessity.— /m. 'Tomat: Buch. Grist. 336. 
Anf henu (c), v. 1. to necessitate ; to become 
necessary or requisite. 

Hub B.J mat anet 
Mablneit d^R'bet 
Aghfnnud nffla^ 

2. [anghen 3] to ajioint ; to rub with oil. 

olsD Iswer o gleifloD.— W. Salaburg : Vttc n. 19. 

Osl ved am benadorisid n (slvTS. n rirtddiiHit iry trogto, 
Bcellftnt [•iTiiBmtiant.a.,*^,,!'^ n^olewTnenw'r Ai- 
glwydd.— ii^. Jiie^rd Dames: lo^ t. 14. 

3. [anghen 3] to administer extreme unction. 

Fommct rinwed jw nggtnn^. acf jv bynny. dudi olev 
kT^cpr^dicardTafmywndeurl pona-lue. yd iggennii dyn 
trwy leindit buGh«d. madenf?dic vyd idnw y boll beobodeu 
m&dfnawl. Hj ueil^ both a dyiredir y djunwdnaw, wr y 
dfiijy»ynw y agbeu. ae cnfffrl lecbvt ar r^Tr o amsser. a 

ra dyly nj^snmi y ifjTufer KweiUi y dyftwytbo ymywn 
yt periglag. - AnilA /VcIcidiJ JfanmW , ) 6. 



Mae'n B*r i'r (fan a-rff^fnm, 

/n'o .Worviiiuv- Salmao. 1. i. 4 
Ttla-wd a'r nngkenm, the poor and needy, 
Aughenusrwydd, »m.=:.Ang)if:nogrv!ydd. 
An^henwri, em. need, necessity. 
Anf henawd igrret 



Tri angHnvrOim b*tdd : eel lluii gan orfod. bt Ilea a 
beddwcb ; cwya irrth anfawl ;an py^wndor ; a qoethi 
deddarddifrawdacanHuJUi. — Barddtn, if, 86. 
Augherdd, -i, if. what is not poetry ; an im- 
poetical verse, song, poem, or metrical com- 
position. 
Tn pbflUi ni ddyly oei^avr en credu ; ^ogan dervr. He 
y pryto prydrtd : a ebann anghtrdd brydydd camsolvdK 
ag awdu^wd iddaw.— ilintiu. il. Its (a. U.A. ill. lOi). 

Augherdded, -ion. mn. [cerdded] the wander- 
ing of atravellcrout of the wav; an untrodden 
region; awandering; aberration; aberrance; 
misfortune. 

Ac DfiUy ^ ba flf yn liir yn yr aglitrdft bvuiv. heb dy- 
wedut vngeir with neb ryw gimtaim. 

MablKogiim, I. 2«6 (of. ii. »]. 

Ccdwfd ef Croawdyr nef 

Nawdd am oin po^odi-ii ni 

Kbag anahfrddfd 

Rbaranwared 

Oeaiawl to'rBi,— OonMiuiau Jfji^ia; M.A.l.SS». 

T drdd y byddcnC dy Uteion 

Tn fy uuUTCb daa amyddioD, 

T Tbai'u a ddyga i ntg^rrdiitd 

Yferehgallaf B'raanod.— rioiwu Owain. 

Angherddwraidd (w), a. nnpoetical; inhar- 



0*«11 



Hew yn ei dew oag 

cerddwT no dan ani 



ei dew Bag artb, n 






6 Anquloo 

AnglieTddwria«th, -an, t/. want of poetic skill; 
lack of artdBtic stall in poetry ; want of h«r- 

TH pbeth ni cbynffhain mcwn cerddawr : anvadolwch ; 
ysmalSiivch -, ac ti'ighfrddvrwth. 

Xtv. Arch. iiL 136 (cf. U6). 
Ajigheri, v. to ertort ; to deal hardly. — P. 
Augliarydd, -on, tnt. impunity. 
Ajigheiyddiaetli, -au, ■/. a being unreproved 

Anglieiyddol, a. onreproring ; not reproving', 
rehuldiig, 01 reprimanding ; without reproof 

Aagbei, a. strange ; foreign. 
A galvn ar y gm sa diKonea 
An notbwy nm Kwyth llwyth aian. 

ToiiMin .■ A.S. ii. IS4 Id. M.A. L or). 
Ajigbauddyl, -au, am. occupation. — P. 

Ac ar byony nacbaf dygynor owynl ■ glaw byt Dal oed 
bavd ynebvynet yri^A^rfn'^J. acracannvimvytbdet g&n- 
tunt «u kerdet dyffygyaw aomgant. — ifabiitogion^ iL S73~ 

^ Possibly mi8writt«n or misread for a^Aniedi/I 
(angheneddyl), q.T. 
Augheuedd, «m. [cau] openness. 
Angheugftnt, a. [ceugant] not oertajn, un- 
certain. 
Ag eno vrggyoH ar petb bvmnr en ndlcu^iif (at maetlien 
a dc?u VToder nyt amgen Utber ac Emreyi a ttdaaant bs 
meybyon kanUiiint byt an Brytaeu Vecbao. 

Srui Or. ab An^nr: U.A. ii. 241. 

Anghibog, a. [cib] acotyledonone, faaTing ao 
seed-lobes. 
Angkihogion, acotyledons, 
Anghladdedig, a. luburied, nninterred. 
Angbladdu, v. to disinter. 
Angblaer, a. not bright or clear; obsoure; 

A ffalHt ao augUaer mm^aer mawidvyll. 

Mab Crgg: ii^A-LBBB. 
Gae angVoer mewn cyfyng-lwybr. — C ah (ftoHgtn, Ut, 21_ 
Bid t Inglont byd aigUnn-.—L. a. CViUU. 1. xxtr. S3. 
Anghlaerder, sm. obscurity. 
Anghlau, a, [clau] insincere; dishonest; dis- 
knaviah. 



ingenuous ; 



Ond angbymi 
T Uall yn aigiUni 
Tnwiwagunac 



lod angled onglau, 

^ Gt. rnoJ C«*: M.A. i. U7. 
maintr nn yn frwd, 
1. niH eydvedda ddim 

.— u: O. Pligti: C.8. tiil. 480. 

ot warm ; oold ; cheerless ; 



Angblftiar, | a. 
AngblfteoTf J dismai. 

XJefain anghlTear 

A fydd ar y iiaai.—Tnliali: M.A. 1. SB (Ll.P.P.). 
O-iaagt^MangliSatiir.—SKialdMah U.A. i. Ml [d. aiS). 
6wely agilaear daa&r duMd. 

Ifriiirith GvMlcJimal! M.A. i.3H<oI.8ra,S49J. 
VlibaaiamgVauar.—ar.aHlfcrtdgM: U.A. 1. 418. 

AnghUttder, tm. insincerity ; disingenuity, 

Anghlo&idd, a. not apt to close .or fasten; in- 
conclusive. — JV. 

AngUoawl, a. inconclusive ; not dosing. 

Angblod, am-/, dispraise; reproach; dishonour; 
disgrace. 

Oa y bwrw a denr yr marcbam- rif gwr mwyn or Uya a 

ird amaw gan y maJcbBwc. ac agtot dngywyddavl y Aiv 

uiiu- u> Tilwyr. Oi y lad aderw yr ogim a goda ml kynt. 

XnMmogwn, I. HS, 



Jm V_.(,K)t;iL" 



Akoblodfah 



d gael bd DM <vM BT 



O ins kadt dwyn df "«*( U iinuf b^ r bu d]' glot 
rnpedirnol byt bellkt.— iAJHu#»ii, ii. 304. 
Tfioy anghlod a chlod, by evil report and good 
report.— 2 Cor. -vi. S. 
Anglilod&ii, 0. [oDghlod+ban] not famous or 
renowned ; ignoble. 
Nft o«d ■gclDdiuvr lUm pan llatel 
NTtoedarcJfdaanToiuuirdiiei. 

C^hAWb: m^. i. aiB. 

Kjbjtax^Muonyljaimybd. — Llj/fod Ovt; M.A.I. 343. 

Asghlod&wr, a. not tamons ; without honour ; 
nnhonoured; dishonourable; inglorious. 
Krnihell Medrrnvt u lu m onu Araur i fa en irur&redic 
■yUfWavr.— £n>( Or. ab Atthiir: H.A. U. SM (ef. titt). 

Asghlodfori, v. to dispraise; to reproach; to 
disbononr. 

Ac ot yigBeloHsfl T "lot beb aoinva idi nerth Mhraghar 
DF nir njtwyd ^rof . ac r ^yt ft faynii j vy anfftiotnori mwDolT' 

Mi ui g&IwBf fif 711 umudoiuwl- ac ae hagctotuoraf. 

Ytloria dt Caroto Ma^o, col. 416. 
At glerwr y pertbyn soBiiiia h; naoiUaii/ori, 11 gmimUior 
cywilydd a gvaj-ndwydd- — Edfgrn ; Doflparth, 37. 

e, renown, or honour ; 

Ti^tfydd nld ond B y ddb a «aeth 
AngUodmt Knyf pan lyddhcid prin Uai 
Naluiu>aeng7ldDr{.-H'. O. ftw*< ■■ CO. ii. IM. 
wiw, a. not 

f honour; ignobli 
Ang'M&edig, a. unlocked; not locked; not 

(xniduded. 
AmghlOedd, 1 «m. the state of beingun- 

AngUOeiddrwydd, ) locked; inconclusiveness. 
Anghloff, -ion, a. not lame or halting. 

In the foUowing stanza from an obscure 

lampoon, angktyff appears to be used as the 

plunl form: 

Otuot ^eiriaa oTyff 
IGBglVa fan fwjT a^Usff 
O ddan gwya Hd gau ei gjH. 

AngUudd, 
obscured. 
Qwa o ddwyn torrwrn toif analudd. 

D.Bnfral: M.A. i. 314. 
A»g\tiU '.at. an datl ywmt onr noddiad. 

Talttm: M.A. 1. » |cf. A.B. U. IIA). 

Aitghlwyfadw]r,a. invulnerable; impregnable. 

rehi riu^ cyrdi-ymoflodLadan tnunor bvy 

AngUyd, a. not warm or sheltered ; uncom- 
fortable ; cheerless ; cold. 
O ganhar anghlasar niffU^d.—Efidir Snit! M-A. 1. A49. 
Porthwyd tj nyn llwyd mewn llawr rt^glgd. 

Or. ab Mcr-djild: M.A. 1- 4H. 

Angbljrmog, a. without knots, knoUess. 
Anshlywedig, a. unheard ; unheard of. 

Kyi'TdnlaeUim J kywydplTon o o»Wjniw(i>iioii nanireu 
kdnneadetfa. — Campau CSaAj/maai, IS. 

Ac ffvcdj kaiTael y vudugolyaetli honno Bran a byrwa 
jn unhenwdTT jn RaTcyn jn daratwng j pabyJ o ajfiti/- 



Mipped. 
Anghnodawl, ' 



having no flesh or body. 



1 7 Ahohof 

Am^boel, -ion, im-f. 1. disbelief; unbelief. 

Ac niA cyAawn anfflvttl grwyrtit ar weithnd i chvi. 

Da/. Ffiiait : Efeng. Nfood. It. 
Hewn ymmtynjfiad raawir I atglnMl diniwm dn modd- 
yliau.— /tit. Taxuu: Buch. Orut. 179. 

2. discredit; diBeBt«em. 

Beth yv'r acbo* fod rliyw nn p«hod yn peri y taCli 
aaahatl k aurhlod {"r drnlon perffdtlual I 

^S-htj-lUviiid.- lJwybrHyffordd,226|of. Ml. 

Anghoalbar, a. that does not induce belief; 
inconclusive. 

Angho«lbaredd, »m. inconclumTeneas. 

Anghosledigaetfa, -au, ^f. incredibility. 

Anghoelgar, a. unbelieving ; incredulous ; dia- 
trustfuL 

Anf[hoelgarwcb,«m.incredulousnesB; distrust- 
fulness. 

Anghoeliadwy, a. incredible ; not to be believed. 

Angboelio, v. to disbelieve; to discredit; to 
distrust. 

Tr un Dmr ag nydd yn rwahardd dywftdyd wlwydd, 
sy'n eomiaedd I a aaahotUo't gvir. 
' ' Ch. iitiard. .- Han. 7 Ffydd, MO. 

Nid oea acIuM yn y byd i neb anghttlio yt Bplatol at yr 
Hebieaid.— Ed. Snmurl! OrotiDs, ia. 4. 
Edliw T DM gmthddadlwyT 
A'n aam, yn anekotlia'I a^. 

OKoOlcr Xrduiin : OwaiUl, i. 3M. 

Anghoeliwr, wyr, ) *m. an unbeliever, a dis- 
Anglioelydd, -ion, ] believer. 
Anghoelut, a. unbelieving; incredulous; doubt- 
ing, soeptioal. 
Anghoetb, a. unrefined, unpurified ; impure. 
Anghoethedd, | »m. impurity ; lack of refine- 
Angboetlidsr, ) ment. 
Aughoathinab, rm. impurity; want of refine- 

Anghof, -ion, mt. forgetfulnew, oblivion. 

Qollvmg yn aitghof, to forget. 

Oadael yn anghof, to forget. — Marc viiL 14. 

Myned yn anyhof, to be forgotten. 



Na ad Jiyn anghof, forget me not. 
Tir anghof, the land of oblivion, — Salm. 
Ixxxviii. 12. 

T mMnt yn airor, ebr Tnt«a, i Dir Anf^of, gwlad (awr 
tan lywodraeth fjf mraiid yr Angeu. 

ElS Wsio: Bardd Cirag, S2. 

Afon Anghof, the river of oblivion ; Lethe. 
Ov&negai Lteddai araf davel ffrwd. 
Diryc K/on aa^lioj.^ W. 0. PV}hr .- C.G. Ii. 61». 

^r nni/Ao/, in oblivion; forgotten. 

Tri phetb ni ddylynt fod on oHg teohan or atahtf. 

Kid oedd na deddf na defbd amynt yn ddupartblia^ 

adma hyny dyfwyddoa gwiu ac aHghBf ar lawer. 

Oyru anghof ar, to cause to be forgotten ; to 
cause to fiUl into oblivion. 



jgic 



Myned ar angho/, to be totgottea ; to tall into 
obliTion. 

Derfydd oerian poen a c»Ur, 

Er amsfr anghuf, from time immomoriaL 
Anghofl, v.=Anghofio. 

Ac wedi tj erbyn I Yh^I Bdifdrwcfa, mi m ddjigmis fyw 
yn ddaiopuH.ap angh/ijl y<iTjgeid iLdduWJSfBidiDUiiaewn 
uuBoroeild a a«thoedd heibio.— JfirrcAof Cn^drad, ii. 8* 

Gellwng dnwgur [*ebrTfreo, lagliofi] hjn iry tu «fn. 

Nid 



Anghoflant, iannau, aiut, im. oblivion. 

Cw<g, hjTUWB gWtg. 

Owir lAjoAAfUi ukiHJkf pH dycbrTnUA tf| 

Fy mniryU J Fwydaw inewD nRy^^aif t — Cair/'iUtcch. 
Anghoflo, V. to forgot. 

A dnf^jfn gvni^ Ei phleatyn BDgno !.-.!■■, hwy a 
■llant un^tajtu. eta myfl nid ai.^Au|t^i/ di.~£J'i. ilix. IS. 

Nid O^B 1 cbwl oU an^hoHo hjn ; onid «, cliTi aagAofiitcJi 
Oriat ei hun.-/«-, Oic™. SO. 

Anghofraith, reitbiau, >/. an act of oblivion ; 

an amnesty. 
Aaghoflie, a. forgetful, oblivious; apt to forget. 
Hwn, hf^b fod yn wraiid&WT mgho/iis, ood ewueuthiirwr 

y wcithird. efe a fydd dedwydd yneiweithrrf.- /«(/"*- **■ 

eBgtuluBBinaddtl.— ft. ttogd: LlwybV Hyff, 3». 

oJId^-mdrto Vmedd^l^ll, 

Gan ocliel gwaJl luyfto/us.— i/«ui Llfgd a Lancar/an. 
Tra yr oedd y Brnun lorworth yn canljm d orcbvj'lion 
perthyiLul i wlcdydd ereikU >iid or>dd yn np^^^ifj i '* 



forgetfulneas, obliv- 



AiLghoAiad«r, 'i 
AughoAudra, I 
Anghofturwydd, ) 
AnghofEtidwTiaetb., -au, a/, oblivion, 
fulneaa. 



Angbolliant, am. a binng not lost. 

Anghor, em. and a.-^Anghatvr. 

Angbord, -au, sm. discord ; want of Harmony. 

Fob taytiaFd, dlir, ua ddcall dyn ei dj»- 

llib'H rhrth .- awcith. Mi. 

discordance, disugrec- 



Anghordiad, -au 

AughorffkwT, a. incorporeal ; incorporate. 
Anghorffol, a. incorporeal, bodiless. 
Anghorffolaetb, -au, ef. incorporcity ; an on- 
embodied state. 
AughorfEtoliad, -au, am. a rendering incor- 
poreal; dissolution. 
Anqharffoiioji y Myuachlo^ydd yn nhcjmaaiad 7 Bnmin 
Ham yr 3f«l.- H'u/Wri. 



Anghorfforol, a. incorjioreal : bodiless. 

Ef a dhyw&Ur nat ydyw ef yn on Ihe. ouiya ojTiihatairi 
yw lie- AC agfiorphi/nivl jv liuw.—LaeUi'ir, }&{v1.Hi. 

O bieif id aylwbldau anffhorffi/rol ydynt- . . Ae feUy hirynl- 
hwy a g>Tinclir [iniwy*^ j maent yn fudau nttghnrj/nrot] gao 
yr V«|wyd hwn iydd yn bywhau. — lerrmi Oteai, 4fi, 0*>. 

Un yw y byw aV vwir Dditw, Ln^ywjddal, atigkerforoi, 
dlranadwy, na ddicbon ddioMirt.—aiiiyli'^iidd, ill. 10. 

Angbortforoldflb, | incorporality, inoorpo- 

AngliorffoId«b, { reity. 

AngliOTi, V. [L. adhortor] to exhort ; to advisa 

Tma vellir ttapthu eoKhrymbwra pechDd, dan aHffkari 
pavb i ffo rhagdda.-^nrj,. (Vyn^ .' Athr. OlM. 48. 
Augboriad, -au, am. [L. atf Aor<(ifio] exhortation. 

—MiiTt/i U/r/nog .- Athr. Grist. 7, :i8. 
Angbospadwy, n. unpuniBhable. 
An^boapedigaetb, -au, a/, impunity, lack of 
punishment. 

~ nnjjimy-rf^""* [•dlffytrooipedigartb] 

Jlohrrl Uayd: Uwybr Hy*. 839. 

Anghraff, a. not sbarp, keen, acute, or pene- 
trative ; dull. 
Anghraff ei ddeall, dull of apprehension. 

CuOoDoet.aiiiSMtiortfa.wa.—Cs'ddaiB: U.A.LS31. 
O Eiyr a»j*raf /— J«oF»»» Lltcgd .- Tri Ad. SS. 

AngbrafiUer, \ am. want of sharpness, acute- 
Anghraffedd, | ness, or penetration i dull- 
AngbrafBneb, JneHs; dimness. 
Angbrafi^, □. wanting in sharpness, keenness, 

or penetration ; dull. 
Anghraiff, eiffiau, «/. [I..L. anagriph, anagrip, 

anagrippa, an/igrip<i']^Anghrai^ (1). 

riiffu da yny ol. 



yn dwya Udwenwdd i ' 



Bn-1 Ur.aiArll,^riB): M.A. li 
ldi fedd Crist creawdr crrd y sangi 
ra aaffraif angred yn ei ^Ichyn. 



Micf.e 






(■■ C.B. B 



a, no. 



Augbraifft, eifftiau. af. 1, a pattern, exemplar, 
or model ; example ; instance. 

Kan adaw agrhrj/fft girarder y pawb or a dfdliynt jm y ol 
yn[*n.— Brul Or. ai Arthur: M.i. i. IM lol. Sia). 
Et rodhi agerai^ y bawb yn y byt hvnn. na dfayaco ony 
" " 'iTl.- J.i.c«nr, (aS|ef.69,7*,M, 119). 



9,10*). 



be! yr oedran dedhfav 



Oan adael i ni an^hraigt, fal y (tellj-h cbwi ganlyn el 
olioacf.— ^^. Sidntfd Dnvia: 1 I'edr K. 21. 

Wrth hyn y ^velwn bellaeh, na dd>-^-udd yr Apovtolion 
1 Hi ddim mwy ar elriau, niig a dd^nffoaaaant hvy trwy 
anghriu^.—Df/'ieltriid tl Cntlion. 11. ii. ib. 

Giibcithiwn y dilynir yr auoHmyfl glodwiw gan bob (eym- 
aaoedd ereiU.— C'jr''*irr<"m, 1. 368. 

IwJ ay yn awT yn 

Wrtb ■daw'i Alpht an^tmijR oedd.— Groaict Oi«iui, SI. 
Et anghrnifft, tor example {e.g.), for instance; 
as an example or instance. 

lliuellau canlynol o vaitb y 
;: Ban. Cym. lB(c(. 40, TSO). 
2. reproof, rebuke ; reprehen 
"■ " ef toB Flelea, 



budd Cyiaddelw. 






nn3krn(ffl a rhag yr 



— /dIoOm*. 



,)glc 



Angrbrain, a. [an-^-crain] prosttste; prone; 
drooping. 

cn>g. r-oicoch: U-A-i-sse. 
Anghraitli, eithiau, «/. an example. Appa- 
rently a variant of ongkraiff oi aiighraifft. 
Yngborpben pub rMyi-ftWtA owtiflith deu^nyn {ai. HBOgja)' 
Ootijitdaf .- M-A- i. IM, 
T-trt Ayrfa diganwD ol angrhait/i. 

Stia^U BryJfiirrcA : M.A. 1. SS8. 
Uuu drin bnenhin Brynaich niigratt\ i^at uinrAiUlJ. 

Uinheu a ^fwplajtf j^ih p 

rei drwc yo sytrfduurl ar diwed , . . 

Punian Padiig, II, 

Ajigbxarwi, u. [crawn, oroni] not collecting or 
boarding; liberal. 

Gu-r unyhritwn, a person that doea not heap 
or hoard riches; on open-handed or liber^ 
person. Cf. Owalchmai'scxpreBsion: 'Teym- 
ain ni grain ni grawn rei.' — M.A. i. 197. 
His »rd pyrd am nad aiigli»a 



in^hymrn chvi. 71 

aiij-n jifowndcdic yw yn Ujivei 
' '" s. dyuot ogj\.jaa da. d 



Oi/ndt 



Xict.a 









Anghred, -au, if. unbelief; disbelief; incredu- 
lity; infidelity. 

ttiTpwnvydpdredypc?odr7onbynnyff(>lch7 
■wy hoU ynYB I'rydeyn. 
BnUGr.abArlLr.- M.A. ii. IBS |c(. Ml). 
Brail knydam yKTt ynakryt aakrt:t, 

Ce-Mtlw: M.A. I.MS. 
A cbenedloed erdll arqiehrwIaBiuit drBchefyn » en iagra. 
r«. <i/ CarBlo Maipu. col. 381. 
Ac fetly 7 daeth bjtu OHghrrd aia Bduv a daiuni. 

/pfo Mu. 171. 
thraaOi y« . . . vot y bobyl ynn-lt nduiit xaa oryn en 

jlkBghred, a. unbelieving; incredulous; infidel. 



Oalwo ArUjurar Umw uab Teirgwaod, kanys ol elynl i 
wlat am^hr^t. raal y gallci yrru lletnth amadunt ahaL hyt 
noa wwam Dflb wynt. oc wyntwy avelynt pavb. 

Bellacfa y decbi^oir Oablud ac ynUadeu y FfninQ a gwyr 

Nid tTiiedlgjou $'d ni, uac o hil asghrrd ac elUlon, elUu 
IddewoD a meib Iddflwcm. 

Ilaf)dd Fs'.hni: Ermgyl Nioad. 

EI a tynai y harhsriaid maf ui 
Paul . . . a'rrtuiian.;Ar<'<'addi vrtli 



...Tuddlog L 

til gniee Crut, a dybiaoaat 

Icnai, Bruili/dd llir: Preg, i. 19. 
a ^ draioo iii«Arr'J ' yn ddy wediad diftDQ cyffndta. 



If Like most adjectives, it is used substan- 
tively, especially for the plural. 

Tn el amMT ef T Uaddodd yr an?ArriI lawer o'l CriBfoiw- 
km.— /ai,»M. 8(ef. B). 

Via yn,dd yr Ai^lwydd di allan o*(h df i rmladd ya 
Brbyn yr a»ghred, yr ovdd itukti u'r ffyddloniaid yn wrm- 
wjnebua ganddynt ynjadd. . . Aonoger y ffyddloniaid i 
yioladdyik erbrn yTanghred- 

Churla Bdioardt: Baa. y Ffydd, US |c{. 131, ISl, 3U). 

Anghredadwy, a. 1. incredible; that cannot 
be believed or credited. 
Ai anQhrtdadwj/ [Or. af>\9lo}i\ y bemir gfsiyoh chwi, y 

Cyntfdd tra-helactb ydoedd a hyllaerth, a gwg el redfti 
at mtgongl ddogodi aMkrBtadKg o wrthuni acepehyUdod. 



)d Ahobbedadth 

2. unbelieving; disbelieving; infidel. 

Ood yT Iddewoa anghr^dadwy [Or. aprithmtMttt] a gyffrH^ 

ant, ac a lygraaant teddyliau j Ccuedloedd yn erbyn y 

brodyr. — Etg. Mofgaii : Act. zlv. 3. 
% This passage has eserdBed edit«rs more 
than an^ other in the Welsh Scriptures. The 
first to introduce ajighredadwy (with the mar- 
ginal reading — ' a'r ni chredynt ') was "W, 
SaleBbury (1567), who was foUowed by Bp. 
Morgan (1688); but in the revision of Bp. 
Parry- (1620) it was changed into angkrtdadyn 
(q.v.); and so it remained until 1799, when 
anghredadtoy was restored. In 1814 Thomas 
Charles converted anghredadyn into angkred- 
adin, which appeared in no other issue. In 
the Oxford N.T, of 1828. Tegid introduced 
anghrediniol ; but this decided improvement 
has unfortunately been discarded in all subse- 
quent edjtiona, most of which adhere to 
anghredadyn. The objection to anghredaduiy 
in this place is, that it is ambiguous, making no 
distinction between irmAovrrii and Sarurritif 
and not that it is incorrect, as is often as- 
sumed ; for this was the more usual meaning 
in the time of Balesbury and Morgan, and at 
a considerably later period. At Dorik. x. 7 
both Morgan and Parry have angkrerladwy, 
and all the editions of the 17th and 13th 
centuries retain it ; but in some later ones it 
has been altered into anghredadyn, in con- 
formity with the passage in the Acts. As to 
the form, cf, teimladwi/ (^feeling and tangi- 
ble), rkuadwy, afradwy. 
Agkndadiajf oedd ynteu. o aohoa iddair wneuthur gor- 

cbymmynheu y kythnul.— /p0ji«, | fl. 
Ond yr ofoog- ac aaghrtdidwjf, a'r widdyiiuni, a'r Uiaswyr 

, . . eu rban bwynt y bydd yn V pwU y sydd yn el Icw^ o 

din a brwmstan.— r'l. ATvcl.- Dad. ni. s. 
Here Morgan has ' ajigkredyniatd' (^langhred- 
iniaid), which Parry, followed by subsequent 
editors, changed into ' digred.' 

Ffydda 

mewn rhj 
gyfododd 

Hil ac eptl atgkfniadiirg Fbaraoh a ^blaaant ac a ddi- 
ofrydaaant jryfraith Dduw, 

CIHrfc.£Hionn(..- Han. y Ffydd, 110-11 [of. IIB). 

Ni a nelwn fod rluii o'r renedloedd aighredadurg yn cyn- 
nwyi Uedrad.— £1. Samurl; Omtiua, ii. IB. 



6(»0B1. 



bonno. . . Canys d«olwyd Banotelddnrydd oddi jaa ^ran 
y lladiDn hyny, y Twrciaid brynCiun anyhirAtdwv- 

W. LsvKi: Dwy Daith, 27 |c(.711. 
Yt rmghrrdadufj/ ui ohredant byn pan Bi darllcnont. 

Oatand fr AmHglhuielalig {1761), 2, 

Anghradadyn (pi. anghredinwyr, anghredin- 
iaid), im. an unbeliever ; an infidel. 
Na f ydd aitghredadgn, ond oredadyn. — rmn n. 27. 
Ped ifofynai rhyw anghmliulai iddyat bwy po bam y 
(nelient uneuEbnT o Fo8» ryfeddadaii, ni ledrent luddl un 

Keu pa Tan eydd i grodadyn ^yd ag tJiffKrrdadr/n T 
Ac agatuyd pabyl angrreiiiiinn ynt. 



,,gle ■ 



AnonRBnADVNIAETn 



dim itffltnittttnit. iwu ii>fkyfun jr wixion^. ok liwix jr ^ 






An^hMdadyniaeth, «/. unUlicfi initdelitj; 

incredulity. 
Ang'hrededTii, ) a. unbelicviug; disbelieving: 
Aufhivdedu, ) infidul. 

GwtLnmdeiret jt 1h>1I buby] n-fkr^drJi^. 

Oh ni a'a duigoHwn «in bonam ruf pt ttitghrftriiifn i'r 
addevidioa bra ; luc yn Dfaotf 1 traoA j'r Triidr«ch a trsn- 
Bfgit itd—Vr. J-kt />.;■•'>: Ll)* y R«. II. U. M. 

Aiighred«d]m, an.^Anghredaili/n. 

Pel y ni«e"r (T-jftrnJ-Jj", h phawb o'r rhsi cyndjn dJj;iilyr. 

Anglirededd, im. unbelief; diabcliaf. 
Ajighredgar, □, disinclined or iudispused to 
believe; unbelieving. 

Kid u» und bmua. pneth ei wtn. 

/cA. JtforjFa.icj; B»lm»n, I. XXXIl. a. 

Auglmdiiu&eUi, -au, »/. unbelief, disbelief; 

incredulity. 

Ni cbif fl o eniiyd ynu finwi yr imrbsllh ■ wiuetb 
chvaot da byd, ac fntffKrfdinittA i addawoidion Duv, ai 
bob rhfw ddyn yog N^lLyroni. 

&,. SichanI Duiirt: Epialol. 

Trwy a>ijA/-«Ji»«i«* y lorwyd hwynt fniuUi. 

Mr./, m. 40. 

Ppry tiii^'fHHinfih uirb«ymol i ddyn iradw ^ ddolur 
ootffoiol.— ('A. Sdttur,!..- 1L«I. y Ffydil, MO. 

Tuddu y maent oddi wrtli amnibin^eithrwydd ein had- 
€iicdi|rik«th. Bc oddi vrtJi yr ymdreob a'r ymrywa ardd 
Thvug ffydd ac nu^^r^/irji^/Ayui mrddyliau yr etbuledig- 
ion.— flofttrttlioyJ: IJwybr HySordd, 171. 

T mae Duw ye hir amMr yn cyfrif i hwynt, o ble^ 
eu Aai^Andihiaf U a^u bonedimrwcb. 



Aughrediniaid, t.jJ. unbclieTere. 



»(cf.6l 



Angbrediniol, 
incredulous. 



idduirnliaeth y^'^fc 
fan, y ifyM, 110. 
. unbelieving ; diabclieving ; 



Yroodd^mdidra«olyn|cryfacbnagavdurdod'i''tfAr«l- 
i„M.~lli. RIkiM': Dan. y Ffydd. 13. 

Anghrediniwr, wyr, »m, an unlxilicvcr ; a dis- 
believer, 

Uymuiui iM^A'TJimi-yf velfd parbBd o'r git'yrthiau cry- 
bwylledig. -;«>. i/arriM; (Jweitb. WB. 

Anghredu, i: to diHbcliuye ; not to believe. 
HygeUynt gallea itugirti/u.—SliJir »iu: M.A. i, 360. 
Ac with byny ftwplic yn dLwii y «ellir wdwfdigaath 
bywyd aragrrto idilair, - •-•-■'■ ' .--,:. .-... 



1^ pheth ni faddfu Duv i ddyn : ei oganu ^ m 
B'i anabeithia.— -Vfu, Arri. Hi. 183, 
An^hradwr, wyr, } em. a disbeliever 
Anghredydd, -ion, j believer. 



Akobbibt 

Allgbr6«dig, a. unaroatad. 
Anghrfiedigaetlk, | -au, $/. the state of b«ng 
Aughreadigaeth, ) uncreated. 
Angliref^dd, -au, if. irreUgion; impiety. 

Agkr't^'t ywyd yHyuA«(b- — fgndJdM^: U.A. i- SOO. 
Mae pechaduriaid yn gwiiEuUiiu-eusonoertaeiiiidryg- 
iooi ao'in^&rc/^^ar wynebyrbollddaLiir. 

In^i Brtdgid Hir; Preg. i. MS. 
Awcb anunhwyll fr^wtrnlcbymniydd, yo wir 
/Joii^rg<i«us: Sail 

Anghrefyddol, )a. irreligious; impious; not 
Anghrefyddna, ) profotuiiug relipon. 

Myfl a fl^m f;rw inewn pecbod ac amrrbodaeUi boll 
ddyddiaa fy pijiioes. yn UV^ amffhrrfvd'lol. nc heb wir 
wybodaMboDduw.— ft. Llv^; Llwytii Hyffordd. 4S0. 

AiigliF«f^ddold«b, ] «m. irrdigiousness ; 

Anghrefyddolder, / want of religion or 

Asghrefyddolrwydd, t piet^: inipiousnesa, 

Anghra^dduarwydd, ) unpiety. 

A'r nnghr'/^'tJa/'/'f' cyffrrdiiial a wnal'r yohydig o rai 
duviol ymamio at ddaioni yp lewadi. 

Ck. SJK»r<b. Hann y Ffydd, SSI. 

Anghref^ddwT, wyr, (in. an irreligious man; 

one who does not profess religion. 
Angbrefihi, »m. want of sharpness, keenness, 

or acumen ; dimness ; dullness. 
Anghreifflo, tf. to rebuke or cenaure. 

A naw kytbrenl y8(fithrH.wg a cbynm tAOllyd anuuit yn 
y harbcilaw. ag yny affkrrif^aw. — Breutidat/d Powi^ ta. 
A ffw«dy dyvyunu attair y boll wyrda : m k^ffrrifaiD 

Ac yna y aomv y bTvnhin y apkre^fflo ebon yn y TOddwl 
am gyituddiaw y marchawc.— DofiAimi Bfti,/oin, )S4, 
Allghl«ifltiO, V. to reprove ; to rebuke ; to 
ceiuurc. 
AngAreifftio gioyd, to reprove vice or wicked- 
ness.— ra(t>«n.- M.A. I. 9S. 
Ai rei prudat onsdunt a igr-iffl^iaiiM Tandl. 

Camp>-« CtaTlgmafn,t»l (cf. 101, lOS). 
fTwsdy nfrriffi^tn J gytymsilb. dyoedut mtb leaan. 



Argluyd wffa vi pann 



ddyehyth 



il^'tfiipyii B/lyiUIrrc 



JVlori Dind, ) 67. 



adnabn Bwtor hyny, angkrtijftiav oi wni^ a otng. 

Anghreiffliol, a, exemplary. 

Crogir Uoriudd . . . i ddlogela moddiaimaD a byvrdan y 
rffitrdla, Ijwy amlyiru <id^ajvirydd at y fath yrnddy^^iad. 



oyff ndla, Ijwy aiiilyiru <idtfa^irydd at 
a thoddi rbybndd anghfifftiol 1 ar«ill. 



Angbreifftioldeb, em. exemplariness. 
AnghreifRiwT, wyr, wn. a reprover. 
Anghreithio, v. <o reprove; to rebuke; to 



iliTyriyellyhebyi 



jTbairc mini 



Kanya lagrHAffn^' 
af dywedaf iW.— SI. i.™h,id. 

Ac yna y dywat Q«inas un or lladroim a dudyant y gyt 
ac cT at y ^roc. Oa tidi Ortst hpp cf rydhaa ni a tbi. ar 
KHnaua ae haarrilhaiid yntpu ac a dymt. nyt Doa aroHt U 
oryn dnw a tti yngliyuyrgoU.--ii^p- (lurym R/tytdrtch. 

A pbaim oed yr e«Db yn cmgrpUfrnwy marchairc bmuiT 
am y bochudeu. mc yn dyvcdat oodi Duir obonav yn or- 
tbnnn. yntcu a dodca ocnaieit o unlwc ediuarwah. 

A.n(iin PaJnf, ) 7. 

i« af ar byneif ac ar 

_, _,.„ »y yno DC mofry r" *-' " 

anuarwawl.— J'rfrivai*, 1*6. 
Anghriat, -iau, em. 1. antichrist. 

Ao m«ryH y dywaocb y daw nn^ Arirf, yr awr boo bef yd 



Cany i*ynnei> ac wyDl« 
in^ y kyuyi^fdluHant vr 



iR^lii 



,.v^i(,K)t;ie 



Ill 



ASOURYNO 



Dywsdyd 77 ydvm . . . ddnifod iddo rmadael S'r ffvdd, 
•cmaiefoywrtuigfliienorwlaBsJrit.— «. Cgffln: DiS.ii.S. 

fuddeu hwiiB o Rufain, s delir-oddoliant ar-shrui, u an- 
nnwiaotb.— /iottn I,lK/,d.- Llwjrbi Hyff ordd, 484. 

On odrychwn ar j-byd Criit'nogul duo lywodnwOi J n^fri.i, 
^ fava nydd yn fnvi ti hon yn OriatiiHif Of^, gjrnnlfo' 
o sueldiau gydil 7110 mewn tartiiwed erpJirll 1 

2. an autichristtaa ; one that is not a Christian ; 
an unbeliever. 

Ar peOKU gwrthoAedic oil a ^dyanara laf rudl ohonam 
nl JT aacril icwenyd dnry W70 arOiiit.— BM*iaW Jfair. 1 1 . 

Anghriatlaeth, -au, >/. antichriatiBiiiBm, anti- 
ohristi&nitTt 

Kid o«dd aifau ^aawyr cyDtal Criationogs«tJi ^nardol 
ond n«rtbol ttwy Ddaw . . , i dj-nu cntyll i'r Uavr, ac i 
ddivreiddJD eOunaddLdiasth ac anyhrieiuirUi, 

loarpli Ifarria: GweMl. 80. 
Uoid a^hrittiatA ffnim hvddinant drav. 

IT. Ji™«,- Adjyfodiad, 107. 

Anghristian, ^. anghristJanogion=.^n^An«t- 

Anghristianua, a. unchmtian ; non-Christian. 

An^hiiation, pi. anghriationc^OD, tm. one that 
is not a Christian ; a non-(Siri3tian ; an un- 
christian man. 

rbedi 

aeth, L 

— W. a. Gf^ndv 
Tair cynaeddf aitgh rUtio 
wiredd.— farddni, I. 290. 
Yei wylo aaffrddJoiuon ag arOcrittpiogion. 

ISIhStiS; ! "■ »»°''rf«i" : mchmtiaiJr. 

Bedded imi w^dry^icm, 

A phob fnaid anghrisum, 

B^d olaitb yri «l7iuoii. — J^^. Arth. iii. M- 

Tuy berwid biad Brrtlion aiJnilsiCKn 

Ciutin ae melbjDD. — Jf^. Areh. i. 418. 

iiihli.lyiOgUth, ,) ohraOaininn. 
Maor drj'geu biTdeu braudotTajrllj 
OaskretoftTubma^uU,— CVnildclw.' U.A. i. IBO, 

Anghristiono^aidd, > a. uncluistianly, un- 
A nghrigtiano gai dd , / christiajililco, imchris- 
AnghriBtTHOgaidd, ) tian. 

Yd y drj-gionua a*r anffhrisliafi/tffiruM 7 DUUF rflTW bethau 
da.— ftotn-i l.ltri/d: Uwybr Hyflonia, 25. 

1 huT i dreulia'r sabboth 1 
mofer ■■ ■ ■ 



1: baJchder; tfeuloEbdeb» a( 



HevD om«dd at 






r,- c. 7 c. ix 






Anghriationogol , 
Anghfistianogol , 
AnghriatTiiogol, ; '~ '" 

O myn at goe\io OTegorioi ei gydTinaltli ei hun, cTin- 
meryd anui 7 mae et beaw baliA annmriol, eglirT"lowii, 
aii(r»rt»lw>ioffa«i(.— Jfflma c^fin : Diff. ii. 8. 

Na thyblwch 7 b7ddal mor gmdawn anirbriif no^ol a'l 
duidir yn hir, thag euh nyiihu o hiraea. 

Bliai c boDTTit (fe aUai) 7T1 perchm eneidiau cyfo«lJj- 
ocadt o rioireadan na'n mamachwyr any^rijtiiinogol. 

Anghrlationogrwydd, 1 sm. unchristian- 

Anghriationogolrwydd, - | nesa, antichris- 
Anghristionogeiddrwydd, ) tiauity, anti- 

christianiam. ^ W. 
Anghroeaav, -on, im. lack of welcome; in- 

hoapitaUtj. 



Ang^htoetairgar, a. 1 . not given to hospitality ; 

i^ioapi table. 
2. unwelcome; not grateful, 

Yr hvD a dduj^ (j llafur e^rwan I ief^u dan eth)^ adflv- 
ydd eidh mawrhydi ; a Ujrwy muJ j fatb groeeaw, ni till 

RiHi^land VaHghna : Ym. I>uwioldeb, Uylli. Goreh, 

AnghroeBawiad, -au, em. a, treating without 
welcome. 

Anghroesawu, i'. not to welcome ; to treat in- 
hospitably ; to cease to bo hospitable. 

Aughroesavua, n, unwelcome ; inhospitable. 
Derbynind an^hrofaaivvs, au unwelcome re- 

Aughroew, a. not clear; not distinct; inar- 
ticulate ; not fresh, 
Llefariad anghT{>eU', inarticulate or indistinct 
speaking ; poor delivery. 

Anghroewder, rm. lack of clearness or distinct- 
ness : inarticulatenosa, inarticulation ; want 
of frcabnesa. 

Anghrwm, m. I a. without a bend or curve ; 

Anghrom, /. ] not concave ; not stooping or 
bending; flattiah. 

Has ri ryTiBnn fn hirgTon. o ddeutu nn modtedd ai 
ddeg 4 hyd, yn Ucd aughrvw ar ei hwyueb uchaf . 

Anghrwn, ra. 1 a. not round or circular; un- 
Anghron, /, j circular ; flat. 
Anghrybwylledig, a. unmentioned, not named. 
AnghiTf, m. 
Anghref, /. 



! a. not strong ; weak, feeble. 



Hywd YstoryH : M.A, i. M9- 

Angbiyg, a. not hoarse; articulate; clear. 
Erchv7niaw^ Oylev Crylwyn uch pram 
Tlyllweioiigyro«srjsry8Kaui.— CuviUflw,' M.A. i. 9M. 
Anghrymder, ) am. the quaUtj of not being 
Aughiymedd, j convex; a being unbent. 
Anghrymu, v. to unbend, 

Anghr^nder I {y), am. a being not round or 
Anghrynedd ( spherical, 

Angluynedig, d. [cr^n] not shaken or agitated; 
tindaunted, intrepid. 

Cany" kyn bei bjchan y oct cisao™ yd ood B«iitaw weith- 
ret m^irthawi: ac yn nng'^ntdif. dyvysaavo yn onnoc 7 wyr 
y Tmladt ac yn hyrr^u [hi7. trychuj e bun 7 dl'Dyan yn 
arueu,— ^rut j/ Tpw^toffim, 168. 
Anghryno, a. 1. uncompact; loose; diffiise; 
disordered; untidy, slovenly; not neat; waste. 
Llawcr o bethaa erdU ... a adavaaom heb 7d7W«dnt nc 
bamnn 7 ll7tbyT bwn yn nngkrvno. 

Riichtdd Snm .- C.B. aainta, 20. 
„ - - tyniadyiig 
yn pedym y naiU 

A rhylaca a rby anffhrt/no a tbnwl y bydd er Uonio pen- 
oill yn (olangwbl emi.— Cj/rfMc* v IWnW, BO Ist^iji, 
2. not hoarding or accumulating ; Uberal. 

Cloduoiaf (ynafnnwaa^^Fio.— /.(jf^ndOior; M.A-i.StS. 
Oralch gvylwaloh gotut anahrrnp. 

f%(i> Dr^dydJ: M.A. i. »7S. 

Cf. digryno, which is used in a similar sense : 
&WT TW »'i am fiJ y gta.—L. G. Caiki, iv. xii. U. 



,>glc 



ANOHBTSOAn 1 

AngtaiyBOUi, »f. a slattern.— P. 
Aughrynoawl, a. tending to be uncompoct, 

untidj, or diffuse. 
An^hiyuodeb, am, unoompactaoss; imtidiDeBg; 

diffuscdiieM ; negligence ; disorder. 



choflvt p- hoU wlBt ar a^tr^Hodeb heb diryn dim ffrwyth. 
Angbrynten, */. a slattern, an untidy iromou. 

- ir. 

Angbu. a. [cu] not dear, lovelir. or affectionate ; 
unamiable. 

Anj/Ait antad ujtghatSl. — li', Midlrbm: aiJni.lEd- 7. 

Anghuaidd, a. not lovely or amiable i uiJovelj, 

unamiable. 
Anghudd, CI. not hidden or concealed ; un- 

concoftlod ; unobscured. 

Dadmnliud anifhitd uueid OwAJn. 

OmbAiut. H.A. i. SCO. 
Elryf dnbint anshm mas?rt Dinbrni. 

Snian ab Omilckmai : M.A. 1, 380. 
.l»yiUvrtortwyhyiiDd.— (ViAW".' M.A. L SM, 
Get on^TT oet vo^ eu bar 
Get angut ^mednit vwttedrTU'. 

LliTKarS, ab UffWlyn ,• M.A. I. 198 (cT, »3). 

Anghudd, -ion, «m. that which is not con- 
cealed or hidden. 

Trt phrif hh^AihU dfn, u wrthrnt &'i Mdw»eair: trem 
el olv^ ; a ch amad ei luar : «'r modd Tdd Tmchvrf . 

Jfji. .In-i. Hi. Sll. 

Tri nu^ltiiiM pob llnrwyn : ei Hu ; ei floleuetb i a'i 
tAAoa.—Myv. ArcK.ai. S60. 

Anghaddiedig, a. unhidden, unconcealed. 
Anghuddiog, u. uncuncc-aled, unhidden. 

Dy lutt wyf dy unt ja angliuisi«:r: 

Uj ueirt ynt beirtfod vt Mon mynairo- 

/.ij,u-«rcA ot Uyvlgn: M.A. 1. 8IM. 

Anghuddiol, a. not concealing or hiding. 
Aughnedd, am. unloveliness. 
Anghueiddio, v. to render unlovely. 
Aughueiddiol, a. tending to be unamiable. 
Anghueiddrwjrdd, sm. unloveliness, unantia- 

Mity. 
AnKhuriol,((. [cur.curio: butprobably^ian^ur- 

1*0^ or atufiriawl in the following extract] not 

pining or vexing. 

HeD widdoD dditloD pui lidiTTv 

Jiijl4*™rv.i ei h»wl pBnhwyliwjB.— roJiMiB.- M.A. 1. 1§. 
Anghwaneg, n. [chwoneg] more; additional. 
mmnt ekMohamiioB h^t em Paris. 



deliemjlifi dydh' 






A tbnmnoc^ . . - yhymcrthydairiiaayvaewaeeledyf. 

Anghwaneg, -ion, »m, more; a greater quan- 
tity, amount, or number ; ' 



cl Unff«r/ad ISSS. 
DyTD i Di mghamteii ffydd, gobsiUi, s sbuiBd perffmith. 
tl. 0. OvJfndi" fHyJd Snl wedi'i Drindod). 
Augfawauegiad, -au, am. addition; augmenta- 
tion ; a supplement. 
Anghwanegol, a. additional ; augmentative ; 

Anghwanegn, i'. to add to; to add; to aug- 

Ac raa bU?n pob pQtli ^wr a Tyimey agkteantgv ky- 
hocdawD vedyuit kooA Buveyn. 

hnt Gr. ah AraHr: M.A. if. 308 (rf. SS8, 488). 



Akqhtdbwyll 



Tterfyig . . . ^uifyned aaelb. acain^ftvaarffod-L 
Am hyny y dyved y Dr. Daf e« am y pnrLwyl hwn, iddo 



H Sometimeserroneously written QncJmiinfija; 



a. incomplete; imperfect; deficient. 






Lrfftrt Wallifv^, IP. Ixxiii. 3. 
AnglaMpo\iBsta.~lHanh.f}i.^.iii. 147). 
Uac'r hoU mUlmilrKdd da a aUom nl ph ginumthnT yn 
dnfAufrf acyn azighyflawn. — Ed. Jamar: Ham- i. VS- 

Aogliwbladd, em. incompleteness. 
Angbwblhftd, am. incompletion ; a ceasing to 

complete. 
Ajigbwblbaol, a. not completing; deficient. 
Augbwblbau, tl. not to complete ; to make or 

render incomplete. 
Aughweitbacb, adv. [chwaith] much less. 
Angbwrtais, a. [cwrtois^E. couHntua] un- 

courteous, discourteous. — Madog Dieygraig: 

U:.A. i. 488. 

Angkierinit wyd o oheiAi, 
HyDAmflaifeMdUrfl. 

B. a( Oni/y™, c!U. *3 |pf. liv. SB). 

Angbwtaa, v. not to shorten. 

Angbybydd, a. not covetous, miserly, or sordid. 
Y dyn cybydd ay bob amafT yn dlavd ; y dyu angtvbjfdd 
ay bob uuaer yn <Mudaw^ : y dyn cybydd aj'dd elyn iddo si 
bon; y dyn itngAy/ii/dd ay gyiuiorthwywr j «™i: y dyn 

yn Dawn o ddiddanvch a llawenydd. 

H.«ri Pnri: Egl. Ffr. xiri. 8. 
Anghybyddlyd, a. uncovotous, not miserly. 
AngbycbwlawT, a. disproportional ; unequal. 
Deu edryd y ayd a iiyabwyTftiir 
Dcu arbyna^kBU(U»j%i:flumii«..— CjajW^/w.' M.A. LSiT. 

Angbychwyniad, -au, tm. immobility. — P. 
Angbycbwynol, a. that does not begin to 
move; not moving or starting; unmoving; 

Da anghyckwynol, immovable goods or property. 
Mryfodedyn ; eef yw hynny 



Anghydbartbu, v. to dispro^iortionatc. 
Anghydbwyll, am. difference 
signiiication ; disagreement. 
Ac fal hyn y daeth attgfiydbvslt i 



jM.v^.(,K)t;ie 



Abohtdbwts 1 1 

Anghydbwya, a. unequal in -weight or gisTity; 

nneqaal as to quantity ; oneven. 
WRb tjArjiAn terM . . . rAtjAieA j budd na ntiiD'n 
Kin>lfidig J lyjfrfw fuiau tie a iba% it aimiwbrKi *^ Jtnn*- 

Ck/tmuM Jr BtirM, ST (ef. Sfl, 7*1. 

Angliyd&itit, a. unequal in dse or maigiutudo \ 
uoequal as to amount. 

T crfrrv u a fwrhi i frwfthuuil mmAQ crfaiinj on^Atftt- 
/anl.—El/tmau RtiifyMiaHh, 78. 

An^hydfam, a. not of the stuue opinion. 
Angh.yd£am, -an, «/. differanoe of opdnion ; dis- 
agreement in opinion or judgment; a think- 
ing diffsrently. 
Omdmnr 7 nrbl o huth devia a Twrthod, a chrdtun u 
iF«y*l»^iini, i bwyll a tnni ac sUuruUi a ddulkna hm. 

Ciifrvmclt g BfirM, 14B. 

Aa%hj6S%i6xBAwj, a. incommensniable ; im- 
measurable. 
Angliydfeidrol, a. inoommeusuiate. 
Anghydfesui, -au, am. unequal meoBure; die- 
proportion. 
Omuj Ajoaji, ddoeth a chnmLl, beri'r tatit 
Aitfk^/auTau^ urea ft pjrhael taw 
Fau lu o deoBnCh oyrff, a mivT eu majnt, 

/, B. F/raid: OoU Gwynfa, TiU. 30, 

Ang'hydfevnradwjr, a. incommensurable. 
AjigbyAtamaroX, a. inoommonsurate.— IT. 
Angbydfod, -au, tat. disagreement ; contention ; 
itrifo; division; inconsiatenoe ; debate. 
Ocd Criit lOee, drgwjdda mght^/od TDg Hnrnedd. 

Brut AberptTgam: M.A, 11. 617. 
T^MMtli J Q'dd gTthniDl; ax^hnd/Kid ; a^trjii; ac 
uwjtodaetL— fiarcUoj, 1, saS. 
Wathiaa r inaB aniTnt gjinmodl an;lk^/ailaii. 
Tiigii^iadtaaTTan;A]r<r<>d.--I?.ir>i:Aalii.' airalth,l.TO. 
Anghydfbd, a. contentious; froward. 
Udi huTBfwr pwr yn gornod u bawb 
Or Ddblciet n^Jhirifiwd. 

Urw. at Uinctlyi: U.A. 1. SM. 

An^hydfod, v. to disagree ; to be inconsistent 
mpatiblt 

- Dn' 

pob moddiaii ,. , , ., ._ 

BdK. Auud : GlotiDB, 1. IV, 

Anghydfodog, a. not existing or dwelling to- 
gether ; not co-«xiHting. 
Tri unfhjfd/edMion doetiiijieb : balchder A gwynfyd ; 
Bk>dde*t ag iecfard ; ac yimalhiirch 1 llawaaidd rallineb. 
Jffv. AmA. ill. ai3 jet. ai4). 
Anghydfbdol, a. disagreeing ; incongruous. 
Angbydfodoldeb, Mn. oontentiouBnesg; incon- 
gruity. 
Angliydfyddiaeth, -au, >/, Tarian<!p ; dis- 
agreement; diasention; commotion. 
OtniTTwyf — tbagbod . . . anght^/j/iUiati^ii. 



AHOHTDLnrOL 



Anghydfinirflaatb, -au, ^. nonoonfonnity. 



in Aji^hjdSuitwji . 



A ydynt 7 

1 A-a'itdi 



,g>il/dffur/i 

not to conform ; to dissent. 



Anghydfhirflo, 

Mjnodd WDtrd ymcbvitiad manvL pvy D«dl1 yn angSjid- 
ffurllo, a cbaTodd ati yog If^hFmm beL gvmmerrd vylw 0^ 
ddeddf.—-! JolyjirAi, 1. 4 IS. 
Aughydffiirflol, a. nonconforming; not con- 
formable ; inconsistent. 

NodwaddaQ priodol j meddwr ydynt aufoflsoldflb, UHm- 
««tTvydd, aflanweithdra, arK«7mD]deb. a bacb«dd anffhffd- 
fiir/ot k chyfraith ei wlaA.—OuitlUdgdi, i. ITT. 

AnghydfhirflwT, wjr, ) tm. a nonoonform- 
AnghydftVirfy'dd, -ion, j ist. 
Vr Anghydffur/wyr, the Nonconformiste. 

Ac yn nyddiau diveddal y wdyni cyntaf , yi yrnddangOB- 
odd tyrfa yr Aagii/dJiiT/ayr ar y maoa. Oilwid bwy cjn 
byn [16S2J ynBuntaiuaid; ond mewn cyaayUtiad l^r am- 
gylchjad ytna, galvyd hwy yn Anthj^dSurfwrr. 

AdoluBJt^t i. 414. 

Anghydgaia, a, 1. not seeking the same end, 
purpose, or object ; not having the same Eum ; 
acting separately or in opposition ; opposing. 

TrabochynymwabanUipabnnard ben^ bnnaD,yaaiU 
yn anghyth/ais fL'r Hall, ha-wdd 1 bob On a cbwannych, «icli 
gorfod.— ^gl« Jtf». IH-e. 

2. unrivalled ; without rivalry or competition. 
Uyn 

Anf liydgar, a. not unanimous ; discordant. 

Anghj^d^arwcli, *>n. want of unity; lack of 
unanimity. 

Anghydgerdd, -au, »f. want of harmony ; dis- 
cordance; discord. 

Angbydgerdd, a. inharmonious ; discordant ; 
dissonant. 

Angbydgerddol, a. inconsonant. 

Anghydgof, a. not agreeing as a memorial or 
record ; recording inconsistently or diserc- 



Anghydfyddui 



. disagreeing, dissensious. 



Uae'r cymuddfan ibaJ'n heb allu cydfbd Vt byq ey'n y 
f^rrthwyiieb Iddynt, trwy ^yfiwJtb duuveidrwydd, a nad 
ydynt yn anghgd/yitdwi Irwj ddeddf graa. 

Oxiafeid Mtbyd a ItuoKltd IITW), US. 

AngltydfhtTflad, -au, «m. the act of not oon- 
forming ; a ceasing or declining to conform ; 
nonconformity. 

O harwydd el tRg^ydfurfiad k ohtBtydd sefydledig ei 









■rUyfrau 



anwennag 
tnghj/dgof.^Barddm, 1. 163. 

Angbydgord, -au, im. discord, dissonance. 
Trwst arfau ar arfovafith dyrf ai graa 
Aaghjfdgord eBii.—I. D. Ffiaid: CoU Qwynfa. vi. SIS. 

Anghydgordiad, -au, tn. dissonance, disoord- 
Anghydgordio, u. to b 



Angbydlaia, a. inconsonant, discordant. 

Can*a M av byddai offeryn Aerdd, pe bal bywjd yndda 
, . . yn ffieiddio augbyHBondeb ac nnghi/dlais Tel peUi an^ 
natural idJu.— /«. Toimii: Buch. Ontt. 181. 

Anghydleiaiad, -au, tin. disagreement of sound; 



«»d.— . 

Ef e a ddioddetodd U 



oblegldei 



D. Cnr. SS7. 



Angbydlyniad, -au, am. want of cohesion or 

adherence ; discontinuity. 
I Angbydlynol {y). a. not adhesive; incoherent. 



AKaHTDNABOD 1 

Anghydnabod, i', not to acknowlcdf^, recog- 
nise, or own ; to ignore. 

6orf,- *c an!jhftiiin*wl,— .tf.v!'. HrrAr lii. ISfi, 

Angh^dnabod, am. non -acquaintance, unoc- 
quaintance ; want of recognition. 
Hir a h?n jfir'r nryn . , . fod j (JTririmwdd yn crwydro 
fd HtJVD yo J byd hwn. ac ym umlirh ei nng^'idn^l"^. 

)l„,..nr.^«: Diff. i. 1, 

Anghydnabyddiad, -an, sm. want of acquain- 

tante ; a coasinft to recognise or acknowledge. 

Anghydnabyddiaetb, -au, »f. unacqiiaintance; 

want of knowledge. 
Anghydnabyddiu, ) a. unacquainted ; unre- 
AngliTdiiabj^dol, | cognising; unknown. 
Anghi/dnalniddiu 3, not acquainted with; un- 
known to. 
Y gw$t hyn. morys lincimi piw. ydynt yn cwnuJ yn «i 
had*™ hwy, eiri»u dWlhr iii.ift,«dii.i*»,M..j, heb wybod- 
utb. faeb jntyruKtb, heb ddyw, hfh ddawn. 

Mora, ejus: DW. T. 11. 
Tr hyn a i;yffn3dd y RhnMnbild ... I omqyn yr ynya 
bon, ydocdd aitfhj^iahuddut iddynt hyd hyny. 

Ciarl'a Elifardi.- Has. y Pfydd, 169. 
Constaiu ■ . . oedd ai:sliiiliiil-v,IJnr ta nrferinD y llyi. 

r*"!. Emm: D.P.O. i. < (Ml. 

Angbydnabyddunwydd, gm. unacquainted- 



Au^bydoddef, a. intolerant: rigid. 
Ang'hydoddef, am. intolerance. 
Anghydoddefedd, $m. intoloranco. 
Anghydoddefgar, a. intolorant. 
Aughydoddefgarwcli, im. intolerance, want 

of toleMtion.— IT. 
Anghydol, 1 a. incontiguouB ; not adjoining; 
Angbydiol { non-universal. 
Angbydoldeb, ) im. non-univcrsalitf ; uon- 
Aughydioldeb, | contagoity. 

Tri fuuFhadam lliawi : iinghf< 
Dpwidialdcb: sef aat/hvi-'tiU/i, < 

~B«'rd<iiu. i. aoo (d! IW). 
Angbydoligion, t.pr. non- Catholics. 

J-fhti'liiligin^ . . , [AcaUioliFil.enwcyffrcdlnu'ymiliii 
pberthjiuat i aynunuudfb Eglwys RhiifHin. 

iiwi,M«-.i.,J.<r r«,«rrig, 1. 11«. 

Angbydradd, n. unequal ; not equal in degree 

Angbydran, -an, </. disproportion; want of 
participation. 

Angbydranol, n. disproportionate. 

Angbydranu (d). a. to diapmportion ; to divide 
uu equally, 

Anghydred, a. uot running together or in the 
tuinie direction ; unconcurring. 
Anghi/drfd Hi/ a stvi/iit, a tide nnder the loe, 

Angbydrif, a. aliquant. 

Anghydryw, a. heterogeneous ; of a different 
kuid or nature. 

Angbydaaf, a. not standing together; incon- 
sistent; incomj>atiblc 

Angbyda&fedd, im. disugreenicut ; 



4 AnouydWeled 

Augbydaail, a. not alike as to foundation ; 

incompatible. 
Angbydaain, ii. dissonant ; not of tho auue 

sound ; diauordant ; barah. 
Ni tfaorir y disUwrwydd marWHldd, ami ttna ttTyg ^rvrh- 

hyiukdawiad 1 Uilnloedil y dpItoD. 

l.-u-ilH-r MrJimu : GwiiIUi, ii. 3G3. 

Angbydaain, soiniau, af. 1. disagreenient ; dia- 

Oud gyr ym nUiell ouyt^lMrB diloei BMnchiii. 

/. II. r/rai,!.- <:uU Gwjn/u, vii. 41. 

'2. {/'/. anghydHitiniaid] a discord in sound, dis- 
sonance ; discord. 
Cyihriiiiiiid <ir Hughjiilariuiuid, chords and dis- 
cords (in music). 

Y lOMt: int'ihy/d^'luinui nid yn uijiif yn add«fu], ODd hefyd 
yo itDghenilLVJdioL nu^wu caildohoeth. 

J. ililU: Onm. CrMd. 1S4. 

Angbydseimad, -au, tm. a disagreeing in 

sound ; discordance. 
Asghydseinio, ''. to produce discordant or 

inharmonious sounds : to sound diversely ; to 

become or to render discordant. 
Angbydseiniol, a. dissonant, discordant. 

Miwyii In)- »tr«)inol, 8 ctyffrfdin yn fiiryn«^*yrfmNiij/, 

Angbydayniad, -au, am. incompliance; dis- 
agreement; incongruity, 
Anghydaynied, ) c. not to consent or agree; 
Angydaynio, j to disagree; to differ; to 

clash ; to become at variance. 
AngbydByniol, n. not agreeing or consenting ; 
disagreeing; dissentaneous; mconsistent. 

YnimlniddiQn, yrhsl hrb y (sOiciqwiiuidohunyiit nhj-n, 
B fj-ddent yn ni.i;(jjjj™iul ia ymidroddion ereill o"i dddo 
91 him.- il<tim'r 3l^liniH .- Egha (Hjvuul, 23S. 

Anghydaynioldeb, em. disagreement ; incom- 
pliance ; inconsiatence. 



AH-ihfiitHiiol A nntiu dynolryw. — Git/fftiei/fild, V. ITS. 

Angbydwaag, n. uot pressed or pressing 
together ; not compressed ; loose ; inconi - 
pressible. 
Anghydwedd, a. inconsistcift ; incompatible. 
O bydd prinwd Brwyddocid y (teirinu jn yr Yngrythyr 
Lin yn nnyijJi.-jj lu ( ffofjddpb y ffydd. vnte i'r uuuiau 
eglut u'r Tnirrythyr Lin ; yno rhaid yn wiHaw Kynwyr a 
di»\liLn]l.-l/nAnrn.- E^l.FfT.t.%. 
Angbydweddiad, -au, em. inconsistence ; a 

cciiaing to conform or agree. 
Angbydwaddol, [I. iuconsislent ; not agreeing; 
incongruous; not suitable. 



mddi uwdurdud 



'd-ddioiw^ddiau 



h-T.-.: Owcith.ei. 

inconsistency ; 
tibility; 



Anghy dweddoldeb , 

Anghydw«ddolder, , iuvuiuijui.iuii 

Anghydwaddolrwydd, ' unsuitableness. 

Angbydweddu, r. to disagree ; to be inconsis- 
tent or unsuitable. 

AnghydwedduB, u. unsuitable, incompatible. 

Angbydwaddusrwydd, sm. incompatibility, 
inconsistency. 

Angbydwelad, v. not to see in the same way 
or in the same light ; to disagroe, to differ. 



Akq hyf anneddle 



Angbjrdweled, »m. disagreement, difference. 

Bu rhyw gTiniiuint o anghf/dipf'M unvaiUi rbwng j 

Au^bydwelediad, -au, tm. a not seeing in the 
eame way ; disagreement, diffeience. 

Angh^dwerth, n. not of the same value ; not 
of eqiial worth ; not equivalent. 

Anghyd^rybod, -au. »m. what is unconaeion- 
able or unreasonable. 
Tri n»jA^«-(|ftm( cyf™ith f iiydd ; un y«. dwyn ttrfyn yo 
pwbl rjn fidof rfl erwir ; ail ^. b«rau ar diavs Hjurhcn : 
Ordrdd yw. cjTnhel! dyu »r ei hBb".— />?-j irnCi'n-, iv. ft. 

Aaghydwybodol, ( a. inconscientiouB; devoid 
Anghydwybodiu, ) of conscience ; contrary to 
conscience; unconscionable. 

Rnh. Lhrn-t: Uwylir Hy«. 36. 

Anghydwybodoideb, \ em. want of con- 
Anghydwybodolder, f acientiousneBs, 

Angltydwybodolrwydd, ( non-consoientious- 
Augbydwybodusrwydd, j uess. lack of con* 

TntMAanjfkjfdK^bodotdrr: uutoeUt ; ornus; iK anrnad. 

Aughydynuiiith, meithion, ) ant. an adversary 
Anghydymdaitli, deithion, j or opponent. 
Ac o hyn aUhd mi a vydnf ngh^ffntdath idav val y jwypo. 
A mi ay AghAiuflolal giui y gywinv. 

Angbydymeithgar, a. unfriendly; unsocial. 
Angbydymiftirflad, -au, tm. honconfomuty ; 

i'^(;uflancy. 
Anghydymffurfiaeth, -au, »/. nonconformity. 
AnghydymfiHirflo, v. not to conform one's self ; 

to cease or decline to conform ; to dissent. 
, Aiigbyd3nnfhirfl.ol, n. nonconforming. 
AngbydymflVirflwr, wyr, ) im. a nonconf orm- 
Anghydymfi^irfydd, -ion, ) ist. 
Anghyfa, ((. incomplete; imperfect. 

GttpU rai cj-fa. no hft nntyjn.—niBrrli. |M.A. lii. 169.) 

Anghyfochos, a. not relating to the case ; 
foreign to the subject; irrelevant; not per- 
tinent. 
A phob gait Blsb a gu gui Eidwjrll yn nnjiv/nrim. 

Angby^ddae, n. pot suitable, fit, meet, ot 
adapted; unsuitable; imflt; unbefitting; in- 
convenient; improper; unqualified. 
Y neb K «rf(TO t ddull boo . . . byddcd tra Rotiliiii rbair 
bod o"!- tyffelybiaethftu niw yn imjiir/iuldiu . . . ime jn 
oddfeithr.— nrnW /Vm".- ErI. Ffr. xy. i. 

Tr wjf yn RgbdUilo na bydd nuflflsfArfrfnii ymrasyoiu yn 
erbynpobano'rneiUdn.— Sa. *™«-l.- Orotliu, it. 1. 
J.3Aj/..<rf^jyselwirycyfrr«d^^.^ Qmith ii M 
Anghyfoddaeiad, -an. am. a rendering unsuit- 
able, unfit, or improper. 
Angbyfaddaaol, a. tending to unauitabloness 

or unfitness; unfitting; incongruoua. 
AngbyfEiddaarwydd, »m. unfitness, unBuit- 

ableness ; impropriety ; disagreeablonesa. 
Angbyfaddasu, i'. to render unfit or unsuit- 
able ; to unfit ; to disqualify. 
Angbyfaddef, a. unconfessod, not acknow- 



Angby&ddeflad, -au, 
nr acknowledgment. 



. want of confession 



Anghyfaddefol, a. not contes»ng or acknow- 
l^ging; unconfessed. 

Angfayfael, a. uusodable, unsocial; not asso- 
ciating. • 

Angbyfaeliwr, wyr, im. an unsociable person. 

Dydijmua brnn^ro iit.-LU/a.d : A.B. tl. S». 

AnghyfagOBjd.notnear.incontiguouB; distant. 
AnghyfagOBTwydd, >m. incontigmty. 
Aughyfaill, feillion, »m. one who is not a 

friend ; an unfriendly one. 
Ntd njijiijr/niJi ond rhygjfaill.— -Wyr. Ardi. Hi. 103- 
Anghyfammod, -au, »m. that which is not a 

covenant or agreement. 
Anghy&mmodol, a. unconditional; uncove- 

nanfed ; unconditioned. 
Aughyfatuaer, -au, »ni. non-opportumty. un- 

scasonableness. 
Anghyfamaerol.n. inopportune; unseasonable; 

untimely. 
Angbyfamaem, i: to render unseasonable ; to 

become out of season, 
Anghyf&a (a), o. not whole or complete; in- 
mplete; imperfect; broken. 
wumwTtuwydn$tr°<"-— -l'""^' Ood. We (d. U). 



UgwdvK: M.A. L »9§ (rf. 4fll). 
Diflo mghs/tn wm-gledr, . 

TelynaQ, iBdisidaa iledr.— ». a* »5»ny», etna. »- 

Anghyfanbwyll, a. not complete as to sense 
or moaning; expressing the sense incomplet«ly 
or imperfccUy. 

CaniK anpligfnilni^ll yw'r rhimyn a (ytbo ynlho aaien 
rhywbethigy5»>™''r>"n7'— S''-^''''"'''' O™™- **■ 
Anghyfander, ) sm. incompleteness ; iniper- 
Angyfanrwydd, ( footness; diacontinuity. 
ppihyny, diany pn«ii"?*.IJ;'"^fiJ*'-._ -. p-^ „ 

AngbyAkiinedd, a. uninhabited; desolate, de- 
serted; solitary. 
Yna i dilliuu ; IwyBwedd eirian 
Mewn pwll Imui itnghnfni 

^ diOMocdd yn "igix/' 



t. desolateness, desola- 



AughyfeBiiedd-dr a , 

Mi a ddiuChym i'r 11b hi 



llr. Tiajmi l-Kirrl : Cerbyii lochrdnTiMlh, SJ. 
Anghyfanneddedigaetb, -au, ef. a rendering 

desolate or uninhabited ; desolation. 
Angbyfanneddfa, faoodd, feydd, »/. a desolate 

or uninhabited place. 



AngbyfEumeddiad, -au, ejr, 

desolation. 
Anghy&imeddle, -oedd, 

or desolate place. 
Yriuiiiilwchii'r"nr(l,i//n«(i-*J/rB 



a making desolate ; 
rn, an uninhabited 

Awenycbimt o'u p1«i(i<l- 
/;»». I»XY. I(rf.li.a). 



Anohttannsodol 



Anghjrf)um«ddol, a, deHoUte, unmhAla 
unmhabitable ; desolatory . 



i dTtfrrn col anaksfimn^dd* 
BriUu,: Sioetell, 

Anghy&niieddrwydd, ) im. desolateaess 
An^hy&nneddwcli, j desolate 
bited ststo. 

To r ddlBu T gmlawyd n#*jcitmuiMnii|idd. 

Angby&imAddu, v. to desolate ; to make 
des^ ; to depopulate, 

A't diiBnedd orfumeddol nangkufa 



An^hyfiuiaawdd, a. unoompounded, not oom- 
positfi j onmixeu ; simple, 

S y nw yw b imlgol, dajtv/iiuaicilil. nt stMliwdlT. 

0. £. /«« .- teithsdur SeiaoiMH, 1». 

Anfffayfiuuawdd, soddion, »m. that which is 

uncampounded ; a non-oonipound. 
An^hyfknaoddedigaeth, -au, if. nncompoimd- 

Anghyfonaoddi, v. not to oranpose or com- 

poimd ; to decompose. 
Angbyftnsoddrwydd,*?)). nncomponndedness. 
Aji^hv^' I "■ ^'^^ opposite ; not over against. 
Anghy&rch, -au, im. [oyfarch] 1. smreption; 

uan-pcnnissian ; a clandestine act. 
Vmm dodwy uigkTmni 



AneaHn: God. BH, 

'2. a compulsory act; an act done under com- 
pulsion CO' a^inst one's will. 

Angci/mrth Bta uiuodb f* cynulb uslb ja wi^isTureiUi- 
iswl y wneathur y psUi Dyi dlfo.— TmiiiTtk yr Enaid, ) e. 

;t, a. in the Welsh Laws, an act when anything 
is privately taken or surreptitiously obtained. 

Bew TB nfhnarch pob peth ■dfoer ja tnueat l-il. ibanit, 
nbmi] ienjwater.-'Vii/rrilhmv O^mnt, 1. IM. 

-I. b. an act done underhand to the prejudice of 
another. 

A OM vn Hftiivarrh adefedic nj' dylyher JfdlwjTl ! Otm 

^ . .ftllynarrnftyiMircAadefiK^iciirdrlTirdfrwyfiaduuir, 

Cg/rnlMan Cynni, L 802 |cf. fi. 192]. 

Trj nn^Axi^rct aMeteiie j ijM, ni ddylyii 
rhAJOlwnr am dnnyiLt. dldtiu '*■""""*-.'«— i- 
yw. o derfyild bod cU 
prurdieiJiritd y dji he_ , .... 

Thus Uu Bonilad- Tiydydd yw^ or cymmct dyn fan^ d^ _ 
arall, ^ br>'Blaw er cyntiu uffeirad at glaf, rtuif d Tyaed 



riiww dau ddrn, a dyfotlu oV 
)es heb mhardd. Ad yw, or 



.1. r. what ia esclusively the 
son, and not subject to i 
with another, 

Tri angh^areh glrr : c1 Fonih a'l orTan ; ac a ddi^l iddav 

o*i dir ; u a dd*l yn wynebwoJth i ifmn « wndff. Ny ddyly 

yntdu TU11] yr un o hunynt t'\ wrala. — Tri aHghs/iTck 

ITKTaig yv d thri pbrif-nd ; aliynyniBrhanhJthau A'lirwT, 

Ityj. WlifM, IV. 11 (C.C. i. (OS). 

H. d. a fine tor committing various actians with- 
out pormisBion : cf . Cyfreitkiau Cymru, i. 1 96, 



iperty of one per- 
ision, or sharing 



An^hTforch, a. 1. surreptitious; clandestine; 

without asking leave or pennission. 



16 AKOHTTABaAVO 

Qwtithrtd aftghy/arth, a surreptitious or clan- 
destine act. — Vyfreithiau Cymru, ii. 464. 

Cwyn atigh^anh, a plaint of snrreption.— 
Cyfreitkiau Cymru, ii. 462. 
Ar^wr oi g-wyrua y banJi 

AJ- ^wihw &r ffVIUl Anp^iftinrfA. 

Urnrc* IJnrUt: JLJl. 1. 417. 

An yt kytiychaid Duiid dytot s hwech ychan, se umdyr 
a heyrn, oc eTehua jmr^t amooth a^ilwat, ac ymhoylyt 
mil o^^vynea mf^nrawl yn angkfiNaffh omaf aUiroa nBwd 
aigllryd.— fj/rAIAimi CVarv, if, MS (cf. (TO-T^l). 

Tair goraedd an^g/lirc* yaydd.—JW^. ^pc*. ilf. 381. 

Drw^ ddefnydd ao achawa. Did amt^on fodd fu, Dog i*i 
Todur ddwyn mandi oocb yn mgiu/nrch amoef. 

Trutidd CsfraM: 1I.A. iii, SH, 

i. uninTited ; without welcome ; imsaluted. 
Aughy&rcfaiad, -au, «m. an underhanded or 

surreptitious action ; surreption ; extortion. 



Angb^farclurw7dd,«i7i.iindeThandedness,Glan- 



Anghy&rchu, v. to act surreptitiously; to 
commit an underhanded act; to embesile; 
to swindle ; to extort. 

AnghT&rcliua, a. surreptitious; clandestine: 
underhanded; extortionary. 

Traia yv yapeiUav atalh oe aonodh ua el dhu yn 
anfCfuarcAiii,— raih>ra|,r A'iMii.te. 

AiigliT&rcliwr, wyr, «m. an embeuler; an 

extortioner ; a freebooter. 



Yrvrif nialB Btocb DMirn ffpistol, na bal hrdi ddim cydgym- 
ddHihoB . . . fr cybyddloD, neu k obribddeUwyi' ['an^ly- 

/rjnAic^r, trawnoD ; treunfyr], 

W.Saiibary: 1 Cor. T. 8, 10 |af. TJ. 10). 
Yd ddy^naoflgaDtbynt DdDV. yn AKekg/anlurr^ [* dram- 
ion], yn teikliiDn, ynffJn»t«7r,rn adrihyinnirg-»rtdry|Kno. 

Aoghjr&rcbwyl, u. improvident. 

Anghyfturctawyledd, on. improvidence, 

Anghy&rchwyliad, -au* sm, a iriftHTig im- 
provident. 

Angliyfiarchwyliaeth, -au, «/. improvidence. 

AngbyibrchwyUo, v. to become improvident ; 
to render improvident, 

AugTftircliwyltu, a, improvident, wanting 
forecast. 

Anghyf^cbwylwr, v^jt, ) tm, an improvi- 

Angliyfiirchwylydd,, -ion, ) dent or careleas 
person. 

Anghyfarchydd, -ion, »m. an embeuler ; an 
extortioner ; a freebooter. 

Anghyfludal, a.-=^AnghyfaTtal. 

Angliy&redd, am,, non-remedy ; non-deliver- 



An^liyftir&eth, a, unaccustomed; not of tht> 

same design or int«ntiou, 
JLngby&rilMth, »f. unaociableness. 
Anghybrpar, a. unprepared. 
Anghy&nang, o. without trampling or prea- 



jM.V^.(,K)t;ie 



Ahghtfartal 



An^hyfartal, d. 1. unequal; diaproportioQate ; 

anoioalous. 
Nurhaf J Hjd yn tyvyllu jn nwr. ar imji rn da*w ^n 
^mgluj/uruii.—SI. Great, t BO (cf. I80J. 

Xt lithra'T noiddaeth yn hawdd ac yu rinvydd-littir o'r 
■ID gynghuiedd i'r Unll pan fCot ya rf nnghtfariat. 

Cji/nnnol g Beirdd, 97. 
Tti aMaHufitriM byd : berthaiw : a chim ; bc Ninu. 

jr^. Jrc«. iji. loe. 
2. indecent, disgraceful. 

Sfdrlyd neb kjfffroi msrebHite nrtuwl jkc y medwl y 
tui krnaw yn tgkipuiTlal.—XoMiagiaH, i. 2M. 

;{. immoderate; inunense. 

A diynuint Ta y llewienydd n ^yfodefl yrwn^ mHwyr y 
fbrt gTODD BC y ba aiuAriuiria/ u sctutm dynomt Bwrt ■ 
LkmS.— £f. Oru', )3 [^. l»S). 

y rivu dnrc bagvD 
mdal ae gfliriu se g 
f^wertfaijiat.— f'vHiiar, lou. 

4. iDoomparable, unequalled, 

&t hyny, ybeunyddol w1eddH,a'rp)rfi>]eddd>ifA^ 
Br. .». I>«™< : Uyfr y Ro. 1. 1. 17 (of. IS). 
Aiighyfartaldeb, ) ant. inequality; diBpropor- 
AnghyfEu^aledd, ) tion ; disparity ; anomaly ; 



fartal & fydd yiu. 



kmbelleztig, yohydi^ anffhy^ 
cifriiaiA a Brirdd, 18. 

Anghyfurtaledig'aetlt., -au, gf. disproportion. 
Ai^hy&rtaliad, -au, «m, a dieproporttoning ; 

duproportian ; non-equation. 
Anpliy&rtalrwydd, ) lui. 1. inequality ; dis- 
* "iyfertalwcli, jproportion; disparity. 



Anghy&rtalwi 



) proportiot 

Un o bril-goiotnan tiyigleiddrwydd s (ydd mi 
'" ■ ' ■ "" y baoau. — Cif^^ath g Beirdd, 74. 



fieb na gwaha n iaeth uao anafiif/arUiliceh. 

Llt/t OhoMi Onffrrdin (Cynusim). 

'2. indeceooy ; impropriety, 

SAnyi an attofd as collet ar daetboed ydaw. ae yotea ya 

— --■-' ■ uQ J wTvic nryhaf a gard. ar offi^itfrfafiKil 

atnvd a gyuarnu ar gwr a ymnlai iH et yn 



Aughyfartalu, v. to disproportion; to render 

uneQual- 
Angbyfarwar, a. disBonant. 
An^hy&rwas, a. not contentious ; peaceable. 
Anghy&rwedd, a. unsocial ; unpeaceable. 

Am na fynai Hu hynaws 

WLad drvy a wad m'u dunva, 

TrwT ISrnsaAjyiimillid.— tf. 0. /"ngti: H.Q. 11. 

An^liyf^krwyddf a. unsldlful ; uninformed ; 
anacquaint«d ; inexpert ; unaccustomed ; un- 
learned; ignorant. 
Anghj/foTivyild A, unacquainted with; unac- 
customed to ; ignorant of. 

Byvhdid [al. byobydlg] dall aKhall aghnfanc)!. 

Bin. "h UxvifcA'Ui.' H.A. i. SS3. 

Mi a w^af ddcu-WT o'r pivyf neaaf yn cyfeirio tu ag* 
atom ; y oaiU a elwir Aitunetiia, vvr aii/hafarmuiid yn y 
pethan a berthyn i wybodaeth o Dduv; a<T Uall a elwfr 
AntfleKon, oecryo ymddjidlBiigiir. 



I.!u,,d: 



I Jicybr HyB. 1 



AngkgfarKgdd cath ft chcbyatr. 
Itaa fob itnilig/ani/sad.—Diareb. ItijL.. 
Tybiaia yu ddyladny dxapthD 
tvlyut yu eia n-lftd cin hiuuuo, fcl nn byddem ddieiUiro] 

'c*. WiMrd. .■ Han. J ETydd, 198. 

A&g'hyfarwjrddiad, -au, sm. a misleading or 
misconducting. 



Ahqhyfedkaws 



Anffliytarwyddolf a- tliat is unsldlfn]; mis- 
leading; misdirecting. 
AnghTfEirwyddwr, wyr, tm. an ignorant or 
uninformed man ; a misleader. 
ddvd, rnn. lack of ii 
in^iltulness ; ignorance. 

ri pbeth a byUnt awan : angkurarKjiMtd ; angbardd- 
ketn^ ac anghasmawl, — -Vyv. Arch.m. ISO. 



Anghy&rnya, a. without a gift or pension 
not endowed or pensioned. 

AnghyfarwyMg, a. unendowed, unpensioned 
ungifted. 

Anghjrfiiteb, v. not to answer or correspond. 

Angby&teb, a. not answering or corresponding. 

Augby&tebiad, -au, tm. a being without an- 
swering or corresponding; want of corre- 
spondence or analogy. 

Anghyfotebol, a. wanting ^ correspondence 
or uialogy; not correspondent; not analo- 
gical; unequal. 

Anghyfatebold«b, j «m.wantofcorrespon- 

Aj^byfatebolder, -au, / denoe or analogy; un* 

Angliyfatebolrwydd, ) suitableness. 

Nla jallaf 11 ymddwyo gyda'r fath aiigW'^'MnBtdd. 

Anghy&tflboliaeth, -au, if. lack of correspon- 
dence or analogy. 

Nid o«a dim dadl Uq toaa oymmalnt o aHahgfaleboHaetk 
Uma 7 pethan y maent ["w dewJa, p'nn 
ana iddynt dam arao.— /onut Taauu : Bad 

Anghytatli, a, < 

Angby&tbiad, -au, »m. a rendering dissimilar. 

Angby&tbrach, *in. non-affijuty ; want of 

Aughjrtktbracb, a. without affinity or relation- 

Augby&tbrftchol, a. without af&nity or al- 

Angbyfathrwydd, tm. dissimilitude, nnlike- 

Anghyftwdl, a. rbymeless, blank. 

Uatb alamad ydyw, a'r ymgaii cynlat i gyfanaoddl yn 
Grnmag ar y memil anghgfavrdi, 

U^fiyddiattk y Cgmrg, MS. 

Anghyfdyb, -iau, am. a paradox. 

Angbyfdybua, 1 u. paradoxioal; seemingly 

Angbyfdybiol, ) oontiadictory. 

Anghyfddull, a. not uniform ; dissimilar. 

AngbyfddwyTe, a. not rising or raising with; 
not ascending together. 

Aughyfebr, o. not big with young. 

AngbyfednawB, a. not connatural, incon- 
genial ; not of the same nature, disposition, 
or intention ; unintentional. 
Tri anbd fauoglon byd : teyrn ; oyfnewidydd i a chy- 
bydd. Bet drwg o bwyU ac aiiAwdd ac amcanlon eu 
cyflyna y byddant, ac a wnint ddaicmi o aDsavdd anffh^f^ 
idviYU! toyin yn gwaroBl dlrieidj as yn Kwermaw anwar: 
cyfnewldTad yn dhnll dihRd j a ebyliiQd yn eyfoatlui^ 
r to a dul ; a drwg o anaavdd oyfednawa ydynt i aef y 
bydd tttym yn anal^flaiRi gan olnd a saUnocrvydd ; art- . 
newidydd a wna awyll ao afmd ao afnid o dnahwant a 
blya anghufidiiaiet : a efaybydd a newyna « dylvyth a'i 
dtnlD a pbawb o'r byd hyd y gallo. «r ynnill ^lud, ac ni 
wna ddaHml o*i fodd, Bef dauml cy/sdnan, om newyno eC 



It Taauu: Sacb. OiM. SS 



.■itodd,>e 
yd.-J?*v. 



Anoiivfeiliokh 



Anghyfeiliora, >m. \_iin- intonsivc] a Btraying, 
n wandoriiig;, 
Arrhaf ytl uat )-mfiTyqli ni dim tr swnel nsb jrtt o 
(ij-vywn. kanjs ri ii dumweinjti ytt ..^.jh^v'lnnr^. 

Angbyfeiliomadwy, n. [cyfciliomi] imeirablo. 

AnglLyfsilionii, '•. [kh- intens.] to go HBtray, 

to stray, to wander, 

LawiiplDt heb ef or bnm't di jnTiiirwo gynno hyim a iiiviu>t 

J'ardy fford dy hun iir ius*,»r,.j/jor(.(, keia d>-uot beliiidli 

Anghyfeilladvy, ) ct, notuomponionablei im- 
Anghyfeilliadwy, j sociable ; unfriondly. 

Me|t)n jr mac pub aoflhyflclyb )m n„.ji.-if'W"dir) ; ftlly 
pub eylI«lj-bB ymguit.—ltul,. IJirfl: I.U-ybr Ilylf . »4R. 
An^lljrfeillgrar, u. unfriendly; tinsnciablc. 
N» IhorddMiint, yn y mtnur llfinf, oddi imb iinrhsT' 
deimUd .i„a/,n/,i!l!,nr.-l-y/.. , Bt.V.M. Rhsgdd. 16. 

AnghTfeillgarwcb, «ni. unfriundliness; anun- 
befriended stato ; uusociableness. 
CyfacTridiadau, a phall yng ngTrrti rh««liiniaeth, b yranant 
™, dun jn-enwej-fcillion, i nj.^*((/'iHipi™r* ■ chBaiueb imi 

Angbyfeilliaidd, a. somewhat unfriendly. 
Anghyfeillio, ) o. to bocomc unfriendly ; to 
Anghyfeillo, j ixasa to befriend. 
An^hyfeilliol, u. unfriendly: not befriending. 
Anghyfeilliwr, 1 wyr, ira. an unfriendly per- 
An^hyfeillwr, ] son. 

lN)b dyn ucT dyddyn DeuC elddMW agheu 

YieddudnyHTBTDHv 

Ynpddordjwul y daw. — Daff/tMR^n/rni: H.A. i.3:M- 
AnghyiL'iriad, -au, tm. indirection. 
Angtayfbirio, r, to go indirectly; to misdirect, 
Anghyfeiriol, u. indirect; devoid of reference. 

08 f^llir dyf aIu dim yn «i gylcfa, rhflid ^ncjrd hyny oddl 

r buiinvi amjkyfeiriol, the indefinit* article, 

Aughyfeirioldeb, t tm. indirectness; lack 

Angliyfeiriolrwjdd, ) of reference. 

Anghyfeiriwr, wyr, »ni. one that goes out of 
the way ; one who socedca ; a seoeder ; one 
who misdircetB. 

Angliyfeisor, a. without an equal ; incom- 
parable; matchless. 

Anghyfenw, a. without a snmame. 

Anghyfarthi.d, destitute of beauty or elegance. 

Anghyfhyrddig, a. not touching; incontign- 

Anghyfbyrddol, «. not touching or meeting; 

unopposing. 
Anghyflad, ioid, am. one that is not an equal. 
ru ry« dretnlitd pymdeiUui* plitb ••-ahaJI-M sydd i 

Ji-. (I. /■-s,/^ ; C.(J. viu. 4M. 

Angliyflaith,«,[an--l-cyd+iaith] 1. of different 
or Htrangc language ; not of the same speech ; 
foreign (us to language or speech); alien; 
strange ; barbarous, 
Dmj-cm —jh-fa'iii ny hurpcr bad b deneloent so ny hny- 

t'eiie'll n lujhyfiuiih, a nation speaking a language 
different fsora one's own ; a nation of strange 
' tongue ; an alien or barbarous nation, 

E BfTtuntLycyt ... a daiuroHUfvuit co rwyrthyau pey lu 
hey kwynviinnm klybot y gan ngl's-'S'sA kenislyl er ryw 
ilcfltryw ft bwiinw ur kywdawt^vrr vnyn Pry^yn. 



8 AKOHTKAWSr 

Tr kyniul dy dpdyf di. slh crigtonoRUth y dmlhuin i 

Din irwl"l yillltudr>d ,i'jl,vfy'M.—Ka^f,„u l!hfA^~^^,, i\il, 

\r iiril ydajtUoi bHvb wynt or ac jrwclui o jft-nedloed 

E^yb i«a'^s/aM dlffalth diffydd. 

IJyaUH ijAiui'jfA adutulp ardiarfilh- -.1.H- il- B, 

Yh Inbluddir y euth rrailh oi iK-^nh^^'irlux,. 

Tn:^.i„: M.A. i.73;cf, 76). 
Wynt a w n- ryl y mymipd ^jl.v.j-jifl . 

Piuini^h iHrnE'Io'rAipht, t,(iiuvbadilj wmlbob)n■lriyf- 
2. belonging to another language ; foreign. 

Xid am *i fod yn arwyrain i mi yr ydwyf yn cftnmol y 
cywydd . . , ond am fod yndnlci ftry o wfavyt, ft Uai o i>iriau 
nyur. ac ymailruddion a^-jhi^iiaitli gwaifav;, 

O arf«r trcirinu dicithr ac tfu-thufiaitk j mftF dad ddrwjr 
nntlduawl ■ ddylid m Kix-hplyd. . . OnJ y cHnlyni-d, ft'r 
drwB mwyaf «ydd yn Unldu o'r h»i hwn, o arfer Htiriao 
n,.,,i,a^,iii,, yr UD ■ ddyltd pi ofui hefyd yw, ei fod yn gwan- 
luu ac ynly^llu )f r>-in iri'irinu cyffrrdLn. 

II". ". /■^jr*' (O-khgrawn <.Vnlnicg (IrU3). Vti). 
Anghyflavg, u. unjust. 

Cyrdiu cyrcli cyhotddawg niftaifntv dnry lid n, b»r. 

II Pughe renders it 'unprovoked;' but the 

word is apparently a misreading for angh^- 
iiiiim, unjust or wrongful, which u evidently 
the sense required. The passage intended 
appears to be the following ; 

Acbyrehu pyrcb cyboodawc nt-^'tjjiitiru^ trwy lid a bar a 
gwenvyndra ac angnyuftrch ac jimnrrh irarglvyd ac ir ar- 
glwydioetJi ac ir (feaedyl. — r^'r^Hhimt Cuntni^ ii- 4Sti. 
Anghyfl&wn, -ion, a. 1. unjust; unrighteous; 
wrongful; inequitable, 
O gj'Aaul CAtraim, ac irn jAycMini vonaich. 



ufl: OrotiuB, iL 14. 
JVanjAy^twiioii, the unjust; the unrighteous, 
Bydd yn -mix gyfodlad n'r cyflawnion a'r angkufaw^ian. 

2. improper ; inaccurate ; bad ; wrong. 

Ai-gli^Aivn gyorich a seldrem a bair nfti/hs^im-t dd^l a 
dychymmyg a ahrebvyll, ac o byny angh]/j''iu-- Gyiarv^. 

Angbyflawnder, -au, «m, injustice ; unright- 
eousness; iniquity; wrong. 
^n^Ajr/tawniierau, actsof unjufitice; iniquitieB; 
wrongs; unrighteousness, mjustioe. 
Trl fai'sfi'Kmler )>ini a braird. 

€u/r>iAu,~ l^smrH. ii. SSI. 
r.lSl. 



laim yw'r byd o nagS/^um 

Anghyflawnedd, -au, n 



•r a gwcndid. 

S K^. i». Z7, 
injustice; unright- 

Aiigh.yflftwuli&d, sm. non- justification. 
AngliTflawiiliaol, a, not justifying. 
Augh.yflftwnliau, t'. to make unjust; tofal^fy. 
dim waeth na chynghor drvg, dnry yr hwu 
i. bnuiiiiiBeUuiu vn va blinbun . . . 



Anghyflawnu, i'. 

Oan briuhnn yr »>bi 
plorianan trw^ dwyll. 



irtiiog Crtrj,tlr/<ll, i. a, 

o make unjust ; to falsify. 

I, nhobwChu'rHid. acinyAjt^'i^nn'r 



Anoutfieithiau 1 

Au^bj'ileithiad, } -au, sm. mistranslatioil ; 
Ang-hyfieitbad, ) non-tranBlation. 
An^hyfieithu, p. to iniatranBlate. 
Angliyfieithus, u. not of the same lon^agc ; 

not acqoainted with the language; of different 

tongue : barbarous. 



Kyt doliirfs.w j 



. ,. n y lirpo 
ochrTc anaymiawl . 



« pob n*W- 



, am. disjunction, disunion. 



AngliTfleuad, 
Angbyfleuo, 

bas been yoked together or 
AnghySeuol, a. dicgunctiTe 
Angbyflng, a.=Angh!ifyjig. 
Anghyflol, a. unequal, not equal. 
So but i ddnwianj gmn 



sepamte what 

ijugated. 

iconjnnctiTe. 



H^*jr^, 



' arfaq ymladd.— 



Angh 



whi^ is tbe word in ordinary use, and fi 
which the dorivatiTes are formed. 

Gmd dol] aghn-iint 

Mjn i ma« msUivn. — Mj/v. Anih. 1. 184 (cf. 184). 
i chvi iTTfcnilDn o'r irolud anahufiiin.. 

hr.JcinDavSi,: UffryBa.II 



Gmjrf^B, Ofy Xiiv,i> law yTaiuiawiol,o lair yriTn^A^- 
anghgfim Dkw, CDs] f ^lijn^ tdw gof eiefa 
lyvynu ai y dnr; a'r da, 
'm? Hom.i.80{cf.6}l. 

AiLghyfladd, a. not fitting 



•c yn daufon glaw ai 



_ r suitable; 

herent. 
AughTfladdrwydd, «m. incoherence, incon- 

gruity. 
Angbyflafan, -au, «/. [_an- intene.] a crime, ai 

offence. 

top aghafminn [al. kyflauan] agTienet greyc talet eken- 
edel trofldy mal trba ffur any byt ^uryHuo. 

Ci/fyrilhian Cy,«TTi. i. 104. 

Angbyfla&n, a. [nn- neg.] without violence. 



Angbyflafar, i 



I. inconsonant, dissonant. 
Ajigbyflaix, a. not agreeing in sound; die- 
sommt ; discordant. 

LDliarth yn drwsglt ac yn 



laidd. 



dd,'&. 



Anghy&utb, a. without mutual slaught«r. 

Breint onffyr an^ert nqk^uMA 

BRdn bomiyad gTreiniuyad girinurith. 

CvnUdii: M.A.i.S16. 

Augbyflawiiid.notfullorrcpletc; incomplete; 
deficient; imperfect. 
Nyd dawn anggjlami DHC asgygya. 

Ll^Mtai Fsrid: M.A. i. 368. 
O biTwjdd niaeV hall WDlCbredqcdd da. a allom ni «u 
gwTunjthuT. yn anghwbl ac yn ungiijfHatBn- 

Tlwyot pob lEiatb 
O atu^kg/aKuiom anian, ertliyl. nea 
Anflbeonl, neu afrvwiavg gynudjBg Htb. 

IP-. V. rujhr: CO. iii.6(«. 



Anghyflawnder, -au, »>d. incompleteness; iiti' 

pcrfoctness, 
Anghyflawnb&d, hadau, >m. non-completion. 
Anghyflawnbaol, ) ii. tending to make in- 
Anghyflawnbau*, ) complota. 
Angbyflawnbau, r. to render incomplete ; tn 

cease completing or oceompliahing. 
Anghyflawniad, -au, »m. non-completion. 
Angtaydawnol, n. non-completing. 
Angbyfla wur wy dd, «m. incompleteness. 

Ptawf anil a ddynir yn amddiffynol i'r golygiad dan 
■ylw, ydyw ani/hsjtivurv^yii't gwobr y cyfiawn. 



[oli haeldra 
Anghyfle, -oodd, a 



Tn agkffic Uwfwr llafur at 



Angbyflead, -au, ) am.adisplacing; amia- 

Anghyfleb&d, hadau, ) placing ; dislocation. 
Angbyflebau, v. to displace ; to misplace ; to 
lake incouTeuient ; to put out of convenient 



Angbyfleol, a. misplacing, displacing, disloca- 
ting. 
Aikgbyflfiu, V. to misplace; to displace; to 

dislocate. 
AngbyflSus, a. inconvenient; unsuitable; at 
on inconvenient time or season; untimely; 
disadvantageous. 
Qerwyd nuwa yr Albanwyr drwy goffau y amuiryf aodog- 
olyaetb™ gynt kyrchu a oruc yn tiffk^ita. 

Snilf Tgargaogion.Ji. 



[wya(B; 



nt gynghor i ymadaw i 



Angbyfleusder, -au, "i 
Angbyfleuadod, -au, jsuitabli 
Augbyfleusdra, ) tage. 



a trwy dniUi a (fwen 



Angbyfliw, a. not of the same hue or colour ; 

different in colour. 
Angby^wio, t'. to make of a different colour ; 

to render of different hues or colours. 
Angbyflo, a. not in calf. 
Angbyflog, a, without wages. 
Anghyfludd, a. without restraint or hindrance. 
AngbyffuQf a. unlike, unconfonu, dissimilar; 
unorganized. 
Oddl yma owmwl, uu, o lud(~ ' ' 
O gyfrwng nid oMd buoo. ki 
Er^«ied, nld i eieill beUu gi 



Anghgfiua, 1 ddaiaien a ganld Duw. 



AsanvFLDNiAETH 1: 

Anghyfluniiieth, -au, «m. lack of provinoD; 

want of couformit7 or likenoM ; duorganiza' 

tion, want of organism. 
AikffliTfluiiio, 1'. to disoTganize. 
Anghyfliuiiol, a. not plastic ; inorganjo. 
Anghyflwg, a. not plain, manifeBt. or oon- 

spicuous. 
Ajxghy&wi, lyrau, tm. unhappy oonditioD ; a 

bad Btato ; misery ; misfortune ; distress ; 

diiBcuIty ; harm. 

With hjuny adpf cdy ymbmwt vy anjia/ier i ae ym 
Dub oa gwelj.— St. Grcol, I B9 [at. 1%, IBS, »»). 



,\nghvisifeb 



Ete ei bunAnrv jt offeMul hwnv o nrdd Lefl, a fyiuff- 

odd Duw yn y DeutennumiJiua, oddi vrtb yr hwn y dylid 

ceifllD oynghor mewn auAiufvr, a cfayn^u Mm evinrm«dd, 

Hani CtJio .- IXB. vL ». 

Anghyflwrw, <m. untowardliness, according to 
Pugha ; but as cyjlurr and cyfiwrw are syno- 
nymous, anghyftvrr and angnK^wrtu prolnbly 
signify the same thing, if thti latter aotually 
occurs. 

Anghyflwydd, tm. want of Buocess, uuprosper- 

Anghyflwyddo, v. to render unproBperous or 



present 

Anghy fl w yt h, -i, rai. unequal weight or 
proemire. 

Tnghyfisgod glyw atu an glewdm 

Yn iwbrAkrvrjl irwytb (rwuth Nunhyfar. 

^ ' (;,MMeJ».- M.A.I.W. 

Anghyflyedd, tm. non-confederacy ; disagree- 

Anghyflym, a. not qniok or sharp; slow, 
taxdy, dull. 
Angkyflym ti dthail, dull of apprehension. 

Aghgfi^m UQiiBr uetreh fer fyry/De. 

zjfic. It Ugwtifn : U.A. L ase. 
Anghyfiymder, i am. want of quickness oi 
Anghyflymdra, [ sharpness ; slowness, tar- 
Anghyflymrwydd, ) diness. 
Anghyfiyrus, 1 a. [anghyflwr] miserable ; un- 
AnghyflytiuB, j happy; wretched. 

Bi fod ynBhy™e(fr-gtt]ch fi-Ail 

IFnna«i(iiyl^™.fydd— /.ly^iJsiffcw*: M.A. i, 6*1. 

Aa ynUv a dyw&wt ma« uvtell j moiynJoa y ^wlt of, 
aph&wb UT yiflyd yudu ynyd an^hiji^ry^ 

Anghyflya, 
mannered. 

Hukdoflt iiD om heri oyd cut ve^yi 
Nyd d&wn annHavii nu avssjln'. 

rjfi«^,m FarM: U.A. i. »g. 

Anghyflyadod, -au, em. unconrtliness ; un- 

ccurteousness ; undvility. 
AnglijrfiiawB, a. not of the same nature or 

disposition ; uncongenial ; not homogeneous. 

A'r modd y ^wneir iaitli tal hyn yn eglar, yw Uwyr ym-. 
mUiad k pliab prUi aafkuftiautt, > pbob oumuiHwdd yn yt 
ymudtoda.— (7K/Wiini:» g hrinid, 16. 



Ac H dan kvymv y agkamirili me at^huioctyt yn y v^ 
honno ef ■ doeth hyt yg KHiytya y dyom yd oed y »erch 
yndaw. Ao onvon kennnt • wnaelh ut y vivch y tcdc^ 
ySy y TI' aytcun"-!* rykyramod m of. 

Ao WTth hynny yr agk).iiTl>fi u- doluiyen a dyodewya 
yyn>tkrfr» tyhedy*.— fl™i dr. at Ankar: M.A. ii. H9. 

Ao yn» ■nron uinerch at y vfreh > onic m y ™Jis(ti idi 
y riw arngkyJIufOi a g^-farfy wai ar pt, 

Bf« [Pedr] a atebodd. Pe irorfrddai i mi tarv Kyd t tU, 
ni'th wndaf ddim ; ac ynu yn oi wadu ef tnry angkjjfmrrik 
a gwendld y cnavd. 

aiWlfn Hi /■TuvrU: Prt^Uiau Biuad, 11. 

Anghyfiierth, a. without support or sixengtb : 
infirm, unsteady. 

lotTth. 

' °°" ' '" «i7^, aaxvL St. 
Angbyfitertlu, tm. weakness, impotence. 

iMmai: U.A. 1. 3W. 

Angby&ertliiad, -au, »m, a rendering weak, 
impotent, or incompetent; debilitation. 

^SjSlSi j ..'™*»ing.d.bilit.a„g. 

Anghyf&erthrwydd, ) im. a weak or infirm 
Angby&artlLwcli, ) state; debility; inade- 

Angbyfiierthu, t'. to enfeeble, to debilitate. 

Anghyftiortll'Wr, wyr, tm. a weak or inoom- 
pet«Dt person. — P. 

Anghyfbewid, a. not changing, immutable. 

Anghyfiiewid, -iau, -ion, »m. non-mutation ; 
imm utableness. 

Anghyftiewidiad, -au. tm. non-mutation ; im- 
mutability. 

Anghy&ewidio, t>. not to change; to render 
immutable. 

Angh.]rftiewidiol, a. not changing or altering ; 
changeless, unchangeable, immutable; incom- 
mutable. 

Qan arwyddoeiu e{ fod ef yn hanfod (ruffwyddol ac 



.— Uto. Ltvit: brych YB({r. 

Anghyfiiewidioldeb, \em. immutability, 
Anghytnewidiolder, ) unchnngcablenessi 
incommutability. 

Canya ammtaeu o honaw, d herwydd rwirionodd Dnv, 
Bydd nblediffafUi yn iTbyn angh^fjiiHdioiit'h dianwadal- 
wchdwMDHddef.— Ai^. Ungd: Uvybr Hyffurdd. MB. 
Cawn Qin har^bocddi yn ^Htal trvry barbfad ei ddaiooil 
"' " ;™. Tom^: Buch. Gri»L 83. 

AnghyftaewidiWT, wyr, am. one not liable Ui 

mutation or change. 
Anghyfiiawidrwydd, ani. unchaugeableness, 
incommutablcness. 
AufAiffifipiitn^/fddcyllvT mocml.— Adufjggiid, i. 363. 

Anghyftiifer, a, unequal in number; difiiering 

as to number ; aliquant. 
Anghy&ifbr, -ocdd, im. an uneven or odd 



,.v_.(,K»t;ie 



An qhtfn ifbbsdd 



An^hyftufsrO^, ) a. of unequal numWr; con- 
Ang'liy&iiferol, ) gisting ot odd or uneven 

numbers ; disagreeing as to number. 
Anghyftiod, a. out of the appointed time ; 

inopportune. 
An^hyfoclir, a. not parallel. 
An^hyfoclu'awdl, ) a. not having parallel 
Aughjrfochrodl, ) rhyme; not rhyming pa- 

rallelly. 

fyogiiaiifii axs\^ochradI.—Cij/HaiKll y Bantd, 127. 

Anifliyfochredd, tm. want of paraUeUam or 
oollateralness. 

An^lLyfbcliri, v. to render not parallel ; to be- 
come disconnected. 
'AngrlLyfocbrogr, a. not collateral or parallel; 
not running in the Bams direction ; unparal- 
lelled. 

Pwy, wrth fodilirl mynyd wn yrBiifo«oldBl), yr aonlneir- 

Angrhyfocbrol, a. not parallel, not collateral. 
AjL^hyfochroldeb, im. the state of being not 

parallel. 
Angliyfttd, a. without rising. 
Anghyfodawl, a. not rising; not raising. 
Anghyfbdedyn, a. difficult to be lifted or 
rained up ; inunovable. 
Da anghyfodedyn, inunovable goods or property. 
Pufbomflc Bdnleho da fHfaU AketHBTau ohonan tain da 
iffl^ufydedyn am T dylyet 1178 drlerr kemrrd da aghaitoiedjfn 
nas en tKl nan Ba ^fstyl. 

Cn/reilAiou Ogrun, U. « [rf. SJ*). 
8ef achofl yw hrnny wrth nadylyir ^rvyftllav peth aghj/uod- 
tdftt ajD drlyet aaUer j ^chwyri. 

f7|^rei(l(ah C^nm, ij. 38S. 

Anghyfodiad, -au. «tn. a being not raised. 
Angbyfodlaetli, -au, «/. the state of not hav- 
ing the same rhyme ; want of uniformity in 

Ang'hyfodli, v, to make of unequal or different 
rhymea; tobe of unequal ordissimilar rhymes; 
not to rhyme. 

Anghyfbdlig, o. not rhyming together; des- 
titute of rhyme; rhymeless. 
Hi a velaf j Motgvra a.'i ddeu-fnicli Ryntaf fn unnln 
- - . a bod y ddau mich diwa«thaf yo angh^fodii^ I'r ll«iU, 
ac jn gyfoiUig ill dfuKBdd.— Or. BobtrU: Oram. S21. 

Anghyfoed, a. unequal as to age; not cocta- 
neooB ; of different age. 

Anghyfoen, a. not big with lamb. 

Anghyfoes, a. not contemporary. 

AaghyfoeBi, v. not to live in the same age or 
at the same time ; to be not contemporary. 

Angliyfoesol, a. not contemporaneous. 

Alighyfoeth, a. destituto of wealth, riches, or 



A< agkyfiitti TW.—Taliabi: A.B. il. ISO. 

Ang'byfoethog, a. not rich, wealthy, or op 

lent; indigent, poor. 
Angbyfoethogi, v. to deprive of wealth ; 

render indigent. 
Ifi 



Ano hyfeas ad wt 

Angbyfoethogrwydd, tm. want of wealth; 

indigence. 
Angbyfogwydd, a. without a bias, unbiassed. 
Angbyfogwyddiad, -au. im. disinclination. 
Angbyfogwyddo, i: to disincline ; to nubias. 
Angbyfogwyddol, a. unbiassing; disinclining. 
Anghyfor, a. not o-Jorflowing; without an 

overflow. 
Angbyforddwyn, tm. incomprehension. 
Angbyforiog, o. not overflowing; not brimful. 
AnghyfoBodiad, -au,*m. a beingnot synthetic; 

a being uncollocated. 
Angbyfosodol, a. not synthetical. 
Anghy&add, a. not of equal degree or rank. 
Angbytragod, v. not to waylay together. 
Angbyfraid, a. inaufBcient; incompetent. 
Anghyfraid, reidiau, am. insufficiency. 
Angbyfraitb, reithiau, «/. what is contrary to 
law ; the transgression or violaton of the law; 
lawlessness ; illegality. 
doniit jdia suneiitJiuT cam keiraUird keniaac jut e 

nodutt. B kmodi banl amau ef am jr ngUungUi honno 

redigoDea tub oodua ; oydde er abadeu ramdifflo. 

Cx/rrilhiau Cgviv. i, IW. 
Trf acham TmHsottst kynrdUi : kyntaf yw, yveiamw 

djKTuagwTMembaraff^lfurfilh; eiljw.jTgwBXelaffkf/urfiih 

or darSri y gwTxaibut ; trydrd y w yr ooapi yneb awnelnet 

'""-■ ■ ■ Ci,™™, i. -- 



ih trwy ditwy a chamlw: 



Angkyfreithiau, things contrary to law; law- 
less acts; Ulcgal proceedings ; unjust laws. 

Oirdl oed gaatuot Urayim eu bywyt yn gomooledic dn» 
rydit eo teyrnas no chyt odef ac aaky/ral^v y Ffrclno. 

Dieyn peth i wHk anghyfraith i gyfraith, to 
bring illegality recognizable to the law ; to 
recover a thing stolen. — Leges Wallicaf, II. 

CtA mdUl ttnghff/reith mghira- 

Ffgdr/dd Bachan: M.A. i. SSI. 
O adios y dryginni a ddyg«yddeB ja ei oes ef drwy ym- 
roi i ddrwB ac «,.,lis/r-iil>. a fflcidiiwch amn-yfol. 



Angbyfraitb, a. contrary to law ; illegal ; 
lawless. 
(Iwerin anghyfraith, a lawless rabble or multi- 
tude. ^j¥yu. Arch. iii. 11. 
Anghyfran, a. without a share or portion ; 
without proportion ; incommunicable ; un- 
connected; simple. 
Qan fad yn unieryw a naillduol,' ac otighymMetli, ac 
anghjf/ran, l^-anaawdd ca-nynt. 



CkM" 



K |t(. J! 



Angbyfran, -au, tf. disproportion 

YadnteU Oyoddylan amorwan pob avr 
Owcdi mawr aughn/rm [a!, anahyvyrdan, ymBynyrdanl. 
/.IjMrTii Hrn: M.A, 1. IW, 
Ami wrth aynitd rhyf odd iawn 
Yw genyf , pa y TwneUd Aniau ildoctb 
AcQiyimil gyaai angh^ranau. 

a-. O. Paghi.- CO. yiii. iS. 

Angby&anadwy, a. incommunicable; unpro- 
portionable. 
Friodo/i'ietliiiu anghy/niiiadiri/, iaaomiaiudaMo 
Httributos. 



Akohykkanoah 



Anghyfrang&r (a-g), a. incommunicative: re- 
served. 
Angtajr&anptrwch, *»i. inoommunicativencBS. 
Anghyflraniftd, -au, »m. uon-porticipatioii ; a 

not having a portion. 

Anghyfranog (d), a. not participating or shar- 
ing I uncommiinicatiiig ; incommtuuoable. 
yr rnw uiiyhy/riiTuig, the incommunicable name. 
—Dofth. liV 21. 

liaf. 
t.V"i"«* » Biirdd, 78, 

Aughyfi-anogfieth, -au, «/. non-participation ; 
a being without a sharo or portion. 

Anghyfranogol, □. incommunicative ; inoom- 
inunicable ; not participating. 



Aughyfreitltgar, n. [aii--|-cyfreithgar] 1. not 
litigious: not given to litigation. 2. fsnghyf- 
raith-f-cftr] given or disposed to Uwleasness ; 
not law-abiding. 

Anghyfreithgnrweli, fin. 1. non-Iitipousness. 
2. dinlikctohiworonlGr: a lawless dispoaitioD. 

nivydd ■ thwyU nn-ywpddin ■ —■'—-' '- — 



Anghyftanol, a. incommuiucative ; 
nicable. 

T giroiUmdisdau isit/li-ifnnul, oeu briod<>luiBUi>.a y tri 
Fli«m>n oddi mewn, jayai j rtui byn. 

KowlaniiVaygltaii: Vnurf a Duwloldeb. 8. 

ai A nim *d]iAbod natoriuth asg^vfro'iat y f«ad%ed- 

talDmOoa.—Dr.J.IMvui.- Llj-fry Km. 1. 1. 13. 

Angliyfruioldeb, »m. vrant of ptuticipatdon ; 

on unporticipated state; incommunicative- 

AngbytranwT, wyr, *m. one that does not 
share or participate with another; a non- 
contributor. 

Angbjrfrawd, n. unconcurring. not concurrent. 

Ax^hytrttea, a, incomplete. 

AugliT&das, »n. disagreement; disorder, con- 

TBtafell CynddyUn a^m erma pob nwr 
Owedy mswr nn-jijcvrjnu [nl. ymgynnyrddjinl 
AwQlaatidj}>ealaa.—lls«.-arcJ, Hn: M.A. 1. 109. 

Anghyfrdelaid, n. not beautiful throughout : 

not all perfect. 
Anghyfirdelid, a. not thoroughly beautiful; 

unbeauteous. 

Om immjrUt a^gfgnlelU, y lutlb dybyd. 
B(TW jioauukt bumawc [-iX. bsrnawol or <«nt nyi rywelyd. 
rafiu'u.' A.B. ii.2»2 (rf. M.A. 1. HI). 

AnghTflrdftlid, -an, na. what is not beautiful. 
AngbyfMlywr mgk^grdtlil llum.— t V**- A.B. d. 9M. 
AngbTfrdo, »m. imcomplot«ness. 
Anghjrfrdo, a. incomplete; imperfect; out of 

Anghyfrdtryth, a. unelastic; lacking elastic 

spring or power. 
Angby&ed, o. not concurrent, inconcurring ; 

not parallel or coUateraL 



AnghyfrMtbiol, a. illegal ; unlavrful. 

Y vlwj^yn rw iiyn?b ydymrfaDeldwd Hoiri unnhin o 
VwTiljira, «■ y kyfarMgwyt j Kjnnry s lUww or™ erall 
fn naij/rrilAaur/.— flrwl J 7V"'»«oj"i"'. Wl. 

Yr hwnn ywi-d jfn gHol ifvnnal y tir rac y dywtdeilic . . . 

Anghy&eithioldeb, on, illegality; unlawful- 

Angli7fr«itlilawn,<i. unlawful; illegal; illicit. 

Oiwl ■ wyddoch nui noofljj/i-iiAIoicn y* f wr tnddew 
rnnru^u neu ddyfod at iSl\,uA.—Act. i. %, 

Oochft fad yn cbimjyddion. mc rut mwlir bugonkm 
aiifhu.,ilKla«.—M<n-yl C%i,iii: Athr. QriM. 44. 

Wt iddo fod yn anbr, jirfpryd yn Eymineflnr bob rtiyw 
ddfryrwE'h oyfr?ith1ou,al]iryTylnAttaIudd] WTthddifjrwLlfc 

Anghytreithlondeb, ) tn\. unlawfulness, d> 
Anghyfreithloorwydd, ) legality. 
Anghyfteithloni, v. to make unlawful or il- 
legal : to illcgaliEe ; to make null or void ; to 

Anghyfreithloni gum'lhred, to make a deed or 
instrument void. 



A minrr auf/lji/ml [al. ngbyBrtt).- 

Angby&ed, -au, rm. lock of < 

agreement; non -concurrence. 
Angbyfli^dol, a. inconcurring, not concurrent ; 

not parallel or collateral ; discordant. 
Anghyfteidiol, a. unnecessary. 
Anghyf^eidrwydd, am. 



O der^d u mUo 
bnrdvT a ddyly fa 

Anghyfreithua , 
litigious. 



u^wydd 



i bervhf-n y wpithird. 

Ulogal, unlawful ; non- 



u yn anghy/rrisJiut yn crbyn T] 

Cgfrrilliiiai Cgtm, U. 179. 
Dynion tlonydd, m^j/irWiu, 
A dilalais. tadiu, tre^uB. 

Morgan LItrfi: (Tvydda' Ucluid, U1, 

Angby&«ncio, v. to break the ranks of; to 

disarray. 
Anghyfrsnt [?]. Uncertain both as to reading 

Anghafini [a«hyriuint. A.B, ii. 140} o nden ■"ir— ■ 
Omflawg.-jiiS™..- M.A.i.C4. 
Aoghyf^ea, ) a. not in a row or series ; with- 
Anghyfrestr, f out regularity; disorderly; un- 
connected; discordant. 

Ardwymt ba«l o bwyl u^n kyrt 
Nyd kBTtWBwd agiy/m. 

Urm. ob LttwtlfTt: If.A. i. JSi. 
Angbyfreatrog, j a. not in a series; in dia- 
Anghy&eatrol, | order; irregular; uncon- 
nected ; disarrayed. 
Anghyfreatru, v. to disarray. 

Anghyfrutru byddin, to disarray an army. 
AngbyftgoU, a. not entirdy lost ; unoon- 



Angbyftif, a. without number, innumerable. 
Angbyftifol, )a. 1. innnmerable, numbcrieaa. 
AnghyfrifuB, ) 2. oi 



Ju.V^.(,K)t;ie 



Angiiytria, a. without myatcry or Beoreoy; un- 

Ang'hy&uiacli, -au, tm. non-mTStery ; what 
is uo secret; publidty. 

Ang'hyblnacliol, a. not i»ivat« or secret ; not 
mysterious; public. 

Anghyfrinachu, i\ to divulge gecreta; not to 
join in secrets. 

Aiigliyfrlog, n. without motual privilege; not 
equal in esteem or honour. 

Angliyfidtli, a. without pretence or show, 

Anghyfinthol, a. unpretending ; without pre- 
tence or appearsuoe. 

Anghyftodedd, a. without contexture; not 



equal in every part. 
Haa yn anghyfTodrdd, U> sow irregulnrly. — 
S.W. 

Anghyfrodeddol, \a. not twisted together; 

Auf byfrodeddig, j untwisted, untwined ; ir- 
TCgidar; unequal. 

Angbyfrodeddu, v. to untwine, to untwist; 
to make irregular. 

Anghyfrodd, | a. without contribution, not 

Anghyfroddol, ( contributive. 

Augbyfrwi^, a. without intervention: im- 
mediate ; ^one. 

t^a fytbo dwr De dair a ffTBKfiuald snghtifrvng -m oewf 
flun TT odl, mrcrurrddai I bobnnnelsi chTiuhlo rn y 
At^oii.—Gr, RobrrU: Onin. ioa [rf. t\tt). 

Anghyfrwydd, a. not expeditious; not expe- 
dite; difficult. 

Anghy fr w y ddiad, -au. tm. indirection. 

Angby&wyddo, r. not to make expeditious; 
to render difficult ; to retard. 

Anghyfi-wyddol, n. retarding. 

Anghyfrwyddyd, tm. want of expedition, ease, 
or facility ; indirectness. 

Aiighyfi-wyB,a. notcunningorartful; simple; 
guileless ; unwary ; unskilful ; untrained. 
Owerlh gtll^y e bimyn pnnt en kefrn jB : chiiennpyntyo 

Aaiffh^ricr/* ynt y rmlAd. 

Bn,! Gr. o* AMt-r (Bl : M.A. ii. 3M (cf. 282). , 

Ot^Tvird atfkgfrm^t y beryf a« hairyded. \ 

F\)li,. B'gdadd: H.A. i. S78. 

Aagbyfrwyadja, I »m. want of cunning or art- 

Anghyfrwysder, | fulness; unwariness; sim- 

pKcity. 
Ai^hyib^dd, a. not equally free to all; not 

Tut CTfiBQ ttnghmffi/id j vydd ; aef nid rhydd i nob ond 
I'd meddo. — fiantdnn, ii. 00. 
Anghyfryngdod, -an, sm. non-intervention. I 
Angbyfiyngiad, -au, im. non-mediation, non- 
intervention. 
Angbyfryugu, v. not to mediat«, intervene, 

or interpose ; to render immediate. 
Angby&yng'wr, wyr, i tm. one that does not 
Angbyfryngydd, -ion, j intervene, mediute.or 

interpose. 
Anghyfryngyddiaeth, -iiii, «/. nou-mediiition. 



!3 Anobtfw&dd 

Anghyftymtu, a. not equipollent; not oon- 

firming. 
Angbyftyaedd, a. not excessive. 
Anghyfryw, a. uncongenial ; not of the same 

Idnd or sort ; heterogeneous. 
Aughyfun, a. not united, without union; not 

sim^e; ununiform; incongruous, tnconnstent. 

Ocheffy di yn y Uyuyr bvn dunafllcieddduiilietj agki//in 
J wirioned. lui liwia yr golyFrtanrdyr. 

T Due rhai 'u d&1> y gsUir csnu'r ddeufan cyutaf >'r 
oM i gjd ja ddiagTDcaig ar anfliyf" aneo. 



Angbyfundeb , 
Anghyfundod, 
AngbyAmedd , 
AnghyAmder, 

A.C o ba l« T daw y cynheiuu. yr ymryeonau. a*T 
iindfMii yma, ond a fuchpdd a jfwg-a«raniuit f 



-au, ini. disunion, disunity; 
disagreement, dissension ; 
contention ; discontinuity. 



honeB^wydd ymiyBDn, cynheui 



a cbywilyddua an- 



to length. 

Nid mynych y bydd rhyviog y oymmad o qd ban i'r 
llall, <» byddaot lin anghs/^hsd na theicall. 

d^ri-aA J, Ainfd, 73 Icf. 100. 106), 

Angbyftinbyd, -au, tm. unequal length. 



AngbyAtnbyd&n, a. unequal in the len^h of 
the Une. sti^in. or division (in versification). 



PsnnOlkin ttiban milwr oByflj/imiyii/aB lal hya. 

Ce/ri-VKi y Brirdd. 100 Id. 87}. 

Angbyfuno, v. to disunite ; to disagree. 

Xid ttnghj/funai daDKnefedd ff nrytblawa. 

M'UUi Dtcsgrain : M.A. i. *81. 

Anghyftmol, a. dissident; disuniting; want- 
ing union ; not united ; disagreeing. 

not uniform ; inconsistent ; 






Angbyfunwedd, i 

dissimilar. 
Aneawdd damwinniaw] i'r okdemyd^ a arwyddocao bob 
alia Beff II drwydd&w ti hnnoji, heb ^ynndliiid 
da* . . - a'r f'yfryw hcUiaQ a ddangoHaDt nid y 
li fodedljeaeth, eitbr yn «i ryw, a'l anlsn, a^i lEw. 

UEkfdd a>r ef parth cudcrriyd, eithr yn inffh),Jai,v}"lft ag ef ■ 
Qbartbannawdddarawain.— tW^y^Ti.' Duqwrth, ^1. 
Ai^byfunwr, wyr, tm. a disuniter ; one who 
diHagTeog : a dissident. 
Anghi/fuiimiir, dissidents. 

Anffhyfifiicvr . . . pnv a ToddinrrithiaaarymnfliUdnvyr 
oddi with E^lwys Uo^gT.—Gvffddonwdur CymFti^, i. llfi. 

Angbyfttrdd, <r. unequal in rank or degree; 
Angbyftiwcfa, a. unequal in height. 



Nidgi 






li Oirltgn. ixlx. 31. 

Angbyfwedd, a. dissiioilar; improper; irrele- 

Angbyfwertb, a. not of the same value; not 
equivalent. 



Angbyfwlch, a. disunited; incoherent. 

Anghyfwrdd, a. [an- + cyf- -f hwrdd 

touching ; not contignmiR ; intart. 



AXOHYITKOAWI, 

Anghytyng, a. not oarrow, etrait, or confined ; AnglLj4fr*d, -ion, tm. mcompreheiuioii ; that 
nnreitrained, unlimited. which is incomprehensible; infinitude; im- 

TYiry ^Tmhorlli uihrlDd*^ 7 Frelfyddyd fuu. mac doeth- m^HHIty ; CTCftt bardship. 

Anghytyngder, -an, «n). freedom from difficult; 

or distresH. 
Anghyfyngol, a. not Btiait«niiig or nanowing. 
Aaghytyagu, r. not to narrow or straiten ; 



An^bTfJrlcliedd, >iit. incohercnc*. !>;*(.;■■.- M.A. i.»< {cf.»w. 

. - .. -.k. .ij.- AcTn hrnnv rd Td mnmaaa CUrel TTOkhiD yn dir 

Ansi>77™dT«Cb, a. without mutual Btnmig ll,wpro»,l,jf.«.KriiirQhniTlTun'diilTn>D4en«» 

or exertion ; without contention. »"i •* cii-iiij-f.— ('-!">"■ '■*nr/,r«n^». ( n. 



Aaghytyxaliw, a. without mutual expostul*- Ang'hyffradad'WT', pl.a. incomprehensible. 

tion. Sid i>w .md on Duw, pwyf. cnawdTdd. Ufwrdd J byd. 

Anghyfymran, a. without mutual division; hoiuiiii.w«.u.«wy4u-i.«a.H>*f^'-'J'^^-^^ ^^^ ^ 

not equally divided. „ . . ^ AnghyflhMtedd, «... inoomprehenaibility. ' 

AnKhytymwel,!!. not mntuallj visited or seen; . . „ ... . . . 

unfrequented Aaghyftsdiad, -au, »in, mcompTcbension ; 

Ahriiy.i«iLrfriii»™im«ido„-ji,/v».-i««ghrt- exclusion. 

tram.-'/tjrj./-w, i. (38. A Tiphy<fr* rtifi ^ a, 1, uncommon ; unosual. 

^ugbytyM, a. not cotroftive ; not co n sii Tnin g- ArAaocdtniMit enoffSifrrtiy^frnLnwjt^ 
AxtghytymgrU, a. not tranacribed alike ; differ- 



O diiir BnHd j 



ently copied ; differing in transcription. yr "lai n^.y/^./m kj^ noc adair iiTiet- 

Tm«hrfyd jUTOdymsHh DiJ.Un.rilhrT"=-?*V'- . _. . , , ,. ... „ ' ^TV^T"' '*^ 

AughyfysUya, a. not ooUat«ra] ; not parallel ; 

without a parallel. 
Angbyfyatyr, a. disafp-eeing in meaning, not r*. o'i (od fo ai,jtif^.iim ju j ddadl cyn bunu : 

sjnonymous; irrelevant. c)iih™uMi.-t-a« ii.,j,w- ,. ^-^ i 

Benir Tw ixiVi nir m nrnTddunu mdpnvd. nini ddefn- Aagbyfik«dinder, 

jd^n™ Durfaj-n bMh ■ hod ™«f.Bie.ii|!Mih. heb y nod AnghyfflradliiAddi J unusualnesB ; infre- 
ri»g,.r.D™i-n»-,«.v/K-'i-'.wirb™gr-->^ «^^^^ , Angbyftedinrwydd, ) quency. 
Angbyfhlyb, a. dissimilar, unlike ; unlikely, ! Yr achoa pa bun jt jvinhmui oddi wTth grvtjid 

tapR,b.bie; i„<«„p«.bi.. ; ;;£:Lr;«''.™,rtS'b3K^ssa,s:s'iK 

Ac uid y-$r nnrihr.tTri^b mat u*r arho* hjnyy fEwlurdd- _ ^ ,. , , 

«Td 1 s. PauindAnid jpeihnuBirtini ni-avlrKKLi, pui AngbyAeOino, )'. to render unoommoa; to 
(TTinnierwrd c( i fjnj jTi rhyfiildul iV diyilnld m-f. make unusual or infrcauent. 

/>!-. JuA" /((««.■ Ujlry Ki*. 1. 1, tl. , , „ ,. , ^ , 

ownarth Du., ™ y. «««ld diwcddaf. rai pcthau i«d Anghyffiredinol, ... not um^ersal or general ; 
rejmi n-jij j./j( I wyrthiau J- hrif miirvi. infrequent. 

Cimri'i ABuvinJ..- fluii. y FTrdd, MS. ; Doniau ffii ;irr-i,;nuri, 
Uac hvnj- fyn ^r^h;f,h,f^, oiijd yw ni.irilj/v/MMt* i KhagiirimUj lu'laclli i'w luwi. _ 

T TVti>iliiliarthaD i>ylwnldnl ydTDl o ddaa rath, naill u 
Kiii,i.ji'.j I'.jujiaav Ymaffer Duvioldcb, 19. 
: Anghyfik«du)oldeb, lam.non-univeraality; 
■— fir.^. Angbyffrediaolder, , uncommonnesa ; in- 

Anghyfiblybioetbol, a. without comparison , Anghyffrodinolrwydd, J freqni-ncy. 

or similitude ; incomparable. Angbyffredol, u. inoompreheii ive ; incompre- 

Angbyffelybrwydd, am. disBiniilitude, dislike- , hcusible. 
ncss, want of n^semblance ; unlikeliness; im- ' .^Qgbyttt) 
proUbility. Angbyflkuw 

iTochplwth. wMh ymsrfw *> dnwll hon. mi ni-,h;f.igi<- stillneas 

rti/.WdnwfyflrfybrwJddrj-dweildaTtl; mrt-yspf dywi-Jiii I " ^^ ^ 

ryw nn. Mae y Unr yo r'TfMlh - aii([liyffpljb ydoedd. N i» itrlUr cylTtaw onid o amyen wrti aniRfii ; ac oair**- 

Hrart t\rri. EgX. Ftt. lii. (cf. il*. 1.) jf™"- a e<Mt o rjit KTlh ryw. 

Anghyflblybua, a. unlike ; unlikely ; diaaimi- ^aghjitro, 1 a. witho^^motiw, moto£'; 

lar; improbablo. Angbyffraw, j immovable; stationary. 

Alighym«a, o. incomprehensible; mcompre- n . * ■ vi ji 

^^nded. A. a nyftj(ff'Ti, unmovable goods or property, 

Ny mawl in tysh«t Aoghyf&otul, -au. xn. want of motion ; a 

Dy«twt affij^n-i.— TaiiMiB ,• A.B. u. 173. ceasing ot motion ; quietnees. 

md;i^il?™i'"4;uf4''^ ^ ^^ Anghyffroadwy, u. immoyable. 

AngllyfiWtawl, a. unmoving; not exciting; 
unaffecttag. 



AngllyAlybi&d, -au. »m. a, rendering c 



m ^unel kellueii coU nytj/r. 



■y^iB. M.A.i.H9. unaffecttag. 



ANOHVFFtlOEDia 1 

AaghyffirdMlig, a. unmoTed, unaffected, urn- 
excited : unsctuated ; immOTable ; uiutirred. 

Da anghyffrdedig, immovable goods. 

Pw7 bjrnnag ■ mel a£« Irldu d ban. nau a etif-dd, un 
ddA vjUnifi^g, npu aiiffligfrHfiiig, megyft tir a dai&r, tra fa 
nub o lewB pBimir Wwydd w ddep, nen ddyn mcddw, neo 
ddfn claf, bf Buf ocb rbyv uaddiffrn yn ni herbrn, 

TriBtddCufraM: M.A. iil.M9. 

Anghythrrdd, o. not touching, incontigaoua.; 

Augbyngel, -ion, am. a monster. 

Odydidlivitiaford^ionf-phl . . .DlwdoBtlorbjrtptbwn 
^yntu A odeurch dnrj a^lini yna ewTniiuiedic ank^grl, 
rwn ugbeoTil. yg^d a>a !— Ami Or. ai AriSaT: M.A. ii. &5. 

Ao DT TOTil » ^tley pwj* tt iij»yy*ri hnnnn T«d« ■ 
wDAetb « chTrchn poi goi-wchd urtw. 

SrnI Sr. db AtHih': H.A. U. 114. 

Angbynghaui, a. without beauty or embelliHh- 
ment; monatroua, vast. 
Uywdyn t^Twyn toryf <»J%J"j^in- 
Biea'r jgwyr a« ^orea bachea bfchdn. 

Prydein aagti^figtia ua gTOgu galon 
Ef golofyn teyraaa. 

Lijfvnrrh ab Llfwetffn: H.A. 1. 003- 

Angbynglian, a. without oouBonAnoe, melody, 
or harmony ; dissonant. 

AogbyngliEiiiedd, -ion, -au, mt. want of har- 
mony or consonance ; disconsonance, diacord, 

Angbynghaneddiad, -au, im. a being without 
consononcy. 

Angbynghaneddol, a. inharmonious, uncon- 
sonant ; without alliteration. 

AngbyngbawB, a. without dispute. 

Aagbynghawaaetb, -au, »/. a being without 
dispute or contention. 

Angb^ghlo, a. without conclusion ; uncon- 

duaive; unconnected. 

Hewn eypg lu a e dd dnn, j cynemiald angA^taMo, a to 

ra ooUi, rhua «u bwrw rhwik^ v rhaf ddivn a'r udt-ddAm. 

Or. ftnfcrij. Oram, aeeicf.waj. 

Anghyng'hload, -au, sm, want of conclusion ; 
inconcl uai veness . 

An^hjmghloawl, n. inconclusive. 

Ai^hyughor, -ion, am. what is contrary to 
advice or counsel ; dissuation ; infatuation, 
madness, folly ; distraction ; perplexity. 

Te beb >T ArtbuF ynf dj/bjnt^flr y moe.— JfaAJitPyior^, Ii. Afi. 
Sjt acEh j-no dyn eiryoel ac tinijhyR-jhor amaw. 
A bynny ynllya Eu^d Hen y ^wiuctb o agh'j^hor. 

At yn aitghyngkor y tri hyn ydd aeib ef yn y (*ftd Gam- 

buk - - - ac fMAam byny o angkgnyhor J oMer. cf ei fywyd. 

Marchofjion Lt^i ArlAar [Urytbon, il. A0]. 

Angbynghoradw}r, a. unadvisablc. 

Ang'hyTighoiaTl, a. dehortatory, dissuasive; 
unadTisable. 

AnghTiighordiad, -au, am, discordance, dis- 
sonance. 

AngbTS^bordiol, a. discordant, dissonant. 

AnghyngboredigTwydd, am, unadvisednees. 

Angbyngborfyiuiiu, a. unenvious; not dis- 
posed to be contentious or quarrelsome. 

Anghyn^borfynt, a. free from envy ; without 
contention or quarrelling. 

Au^hyngbori, v. to dissuade, to dehort ; to ad- 
vise to the contrary. 
A'ttifHgliari neb rtug entrio i fnebedd grofyddol. 

jliiMdd FariulKsi, as. 



AiraHYEOESDOS 

Augbjmghoriad, -au, nn. debortatioii, dis> 

suasion ; a being unadvised. 
Angbyngtaonu, a. inconaideiBte ; infatnatod, 

demented, foolish; unadvisable. 

A cberdat agligfkofvt tiunn yw bmin.— JfuMMviox. 11. M. 

Ac yna pwedy dybot nat yttoed y brenhln yny Uu. wf 
awnAdibaat yn nffhughona ytnlad ar mim«d a cbe i Maw 
dlgtryw y kaalell. 

Bnit Or. a» ArUlur (B) : H.A. U. MS (rsf. IM). 

Nyt bamadwT yn Tolyant. beb y paffan. namyn yn 
aftjlfhimii drudanyaetb ymtodl beb oisiryl y lauoryvn 
gonood.— Cawipau OhatlymaeH, |SQ- 

AngbTSghrair, a. without compact, oath, or 

covenant. 
Angbynghyd, □. nou-united; not connected 

with or joined to anything else. 

Ac o'r nwyfre, yn vi firdduiiiaDt yn anghgngltjid t pbob 
amf^D y mae Duw. — Barddat, 1- 3^. 



oddi wrtb eu pertbyi 
rhai anffhgngl^m De — 

Angbynglyniad, -au, tm. want of junction, 

union, or oombiiiation; disjuocdon. 
Angbyngreddf, a. without instinct; not in- 

stmctive ; witlkout principle. 
Auf byngrea, a. not participating in ; not 
blended or mixed together; uncombiued. 
Am bi bamodyd o tiglif/gng dien 
I>y(if;ogan fywtdydyon 
TgwlatypollBdieyiin. 
Dydf^ofran d^TTiydon 

Ttn mor tra Brython.— TaiiaiH : A.B. U. 210. 
AngbyngrwaBg, u, without compression ; re- 

sisting compression ; incompressible. 
Angbyngwaagadwy, a. incompreasible. 
Angbsmgwaagiad, -au, am. non-compression. 
Angtayngwedd, a. inconsistent; incompatible : 
incongruous; contradictious. 
Ta lie ymoitKng- i fam y taib rnirdly* Fttbilonaidd a'r 
^yn^refl iHghungirtdd ucbod, dcuaf yn ^mnliiTyB at yr uolg 
awdurdod a ddylid ei i^yCaddef ym mbob dadl grefyddol. 

AngfaTs^weddiad, -au, im. disagreement; in- 
congruity, inconsistence. 

AjtgkgngartdditBt bnchedd y meddw 1 chyfrnith "i wlad. 

Angbyngweddol, 1 a. not agreeing ; incon- 

Anghyngweddus, ) sistent, incongruous; con- 
tradictory. 

Angbyngweddoldeb, am. a state of disngrci'- 
ment ; incongruity, inconsist«nGc. 

Angbyngyd, a, without delay; indilatory. 

Angtajmgyd, am. froedom from delay or pro- 
crastination. 

Anghyngydiad, -au, am. a ceasing to delay or 
procrastinate. 

Anghyngydiol, a. without delay; free from 
procrastination. 

Anghyha&l, a. dissimihu', unlike. 

Aoghyhoedd, a. impublic ; private. 

"^wy baelinii inghfho9dd y BETfydtvyd yr y^olion I'r 
Ua«d yng NRhymni. 

Adnidiitd Dirpntgwi/r AdAgig (IMS), ill, cyf. S. 

Angbyboeddog, a. nnpublic ; unpublished : 



,)glc 



Amohtbobiidol 1 

Amgbyhoeddol, u. unpubljc; unpabliehed. 

Aji^hyhoeddna, a. not public; privBte. 
An^hyhuddadiry, a. not accusable. 
Anghyhuddedig, a, unaccused, 
AngbylmddiKd, -au, »ni. freedom from accuBB- 

An^hyhuddol, u. not accusing; unaccused. 
Anghyhf d, a. of unequal length ; unequal. 
An^hyliydedd, tm. iuoquality of len^h. 
Angifyhyrog, u. not muscular or brawny. 
Anghyhyrol, n. not musculous or brawny. 
DerfyiJd pi tniA-wd ef M on'! ffwelLr, &c yn atttfHffJtf.-avl 

Ang'hylchaidd, a. not spbericol or circular. 

Aji^hylched, I -au. am. want o( drctdarity 

An^hytcbedd, j or rotundity. 

Angbylchedig, a. not compasaed. encircled, or 
surrounded. 

Angbylchog, a. having no drdee ; uncircular. 

Anghylcliyii, -au, tin. what is not a cycle, 
cinJe, or compass. 

AnghylchjniAdig, «. not encompassed or sur- 
rounded; not revolving, 

Anghylchymad, -au, im. a being uncircular; 
a rendering or making uncircular. 

Angbylchynol, a. uncircumscribed ; not sur- 
rounding or enctrcling ; not periodical. 

An^hylchynu {yn), v, not to circumscribe; to 
render uncircular. 

Anghylua, a. free from fault or blame ; faultless ; 
irrepreh ensible. 

Anghyluarwydd, «m. faultlessness ; irtepre- 
hensibility. 

Anghymdeith&idd, a. of an unsocial dispori- 
tion; nnsodable. 

Aik^byiudeithaa, -au, t/. unsociablencss. 

Anghymdeithaagar, a. unsocial, unsociable; 
not fond of society, 

Anghymdeithaagarwch, sm. unsociableness. 

Anghymdeithaaol, u. unsociable ; unneigb- 
bourly. 

Anghymdeitbgar, n. unsociable. 

Angbymdeithgarwch, »m. unsociableneits. 

Anghymbar, u. without a fellow or equal ; 
matchless, peerless ; incomparable ; eccentric 

Oct yg oet agheu inisnlia', 

IJg'i^li -b l.ls<"ta'-- M-A. i. 296, 
Caisu', iiigh^rnhar yng iwh&d, 
A'i br»«rchAi & brocoiiMr. 

IiiMK Bradadd Hir: OwB^t^^ 64, 

Anghymhariad, -au, tm. non -comparison. 

Aiighymb&ria«tb, -au,*/. want of comparison; 
incomparableness ; disparity. 

Angbymbaral, a. incomparable; without com- 
parison; unequalled. 

T riirfeddod mwynt s berthyn iddynt. f nertb angiif- 
■uMro', ft bnJdd ui^hifidAdvy, ttgwm jt tn a't duuiaiJa. 



AirOBTMHUTBIAD 



Urrjrriwn Innau yoo « yr olnrfu infliftAarol. 

Et fltil angiym^^raid.^l. G. r/'irionjiU : 0«ir. 14S. 

Angbymbaru, i'. to dispair; to separate a 

Aogbymbarua, a. unequally joined, connected, 
or paired ; unsuited ; unmatched. 

Nh. iftuer chwi yn anffk^mixitruf ^yd l> rhu divred. 



Angb; 



lUeTor 



ri, tm. freedom from contention, 
perturbation. 
Angbymbell, a. without compulsion or pres- 
sing; unconstrained. 
Aagbymhellawl, a. not compulsive or indu- 
cing; without constraint. 
Asgbymhelledig, a. uncompelled; not forced 
or pressed ; spontaneous. 
A't butld a f^dro ya hullol oi rheoUu , , - h tjiiA djgoa 
dl^llrd am bnb petb ftnll. cm bydd gmuddo Awea uiiuiiil 

Angbymbelliad, -au, am. non-compulsion ; 

non -induccmcut. 
Angbymban, a. not neat ; untidy ; inelegant ; 

slovenly ; inetoquent ; uncomplete. 
Tri melb Llrnrcta tri a<.«Avii>«ni aid 
Tri dieimiul [«l. rbrnani uvUtpd 
Uct EC Amu K Uriro. -£'»«■« ^ Hrn: M.A. i. US. 
.iigAyntJKx pob Bui.— iHarrt. (H.A. Ui. 141.) 
Na do«tb pob arejtit^u', nid ffol pob tmffti^mAtn. 



Nyni H velwu tnvpruedd • ynudnKlduit yn 
inwn, hcb r«drjd rhoj fli raflddw] mewn TEvnfoi huuier 
di ; ac ercill, jug nifwribwjneb. yo Tugriienn en meddwl 
yn odid»wK, ac yn parablu yn tn^liffmAfTi. 

•■- -< ftrri: Egl. Pfr. ll». ?. 

berileiUiiodd dy cwyUyi 
ll'r. THoova /Vv-l : Cerbyd lechjrdwTiulh, 11 . 
Angbymbendod, -au, em. 1. inelegance; un- 
tidiness; disorder. — S.W. '2. insolence, im- 
pudence, impertinence. 
A chyuot ti odyna y wn<?uthur [awn yrni amdy -iskeniArn- 

Bell ae dehoLaKt et o yny* t^rydf^ mnrn y rmrawf^. ■« 

Anghymbeniad, -au, sm. a rendering inele- 
gant or untidy. 
Angbymbenrwydd, em. inelegancy ; untidi- 

Angbymbenua (c), a. inelegant. 

Habwifiic mwy yd ITeic fennedic rvyt ta wen 
No pharabyl oe pben aa%niAripncv(. 

ff^Mf aJ Ou.ai„ <Jws..,dJt M.A. i. «(i. 

Angbymbercben, a. not mutually or recipro- 
cslly possessivo ; independently possessing. 

Uaa bath bjaII ar raghntw pfrrchfnofraw], a fydd bob 
amaer ar ej b«a «i bun heb ryfcUUkich rbsghenw arall i 
. y rhafn a slwir ai«]iywpith»a. 



la obydberohfla<igiui( 1 



mplicatcMl ; 






Angb^imbleth, a. incompl 
not intricate ; simple, 

0*n fad yn nnigryw a neilldool, ac anghgaikteih, uj 
angbyfran, y brif-anaawdd amynt. 

Offrinach g Brirdd, 7fl |cl. 71) . 

Angbymhlitb, a. nnintermiied, unmingled, 

unblended. 
Angbymblitbiad, -au. em. a being un mingled. 



Ang'hyiiililyg, a, incomplicated, iuoomplex; 
Dot folded or twisted togetber; gimple. 

Aughsrmliortb, nn. non-aupport; lack ot as- 
sistance. 

AnglLymhorthi, v. to deprive of help, succour, 
or support ; to cease supporting. 

Angrhymliortliol. 1 a. unaadsting ; not con- 

AnghTinliortliiu, ) trilmtory . 

Anghjrmliwjrll, a. without reason ; devoid of 
rationalitj ; irrational. 

AnghjrmlixryU, -ion, »m. want of reason ; 
irrationaUtj. 

AngliymhwyllUd, -an, #m. want of ratio- 
cination. 

Anghymhivylliaeth, -an, if. irrationality. 

AngbymhwyUa, v. to render irrational or 



Aughymhwyllog, ) a. Irrational; devoid of 
Anghymhwyllna, j reasoning power. 
Anghymliwya, a. not fit, snitable, or proper; 

unfit, unbefitting, unbecoming, unsuitable ; 

iiDproper; unqu^fied. 

Mft« e'n amUiau u jn un]f^ pechodna, ac a wiu ddyn 
yn anyk^mhvgn i fod ii»e fa ^yfAill oeilldtiot nao n> 
fTDKboniT cyffrediDol.— £iu Wran: Rh. B. S. U.a (SS). 
A Selyl 'Bcj^ll born lywcdytyon 
BuiiiwHl>nv dew donrtm anykgmegs 
Asft^TinhH Teibyon. 

lAfKaTrkabUfKtl^: U.A. i. SS3. 
Am Itynr dHf A^iaAic^d sc tumoetli T mafnt hwy yo brfn 
tg pnliaii.— Xi>irfi Lttcgi ; Llwybr Byff . iU4. 

Hi djbtaia oad angks^idttcpM I mi . . ■ pyminerTd c«iiiud 
tag goiTch oil, cyn fy nghydkwyn. — Oroiwy Omiq, B^, 
lio allaD yr unier 7 dygpwjd 



Anghyinh-wyadet, 
Angfaymhwyadra, [ ableneas; impro- 

Angbymliwyaedd, -au, ,1 priety; inconve- 
nience ; disQiialification. 
I odiet rb&l angkgmhw^sdtTau, yr jIn nf TT AWT hoD yn 
brrhAD. . ,yddfiii-fl>hy]i]rh>'d]rn wrtbnlwmodarhuguD. 

Y mac prawf nChrcdig yn dAn^us, dyfu o omtyviol 
B«^jfj]tAif|rsilerrTb. — L/g/rQiofddi Oyfrtdin (Rhug.J. 

Mewn wdbonon ereill nid ydym bytb ya ei dy bied yu fawr 
i d di od drf rhyw anghgr^vtfbief yn brenmiio). 

/lu. ronu*; Bnch. Grin. Ml. 

Asghymhivysiad, -au, tm. a disqualifying; 

disqualification ; non-application. 
AnghymliwTBO, 0. 1. to render unfit, iinsuit- 

able, or improper ; to unfit ; to disqualify. 

Efe A fydd doeddol o ediych droa «i llUirudftu ei bun, ac 
fdly d aHfhfiitJlvifW n bun go^yfer I grwneyd dim i^- 
Bjdd jm mliellacli.— /oiiia TIhium; Bucb, ariit. *7. 

Drlai y lavl a fcmir yn anKhyinmedral gui yr eglwrs. 
bandetfian mai pleldguvch 3yn fddo ti bun a'i haagkn. 
mJiwptoid cf AT y cyntaf i faruu yn gywlr yn ei afib« d 

2. to depart from equilibrium; to become ob- 
lique; to incline. 

Ac fdly^r ddiUaf yn fynyob yn CAd «i rvaffhsu i 
*-"' '" -^ ---ydbwyriad r- •- "- 



iv|r*D. ond yn «nwedi^al ei thnion, Pe 
J o bffwydd on rhyVbetb, ni byddai di 



iiBjitt i'-w ddiigwyi.—Di'/iild tanif'- Oolwg, irii. 8. 
Anghymhwyaol, a. ^squalifying. 
Aaghynuaaint, a. not of equal size or bulk; 
unequal in size or magnitude ; not so large. 
Ond autirnntaiiii, nn yn rmd, 
T Uall yn ODghlau, nu cydwedda ddim 
YnwiwagimnuanU.— IT. O. Pughi: C.G. Tiil, «0. 



AngiliTininal, a. jointless, without a joint ; 

unjointed. 
Ajagbynun&ledig, u. having no joint; dis> 

jointed. 
Aughjnninftlog, a. having no joint, jointless. 
AnghTinmalu, v, to disjoint, 

Y ma« hyd yn oed ei ffurf a'i EwncuUinriad . , <m Ai. 

odder mi* h — — — ' — - —•• — •- — -■ '- 



Aagh7mmaluji,a, not well joist^d; ill-jointed: 
disjointed. 

Tstyr y ^ewynan anystwyth hyny y dium^dd nmthioni 
aitfikymmiaiut ""^"^ yr ft^ym a'r rhAdwellau. 

(irisffadd H'jnn/ Ystyriaethan, 80. 

Anghymman, a. incomplete; broken; imtidy. 

Ajyf angltyunull agk^maa dull agkyflgog^t. 

Aryt agcynnnl o^ynuii dnl.— Tajierin ; U.A. i. 21. 

Cael cynuDftT dyfriar dvyfron ditf t^mnaJi. 

KaAii Dicygrai): H.A, i.(86, 

YtgutydawT anghymman, broken or shattered 
shields. 

Aehubymt eng gawT fd^vpildi'rr on^^nvH. 

AmfuT,: Ood. 830. 

Cf> ' Ysgwjdawr angkyuon.' — Ood. 45. 
Aii ^>iymTilwtll| a. dissinular, unlike ; unassi- 

milated. 
Anghymmodiw, a. unoompUmentary. 
Anghymmedr, a, without proportion; inor- 

duiate ; without order ; irrational ; devoid of 

insight. 
Angbynunedr, -on, «ni. disproportion. 
An^bymmedrol, a. immoderato; excessive; 

intemperate; tnconunensurate. 

Bfaoddaifl iddo betb yn bvn, yr byn fydd Iddo yn fa^, 
caoyi ef9 a fydd yn fwy aooA^wmoirol. 

Ch. Sduardi: Han. y Ftydd, 164. 

Owmtwar yw Mlhweiina lairenydt dnry dliy^uairc dhi- 
grifmh dhfcjmtfnnr^ y dronygu aialh. 

arfer a ddiod. 



ADghTiainedrolaetb, au, »f. immoderation. 

tHalwn y gwacd helacth oUynoodd 

Uaw aitfhs<Kmedrolarlli.—SBh<» Ok™, OireiUl. 108. 

Anghymmedroldeb, i tm. immoderateness, 
AngbTTOinedrolder, | immoderation; intem- 
Asghjrmsiedroledd, ) peranoe; excess; in- 

O^r tu mewn y maent yn Uawn o drawaedd ac angk§vi- 



YwioTlk tr Emul,\9. 
Ffydd, pjbaith. a dtaiiad, dyns'r tattn gottra i ymladd 
yn erbyn anghttmrnedrot^tr. 

EUt Wgiat: Bll. B. 8. U. 1 (S8). 

Anghymmedroli, v. to become immoderate or 

intemperate. 
Angbymmedroliftd, -au, am. a rendering or 

becoming immoderate. 



disorderiy 
An^bTmmadru, v. to disproportion. 
Anghymmeidrol, a. diaproportioiial. 
AiigbTmmeidroliwtb, -au. tf. 



,,Ct>(-i'^lc 



Ahohtuueinio 1: 

Aaghjrmmemio, i-. [aughymmaiiit] to nuke 
unequal as to aize or msgnltude. 

AnglkTmrneiniog, n. unequal in size or bulk. 

AngllTmmeradwf, a. unacceptable ; unap- 
proved. 

Dniion o IwHwl Dreredte, yn mghsimmrTailKii o nn y 
Itydd.-a Tim. in. 8. 



Aaghymmeradityo, v. to disapprove ; 

make unacceptable ; to dispraiBe. 



Anshynunerad-vyol, a, disapproving, disap- 
e that diB- 



probatory. 
AiLghyTiuDerftdwywTf wyt, 

approves. 
Anghymmeriad, -au, >m. 

non-approval ; disfavour, diseateem. 

V vuie llHWer □ ddrniuA Arva . . . fe FAdruit ymgadT u 
ynuttkl rbajir ttvneuthur pvchudau ma»fu8, o hoirydd rhyv 

rhai rha^ rj09podigrniQi.^Bob, Lt^jid: Llirybr Hyff. n. 

Angrhynuueriadol, a. being unacceptable ; 
being in disfavour. 

Angbymmeri&oth, -au, */. disestimation ; dis- 
favour; unacceptableness. 

Angbjrmmerol, a. not taking or accepting; 
unacceptable. 

Anghymmea, a. without mediocrity; not or- 
dinaty; extraordinary; vast. 

GftlwetawT yr ache* 

Ar eOic aghyttn.^Taliain: A.B. U. 16t (cf. 131). 

u's^. a* L!yiccli,n: M.A. i. 3M (cf, 888). 
Kyn ysgar Uew Ukolur lluchwrefl 
At alou nfi al anp %mA«. 

Uyv. aft /.Ivuv'sn.' U.A. i. 1S4. 

AngliTmineaur, a. incommensurate ; incon- 
tinent ; immoderate ; unsuitable, unfitting, 
unbecoming; improper. 

J;tj/niuMii--cartkcrt«uuU», -C^'fflr/ir: M.A.I, eie. 

Tri pheth da pao f Ont yn ntomeimr, a drw^ pan f Ant yn 

WmtWan creiU pr cnddin a thewi t Borthedd m chnKWl- 
aeth. nea ynudrodd buatludd. din^A^mm'jrir. 

fiydddynloa. . . ynenllibaJdd, yo irnoA^mm^fur. yn an- 
fwyb. ya ddiBOnh I'r rhaj da. — i Tim. £ii. Z. 



Di ym y BaiMtBidd 



ni oddl WTthym ! 



Anghymmeaoradwy, a. incommenaurable. 
AngbynuneBUrad-vyaetb, -au, «/. incommen- 
surability. 
Yr aohoB o'r cylohau sydd mewn uferiad ^tn aftbrmom- 
yddion yw, yr aitghgnrntmradaiiatlh a; ddrtiRDg oylohdniad 
ymdddAnffoaiodol yr haul. aV bodau irybrenol erelLl, a'u 
gUydi.—D. Prltr: Han. C?™f. *7. 

AnghjrmmeBuradwyo, v. to make inoommen- 

Burable. 
AnghjrmmeBuradwyol, a. incommensurate. 



ANOurHHBEINIAD 



Angbymmeauraeth, ) -au, gf. disproportion; 

AngrbymsiAauriBetb, ) incommensurabibty. 

Anghymmeauriad, -au, em. adispropoiidoning. 

AughymmeBuro, v. to make or render incom- 
mensurable ; to disproportion. 

Anghymmesiirol, a. dispropoTtional ; inoom- 
mensurate ; incongruous. 

Angbymmeauroldeb, tin. diaproportionality ; 
inconercnce. 

Fc wrddai i'r arfi thrdd fyf yriu ac wofi l«>?dd. mymryiuiu, 
' ' ISa-fli-ily-M, iii. 144. 

Angliymmeaurwydd (u), «m. incommensura- 
blencsB ; disproportionatoness ; unsuitablc- 

neas ; intern jxiraten ess. 

Anghymmid, rt. without conflict. 
Anghynunig, a. uumalidous. — P. 
Angbymmod, am. disagreement, discord. 



ffwlad a pjrwlad, sef Ite nid ohi raitli amyat. ac wynt yn 
amg^fjmmod ; ae e .tn>]j-f^ a eanillo frwjdr a gorfod ym 
mlJaid q«ned1 y C'ymry. — Barddftg, U. 90. 

Angbynunod, a. without agreement or con- 
cord ; being at variance. 
Ai^hymmodadwy, a. irreconoilable ; inpla- 

.Ajxgbynunodi, I v. to cause disagreement or 

Angbymmod, ) discord ; not to agree ; t4> dia- 

agree ; to differ. 



gan ddyved] 



thwy i I 



iireconcilabla ; impla- 

LiDod. yn anvhandiR', yn 
ion.-RAH/T. SI. 
Flyn amghgmmadhn J nator 

mdliating; 



Angbymmodiad, -av 

Angbymmodlawn, t 

cable; inexorable. 

Yn ■nnnllui. vn dnnr 



ddynol- — Brulut : 
Angbymmodol, a. disagreeing; u 
at variance ; implacable. 

Tthaid i'r gvr hwn tod o natiir giatdd dx^jbymsux^ & 
DBrao'a anhynawa foddi^u i'w frynunydq^. 

ft/icon* Samurl : AlhiBK. yr Bglwya. M. 
Anghynimodlondeb, \ «ni. irreconcilable - 
Anghymmodlonedd, j ness ; implacable- 
Angbynimodlonrwydd, ) ness. 
AnghymmodlonwT, wyr, am. an implacable 

person. 
Angbymmodoldeb, im. the state of being un- 

coMciliiiting ; implaeabibty. 
Angbynunon, «. nnstablo, unfirm; shattered. 

Yn Aber y Don perJtor rad 

A fbaly^ti u„l/l,ymmi>n.— Hirudin; il.A.1.19: 

iDTnnjdiLOD gan dull nffMmai.—A.S. ii. 9. 

Asghynimonedd («), sm. instabibty; unfirm- 

Anghymmoni, v. to render unstable, uaflrm. 

or unpermanent. 
Anghymmoniad, -an, im. a making unstable. 
Angbymmraiat, a. not having equal privile^- 

Angbymmreiniad, -au. im. a rendering un- 
privileged or of unt>qual privilege. 



,.A^.(,K»t;ie 



Anohtumseimio 



AuglLymnminio, c to deprive o( privilege ; Anffbyiora, ry, em. one who ia not a Welsh- 
to render imoqual as to privilego. I man ; an alien (&om a Welsbman's point of 

Anphymmreiniol, a. of unequal privilege; 
not equal or sinular as to privOege. 

Anghymmri, a. not of equal honour or dignity. 

Anghyiuinrlo, v. to render of less esteem or 



dignity. 

An^hymmrtol, a. of less eatoem, honour, oi 
dignity. 

Anghynunrodedd, tm. irreconviliation. 

Asghymmrocteddiad, -au, tm. nun-reconcilia- 
tion ; a being without reoonciLation. 

Angbymmrodeddol, a. irrcconeilable. 

AngbyiQinwTiia*, -au, cf. unldndncss; die- 
IdnimeBB ; disobligement ; incouTonienoe ; an 
unkind or discourtaoua act. 

Hvy A WTkADt ingh^mTniT'jTv^ it ad^affwydd i'w irjrm- 
m jdog cfD g7n(«d a'r tjotal. 

Koi. lAnsd! Uwybr HtA. H. 
O iiQ^dy«eth kytnndtb nni f^Avmc^JtHU j gut b«r- 



A deddf oodd iddo j gummeddLd i bob ilir" ddya 
M- ddj'iTpdyd ffuLr ar ua aphop f wliid bc oglwys ba 
bynun^, oa tiL" ureiljd both a dnyvedBi byimiur 
ddyn H frnddyi^ }-n dmhau^-falch ■ ■ - i ddyn 
btodurui o^trua, ui tor AigclTn.aL Qy. 



?^yd" 

not cloudy, cloudless, un- 



Tri pheth y dylAi bub djm Bon am donynt yn w&haaol 

-■ jcir, B« am a ffoffo ^n gTnuDvyDAa ; ychydiu'at 

-- - ^Bo^Jl iHg*tyntii"cifiin9 : a dim am a wni'l. 



Xid aU oe 



I Anghymylog, 
I clouded. 

Cn fflora aughsm/j'i^g, ua ffrrd o HKoniant, 
I A Icinw dy fyeoedd. -Ih^hIhu Jfi^n'^r, 4. 

I Aoyhymyraath {$}, s/. ) -au, a being without 

Ang'bymyredd (y), sni. j esteem or repute ; uii- 
aeuuptablcness. 

Angbymyreddol, ) n. unassuming ; without 

Angbymyreddua, j assumption or arroganci'. 

Augbyndyn, <i. not obstinate or stubborn. 

Ang'hyndyniog, in. free from obstinacy; not 

Anghyndyniol, } stubborn or obstinate. 

Anghyndynrwydd, »m. freedom from obsti- 
nacy or Ntuhbomuess. 

Anghynddryehol, «. not present, absent; un- 
represented. 

Angbynddrycboldeb, tm, absence ; the state 
of not being represented. 

Angbynddrygedd, ani. inoffensivoness ; honii- 
lessnesa. 



igef.— £rf. SaaatI; Atbraw. ji Eglwya, 
Angh^mmnynoagar, a. disobliging, 

hU^ng; unaccommodating; unkind. 
Anghynunwynasgarwch, em. disobligi] 
want of readiness to please, help, 
modate ; unkindness. 
Anghyuunvynaool, a. disobliging; 

modstiDg. 
Anghynmydog, -ton, am. one that is not a 

neigbbour. 
Angbynunydogaeth, -au, i/. non-vicimty. 
Aaghynunydogol, a, unneighbourly. 
Anghymmya, a. intestate; without a wiU or j Anghynhebyg, a. dissimilar, unlike. 

Angtaynbebygiwtb, -an, «/. dissimilitude. 
Angta3mhebygol, <i. unlike, diRsimilar. 
r distinct; unconfusedl ' ' . Angbynbenid {&), ii. not natural, unnatural 

Vitld jmr boa wok o otalou a Uawn n weddSau ; yatid ! uncongenial. 

..,*,..«.« tT byd. .ithr gjgnjth™,^!!™ s Daw.^ ^ ^^^ , inghynhonllyd, «. not contentious or quarrel 
Anghymiayagedig, a. not mingled or mixed, some; without stnfe. 



' Angbynddrygol, a. inofiensiTe ; harmless. 
r accom- Angbynddyledd (^], sin. non-persuasivciiCBS. 
' Angbynflgenol, 1 a. notenvyiu) 
I Augbynfigenus, ) unenvied. 
I Angbynill, -od, tm.=A>u]htnjil. 
Id ni ch^r Duw a Bnra ea 
aofki/njU; a gWed rbnd 



Mf^ys ydh jmdhangnfnw^ 



Angbynuuynol (,^), a. intestate. 
Angbyminyag, u. unmixed, unmingled ; sepa- I ' 



unmixed. 
AnghymmyBgedd, am. the state of boir 

mixed or unmingled. 
Angbymmysgol, a. unmingled. 
Angbymraeg, a/, what is not Welsh; 



I Anghynbenwr, wyr, am. 



rect Welsh. 



I o'r ddwy 



Dt/si. 



AnghymreiK, a. that is not Welsh; unlike 

Welsh. 
Angbymreigoiddj a. not like Welsh; not 

Welsb-like ; foreign to Welsh as to character 

CrmmBg tnghpiir^ii4d^ Wirt ei anferthed. 

17 M<, U..^..«'^s. 



uncont«ntious 

Anghynbea, a. not warm; cold, chilly; uu- 
cheery. cheerless; uncomfortable; unpleasant. 

Aiuawo ttnmmawe toiyt itglLg,mhn. 

Ce-l-lri,c: M.A.f.iJl«. 
" A-i/fistnArfi pob OCT. — IHnr'h, (M.A. iii. 147.) 
A-^nhfA', ddiawlea ddileddf. 



T look. 



iglc 



Akohynhesbwtdj) 1 

Anghynhearwydd, im. want of warmth ; im- 

cbeerfulueB8, cheerlessneBe. 
AngbyiiliMu, V. to make cold ; to render cheer- 

AnffhynliTTfbl, 'i a. without tiunnlt or distur- 
AnghTohyrflol, [bancs ; untiunultuoua ; vui' 
AngbTnhyrftu, ) disturbing ; tranquil ; uu- 

affecting. 
Anghjmnar, a. not eaxly ; not forward ; late. 
AaghynnaTedd, ) rm. want of earlineM ; Iat«- 
An^hynnarwch, ) ness. 
Au^hynneddf, -au, «/. «'ant of qualiflcatian : 

duqusMoation. 

•in : gminea u -wyboiioM ; nitiieb gwir ; ■ gr*l^Uiljidd 
heddireh ■ Uuugnef .— AinMu, &. BS. 

Angh.7naeddfol, a. unqualified; disqualifying. 
AnghTnneddflad, -nu, em. disqnalificataon. 
AnghTnnefln, a. 1. unuoual, uncommon; tmac- 
ciistomed; unused; unaoquointod; unftuniliar- 

Or d«i]a djn ya^nibl anfJignifJIn mr d yd iwu bt eJ nlr, 
u rmUdd 0*1 yignibl yn t ^nntuw. & lluld a Iwdn j 
lUU, pflnhenaw^ jr yigmbl buD dalu 7 Uwda n UddCT. 



Fob on a'r ardd Tp yniuf^r i llaatli, vrdd mf Ajtm^n tf 
giir cyflnrada-.— Hrf. v. 13. 
lUiTtedd pob ni^itriv/N.— H.A. ill. 111. 

2. strange ; not familiar ; unusual. 

Fe irdd orphwTefi 1 mlltad blln 
Mewn anghfi'ttjli ddlniu.— Onmiif OhIk, lU. 
Tir atigkynnejm, a strange land. 

Ob djKyydd fod cod dju nch ^mr, obwl a goddmh jn 
tuui txair anffAynnefiit. — BrylAon^h. 191. 

Gair anghynnefin, an unumial, uncommon, or 

Strange word. 

AnghyniLefindAr, \ »m. unusualneBa; uncns- 

Angbynneflndra, ' tomarineM ; nnwonted- 

. Anghynneflndod, ) ness; unaoquaiutedness. 

O dygwydd 1 ti, »r y cali pyntaf, gy^pfod 1 pbetb 

angfiyitnffiivi'^ inewn yi^TW 4 dall . . . dmilm dl*r nun 

h«nw drubefa.— Xonw OsSli : Diffynlad, Viitg. 

Angh^nneflniajl, -au, »m. a making or be- 

conung unusual. 
Anghynneflno, v. to disuse ; to be or become 

unaccustomed or unacquunted. 
Anghynneflnol, a. unusual ; unaccustomed ; 

not acquainted. 

Ao, s nyni ya onfod tod Un cyffredln yn dwyn 7 fliUi 
effeitbl&u angh!/v%^not . . . pvy n ddiolion ddyoliynunyv 
" IT lomr-TiTcL, Be mor deg • fydd yr hoi] 



Ajighynnefini~W3rdd, tm-'^Anght/nneJindtr. 
Aughynnefbd, -an, if. non-usage, desuetude; 

uneuBtomarinoBB. — Barddat, ii. 56. 
Anghynnefodig, □, uncustomary; unusual. 
Anghynnif, u. without trouble or molestation. 
Angliyiinifer, a. not of equal or even number. 

Anal'ii'mi/rr badsan 

Ym' a wuueth ban oeddem lab. 

Jnuui fiixM, i-r Pudsna. 
Angbynniferog, ) a. consisting of unequal 
Anghyimiferol, j number ; uneven as to 



jLUghynnil, a. I. nnfmgal, not eoonomicaL 

M«gy< y gwnlnt yr on^ Afiuir ; nf ^mtlia er <di«nK 

g^t, ao dlchwyl pirna tt ptmt. 

Cam Crwnuf (T Onal, IM). 

2. unskilful; inaccurate; nningenious; nnomat«. 

Yr ungMywnila/ a hi a ilaim 7 crnnilaf ; ao tmtkgmsdJM/ 
jw traeUiadTii o'l boll femlM.— f^rnoot y BtiiiJ, 107. 
Angliynnild«b, ^ im. 1. want of economy, 
Anghyonilder, / Uokof thrift; un&ugality. 
Angliynnildra, [ 2. want of skill or dex- 
Anghynnilrwydd, j terity; anskilfnlness; 

lack of omatencsa ; inaccuracy. 
TH plirth a bail ouiii oerddawr : angfaTttirndBb ; trngh/pt- 
nilrv^d ; a goftann d7iilon da- — Vjrv, >iivil. iii. 1V7. 
Anghynnilo, v. to become unfrugal; to cease 

to be economical. 
Anghyimilwch, *m.-=.A<agKynn,ildA. 
Anghynnired, a. without resort ; not resorted 

or resorting to. 
Anghynniwair, a. without resorting or fre- 
quenting; unfrequented. 
Anghynniweiriod, -an, «m. a being witbont 

frequenting ; a non-resorting. 
Anghjmuiweirio, v. to cease to frequent; not 

to resort to. 
Anghynniweiriol, a. not frequenting ; nnfre- 

quented. 
Anghynnorthvy, -on, «Tn. non-support; non- 



Anghynuorthwyad, -au, *m. want of assis- 
tanoe ; a ceasing to aid or support. 

Anghynnorthvyo, v. not to aid, help, or 
assist; to cease to assist or support. 

Anghynnorthvyol, a. nnaiMriafing, iu)t sup- 
porting. 

Aughynnrych, a. not present ; not rtipresented. 

Anghynnrychind, -au, sm. want of represen- 

Anghyniuycbol, ) a. not present; uniepie- 
Anghyiuuycliioi, ) sented. 

idyWl. "'''" 
<7i;/re<lJti» CfVt, 11. BT4. 

Angbynnrycholdeb, } >m. the state of not be- 
Angbyunrychioldnb, ) ing present ; abaence ; 

the condition of not being represented, 
Angbyimrycboli, 1 (1. to deprive of reprosen- 
Anghynnrychioli, j tAtion. 
Angbynnull, a. uncolleoted; scattered. 
Ar7f nngitjpmvU affkyman dull agfcragogo t 
t™ chymfl lawt tiiiigle™yd llawr Lloegrwy* »twBL 

^>c>r4».' Ood. Ml [e(. IfA. L 31). 

Angbynnulledig, a. uncollected, ungatbered. 



Anghynnwya, -ion, tm. want of restraint ; in- 

oontiaence ; a not containing or holding. 
Angbynnwya, a. unrestrained; unoontainod ; 

incontinent ; incompact, 
^ryaimaao aBwaiio oimfT oit filvfHwj. 

CyaAMv.' HjL 1. Ml. 



AsOHYNNWyS 



StlehfTji! banbrl bolcbglet dnd 
Bar dwyi cytFinvi' TK gad. 

PriJfSd Bfdm: II.A. i. MS (cf, Mil. 
YnghvETilt IbdKWK amahfancgi d imt 

Ai durfU u Loe^TWn-— £>■>»••■>•'«■- H^ i. SH. 

AngliTiuLWTa, ) 11. 1. not to oontom or hold; 
AnghyunwTSO, ) aot to comprehend. 

CKyw-aa cnadui 0*7 fmth hrn . . . o elddo Daw yn ui- 
hmol. Hen yn anghannmmvidKt 1 iAjn i pa uHryboduth 
o TMnw . . . n'i tuediU I bwyao. iiucnr, piUo, ili|na, t 
ehrrtsdln 7 Ct»«dwr nuwr I— &m OoHT, It. 79. 

Tut dad] 7 aydd dja^AvjfHVjr^^ifio yng nghrfimlth - . - 
Trydydd yw, lie y ffVaEd Aya brddehv mewn dadl a fo 
vjif kjfflitwkfnjw yiu( EurhT^iuth herwydd junmhev dadlwr- 
■eOidadl.— r™o«CjyV<itt*; H.A. lii. MM. 

2. to render or to become incontinent. 

AngltTiui'wysi&d, -ku, nn. inoontinence ; un- 



ABghynDyflgAatli, -aa, «/. want of portion, 

dowry, or endowment. 
An^hyniiTflgaethol, ) a. unendowed, nnpor- 
AnghTiUiyBgfteddol, ] tioned. 
Angliyo«d, a.'^Angh^txd. 

IGlaedd arvApwl 

Fkl fi oedd eriwd 

Pkwb a gyith yT oed 



Anghjolwch, am. [?] 



Angbyrbwylledig, a,^AnghrybwyUtdig. 
AngbTTcIi, -an, im. uoD-approaob, non-resort. 
Anghyrchiol, ) a. not recvirring, non-reour- 
Anghyrohol, ) rent ; not returning. 

Bi bSDiT yw hir a tUoddald ; arrddynddobsdmrbTalcfa 
iu^AttcAvW. cyiodlw, o ddev nllar bob uu. 

Or. Jl<*tni.- Onm. 337. 
Anghyrhaedd, a. out of reach. 
Anghyrhaeddadwy, a. that cannot be reached; 

unattainable ; nnobtainable ; inacceanble. 
Augbyrhaeddiad, -au, tm. non-attainment. 
Anghyrhaeddol, a. unattoining. 
Asgh^rritb, a. not niggordl;, sparing, or 

pammonions; unsparing; liberal. 
AitghTTTitlirvydd, tm. unsparingnsBS. 
Ang}i7agt>id, a. [cwsg] sleepless ; wakeful. — 

CyniUUlw: M.A. i. 251. 
Anghyagod, a. without a shadow; unsheltered. 

Bat kmyt nft/mt ikgll7*oai( knynTui 
aKtuiyflantaBryneft.— CW^^"- M.A.I.iSl. 

Anghvagodaidd, a. without a shadow ; not 

aha(U>W7 ; not dieltering ; shelterless. 
Aiigll7*godi, V. to unshelter. 
Anghngodiad, iaid, im. one of the Asdi, or 
inhabitants of the torrid zone. 

AnfliftjioMaid |a«li), tripQlion j ffwiegys poeth : gdwiT 
hwynt felly am Tod yr hauT ddwyraitJi yn 7 flwyddya yn 
en oenbirne, ao d blegid bod «a cyrff y prydlan hyny. o gan- 
lyniad, heb daflu nn matb a gywod. 



I AlfOHYSSOKAIDII 

Anghyigodig, la. without a shadow; with- 
AnghTBgodol, j out skelter; not sheltering; 

tmsheltered. 
Anghyigog, a. motionless, still. 
Anghyagoged, a. not to be shaken ; immovable. 

Bedia agkinffogel yt Tyd Oatroryob. 

Anghyagogiad, -an, tin. immobility. 
Anghyagogol, a. iiomoTable; not moving. 
Anghyani, sm. Hleeplesanesa. 
Anghyspell, a. [cyapell: ct. Bevue Celtique, 

ii. 340] remote, oistatit ; out of the way; out- 
landish ; inaccesaible ; lonely ; [moonnect«d. 
Bocl bendlgett yr aghyilifU wmdi. 

rddTmaffyu 
isrica, ao ardHloedd angkjfnpttt 
fegatwyd yRTsdmiaetii thu.— £1. Samiul: Qrbtliu, 1. 13. 
Hyi rwysp biryfiU yn aer 

TamTaiiaiiiiiibtll.—PkglipBi-fdsiM: U.A. i. BTS. 
ArForfaCaeT, nmryvoerlflnnpA^dTH^arall. 

Biii V.'^x : Bardd C*iK, IS. 

O bl<^ ea bod a rewn syrbBAdd yiprydion sydd rtnnig 

Duw a dyn. a f«dnuit. trwy eu craymder a'u ffTym. eu 

dichell, a'a OiwydrTydd, dniiiglwyildo a ehuglu yn nghyd 

Sd. &iin<icf.' Orotiua, It. B. 

Un peth arall sydd yn achoa o ryteddod yn y hun hnk, 
yv y uv^voh a^T diatawrwydd dwya aydd yn toyman 
dnia yr oror anjijdjwH.— C^fci^nimi, i. H. 
Ue anghi/apeU, an out-of-the-way place. 

A dwyo u ddall i'w bm^ ay'n byir mswn Qeoedd 
iinfllgfill.— ir. LtiBa: Dwy Daltll, IM. 

Anghy ap wyll, a. devoid of discretion or reason ; 
indiscreet; unreasonable; irrational. 
Tti anayberwyd vwledd ; tta-cbworthin ; ymryvonao 
"ifligtpayU ; a meddwdaird.— Xyv. ArcA. tii. MS. 
Angbyaaain, a. dissonant ; discordant. 

Hetyd lod eloch yn geinio, yr achoa lydd yn yr bwn ai 
cano : ood o fod Tjrlooh yn ong^gtraim oni yn ddrygaaln, 
yr acboa lydd yodiS td bnn. 

Sob. Ltmyd! Uirybi Hyflordd, 318. 

Anghysaefim, a, not primitive or original. 
Angbyaaeflnder, 1 im. wantof primitaveness; 
Angbyaaftflndra, f non-originolitf . 
Angbyaaeflnol, a. non-primitive, not primary. 
Augbyaaegr, a. not sacred; profane. — W. 
AngbyasAgredig, a. unconsecrated ; not sacred ; 

profone. 
Angbyaaegrol, a. not sacred; secular; profane. 

Hi roddir dim addyw aHghuttrgrot yn jt ysgol labbaUiol, 
yn gyffndin, ond y swyddyd o ddu-llfln. 

AinddtadDirprwytrgr Ail>l,$l{ia«a),m.cjt.1. 

Aogbyaseiuedd, am. dissonance ; discordance. 

Anghyaaeiniad, -au, *m. want of harmony. 

AnghyBMinio, v. to render dissonant or in- 
harmonious ; to jar ; to be discordant. 

Angbyaaeiniol, a, dis'^onaut ; inhornionious ; 
inoonaonant. 

Angbyaaellt, a. inopportune, unseasonable. 

Anghyaaon, a. dissonant; diacordant; incon- 
Histrat, incongruous, discrepant, disagreeing; 
inhamionious; irregtilar. 

Iawnydane«avdd,nldMuifAjruni.— tfrmNV Oieau, 110. 
Anght/uon d, inoonaist«nt with. 
Angbymaonaidd, a. rather discordant; some- 
what inconsistent. 

Ing a awn on^A^wswiiU, 

Oanruaw, drwyddawadraldd.— T'^^.- Gimtth.l^. 



,)glc 



ANOHYaSOKDEB 1 

Angfhyseoadeb, j -»u, am. inconaistency; dis- 
Angliysaoiider, agreement ; incoDgruity ; 
AnghyaBonedd, ) discordance. 

Y mae talm o sinwrerpan ddwllBnaiii Sreici>d so mijiff"- 
7nan Wtirier; Dwy BrPkret'". *^- 
Ym mhlith pynciau avU] y mac . , . yn Ainddiflyi] pi hun 
riiag y pj-hoddisd o ««s''!i""'»l''> "J anwadttlwth. 

(;«-n«(-r «rr«<.i~ .- EBiuT OlyR. 166. 

-IfJsAy»»OHi?*riiH, inconsistencies; incongruities; 
discrepancies. 
Anghyasoni, v. to render inconsistent, dis- 

eropant, or discordant; to disagree. 
Angh^SBoniad, -au, im. a rendering dissonant, 

discordant, or inconsistent. 
AngliTseoni&eth, -au, 
sonancy; discordance: 
AaghysBOnol, «. inconsistent, diaugreoing. in- 
harmonious : inconsonant. 

Yipryd j- bycl, vt hwn m-Ai yn iinaddaa i'r pfcnirj-l. nc 
ya mwedig yn ,„,<jhsi„n,..J 6'in lit a.'m gaXvai i. 

Anghyaswllt, jlltau, »in. non-connection ; 

asyndeton. 
Anghyseylltedig, ) o. unconnected; separate; 
Anghyaaylltiedig, ] loose 

Mae iiyiuadau fy nhad yn awjhv^t.ylUi'-Iui. fnl y nylwoiB 
o> bliwn.-rn;. nl /»(o; Cyfr. y Bi'inlJ, Khmpld. IB. 

Anghyaaylltiad, -au, «m. non-connection ; 

disjunction, 
Anghjresylltiol, n. not connecting^, uniting, 

or joining; disjunctive. 
AnghyBBylltu, 1 v. to disjoin, to disconnect ; 
Anghyssylltio, | to separato. 
AnghyBHylltWT, wyr, em. one wlio disconnects. 

disjoirs, or divides. 
Anghyetadl, a. not equal (to something) ; not 

so gooil : unequal. 
Anghystadladwy, ((.incomparable; matchless. 
Anghystadlaeth, 1 -au. sf. want of compa- 
Aughyse&dliaeth, j rison ; non -competition ; 

inequality. 
AnghyBtudlawl, n. uncompared; without com- 

IM'tition or rivalrj-. 
Anghyetadledig, <i. unf^uallod ; unrivalled. 
Anghystadledd, \ em. inequality; dispro- 
Anghyatadlrwydd, J portion ; want of com- 
parison or competition. 
AQghystadliad, -au, em. a disproporti<<]ung. 
AnghystaJ, «. not of eiiual value ; not so good ; 

inie<jual: unxiaritllelerl. 
Aji m^pm diliMll ei n,i;/*,i,»("' itflnir.ni ef . . . ynuiyaiwii 

Anghystag, c unafilicted, untroabled. 



Amohtttrio 



t afflicting or torment- 



Angliystuddiol, n. 

ing; unafilicted. 
Anghystwyol, <i. without chastisement ; un- 

c}iastised. 
Angliyaur, -on, »m. discomfort, disconsolation. 
Tri (T^v'i,w^"ri™TTa«dJ; awel] fynlrd; todyfedlyd; 

Ki ddyUi thWHith foddim nghsrvr ini, ifjned rlugom 
yn eiji hufuiM-ili.d.— b;.!-, Sfin,vrl: Athr. yr Btrlwya, ae. 
Anghystirdeb, sm. uncomfortahlenesH. 

Tohtl ffmcnrnit, u ynidciUiienl hribio eyda bryB, o her- 
wydd nnihgrsril'b dy gytvt.—Ci-iflifln-U, iv. 174. 
AngliysuriMl, -au, tm. a discomforting. 
Anghyauro, v. to discomfort; to deprive of 
comfort or consolation, 
A phabi y wlad oedd yn (injjy.n™ pobJ ludih. 

Rff-l iv. 4. 
Mcddwl wrtbyl dy lina yn ddffrifnl . . . pwy a ns' 
"orthwyBiKl K, neu it nj-d-ddyKiiBt ti «k ef inewn Aytr 
trwri™wdi.i>i'hiai.iKdi(r. oiR o u. 

Ijih./foni! noil Ddyli^. Dyn, x. lo. 
AnghyBUTol, a. disoonsolato, comfortless, un- 
couiforfablo ; choerleas. 

IV le'byl] dycliwBtoi'n ol.— '.••••n-.l.i/ .- Gweith. U!i. 

Anghyaurold«b, wn, uncomfortableness, dis- 

consolation. 
AngbysuruB, u. uncomfortable, comfortless. 

disconsolate. 
Athrawiaeth bw<t Rhiifain, yn dj-jgii y dyUi ddynion 

lunmh™ ac iifnC yn ofwiadul, ag ofn fapth, alhrawiBelli 

Bnt. /.Iir/fl: LIwybrHyff. i75. 
-■ eorfl heb feehyd ; tj- hfb wrajg ; 



Tri phelb "i 



harsh, or austere. 
"/. 1 want of affinity 



Angbystig, 
Anghyatlynaeth (v). 
Angbystlynedd ( y). 

non-alliance. 
Aagbystlynol (y], ti. without alliance or affl- 

nity ; imallied. 
Anghyatudd, -iau, sm. freedom from afOiction, 

grief, or trouble. 

miction ; to ceaso afSicdng. 



I T>i»n mai tort n irorthrmn y» y ddsmwain hem i ehwi 
I oil, a chwilb anguriol av (.»y«v.«rN,.— Owmb, Omnin, 171. 

Anghyttal, u. not dwelling or cohabiting with ; 
I without commerce or intercourse. 

Angiyttalgar, ii, indisposed to intercourse ; 
1 incoherent. 

_L 

: AughytteTtyn, n. not conterminous; without 
a common boimdary: iucontiguous. 
Anghytterfynol (i/), ii. not conttTminous ; iii- 

eoutiffjioiiFi. 
Angbyttonedd {»). sm. disagreement of sound : 

dissonane?, discord. 
Angbyttrain.n, not resorted to; unfrequented; 
out of the way, 
A hyuj- II welir fyth mown muuu anghyfyimrel ac 

Amgbyttraa, ii. without con.i:,.^'uinity or affi- 
nity ; not cognate. 

Anghyttraaol, o, without cognation or affinity : 
not cognale. 

Angbyttref,. j <,. not living or dwelling in 

Anghyttrefog, ( the same house, place, or 
neighbourhood . 

Anghyttrefiadu, 1). not to dwell or live together. 

Anghyttrig, j <i. 1. not dwelling together; 

Angbyttrigol, j not cohabiting; wi^out a 
neighbour. '2. nonresident. 
Aelifi ujuihytlrig, a nonresident member; a 
corresponding member. 
Pn both a ddywedwLh am n'livt nKghgUrig tor 



jM.v^.(,K)t;ie 



Anohtttrioiakt 1 

Anghyttrigiaitt, im. non-cohabitation, non- 
liabitaucy; non-residence. 

Anghyttro, -ion, »nt. non-intercoufse ; want 
of communication or commerce. 

Anffhyttuedd, int. want of convergence; di- 
vergence : incongruity, inconsistency. 
Fo idsebyddir t drwU hoa [ irwiitiruv^dd} nth a •tfhgl' 

Ang'hyttaeddiiul, -an, *m. a rendering diver- 
gent ; the being incongruous. 

An^hyttueddol, a. divergent, not converging ; 
not inclining in the same direction. 

AngliTttueddu, i*. to diverge; to cause diver- 
gence, incongruity, or indisposition. 

Aari Itm. E)ti. Ffr, xa. 

inghytttax, a. disagreeing; incongruous, dis- 
cordant : disunited. 

Ac > hvy yn tuffhyttdM ii'a gtlydd, hvy a ymadawaant. 



AnghTttondeb, am. disagreement; incongm- 
ousnces ; discord, disunion, dissension. 
Can mlfttfd ■ mil ucd uet Crist, pim dd fiffk^aandeb rwg 
Qmri fKuhia a Rx>bcr1 Itirl] Ajuwyttuc. 



'; Orotiiu. iii. IS (cf. 16). 
Anghyttuno, t'. to disagree ; to differ. 

A Ut y maent yD 4in^A^jrii>t0, naill ai gejrion Cyinra^ yw 
y rbcj'njr, y rhu a goUuom m i n«a eiriau «fllToiifuda, y 
riiAj ■. fmUiyciadd y Gvyddelod gon j Bcuidlaid. 



3 ANflHTWEETHIDnOI. 

AnffbTwair, a. 1. discordant; not in unison; 
not harmonious ; inaccurate ; disordered. 
r» anghyuxiir, out of tune; discordantly, dis- 
sonantly. 
2. out of repair ; unrepaired ; unprepared ; un- 
equipped. 
Kan ytloed tihea yn aghyn-ir, 

Cyohwjli B otuc . . . y wiieuthur kyidi drioyuyt ar y 
BrytAnypit y eu keiesyav yn aroluinifft nghwrxr. 

Mjn urgktBt heb j Kei ry n^ijiiufir ydwyt o nardi ao 

Aiigb.ywaur, weiriau, «m. the state of being out 
of tune or harmony ; the state of being out 
of repair or order ; disorder ; disrepair. 
Mium aiuihijivdiT, 1. out of tune. 2. out of re- 
pair. 3. in disorder. 
At nutjronV Meir ar merthyii. 

Kinio^ah GiBalclimai: M.A. 1. S2D. 

Aaghyiras, a. that is not a friend ; unfriendly. 

l>y arueu anghou a^ak^Knn galon 
Gal ODTt rwy djTEiriA- 

«^u..rrf «t /,iy..w,« .■ M.A. i. am, 

Anffllyweirdeb, sm. incorrectness, inaccuracy : 
the state of being out of order or harmony. 

Anghyweiriad, -au. am. a rendering discor- 
dant ; a disordering. 

Anghyweiriadwy, <i, incorrigible. 

Angbyweirio, v. to render disuordant; to put 
out of tune ; to make inaccurate. 



Triphf 

ddadgeiii 

" parablwyr.— J/^i 






An^byttunol, | «. disagreeing; different; dis- j ^^'Tf^'*'*' "' ™* °^ ^^^^'^ unrepaired; 



Anghyttuuus, ) cordant ; inconsistent. 

Yf hyn bethau ydynt yn . " 
Fyscprlan hwn-—ite. Oicfn, 

O blfj^ bamatt anghj/ttitHoi, j laaeat yn barod i dr»f- 
■ yntu en gilydd-— /'/-- Oa.'f<i, 110. 

Tm gymmaiat ani;hcniU yw bywyd dynol. gan fod ffcdi 

Anghyttuaoldeb, tin. disagreement ; differ- . 
encv; disunitcdncss. i 

An^bytty, (i. not joined to another house ; not ! 
of the same house; not dwelling together. | 

Angbyttyu, a. not drawing together; incon- 
cnrring. 

Angbyttyniad, -au. em. a not drawing to- 
gether ; a drawing in contrary directions ; 
inconcurrence ; non- attraction. 

Anghyttynol (y), u. drawing contrariwise; 
not concurrent : not unanimous. 

Anghyttynu, v. to draw in different directions ; 



disorderly. 
gDTdhws-l Anghyweiriol, ) n. dissonant, discordant; c 
' AnghyweiruB, j of repair or order. 



Aogbyttyat, a. unsupported by other evidence 
or by anothor witness; uncorroborated. 
Tri chyveiliom cyvraith y sydd: havl aobyab^; ateb 
anghivbt ; a choY ff»^ftjrf(^flf . — f'n/feithinit Cffmi-u^ u. Bao. 

Angbyttyun, a.^zAnghyttSa. 

Angbyttyuno, v.^Angkyauno. 

Anghyttyunol, a.-=.An'jhyUiinol. 

Angbytbruddol, ) a. without perturbation, 

Anghytbruddua, j provocation, or disturb- 
ance; unperturbed. 



Tribrodyranjftju'f'VA'iit: yoad; m 

T rwneion, byddwch ' 
riiai da a cbyw^thnH, a\ 

Angbyweitbasol, 'I. uncivil, discourteous ; un 

accommodating; unfriendly. 
Angbyweitbaarwydd, am. uncivility, uncour 

teousnoss ; untowardncss. 
Angbyweithasu, v. to demean incivilly ; t 

act untowardly or unfriendly. 
Anghywelyfog) 'i- having no bedfellow ; un 

married, sin^e.—Mrddyijoii Mi/ihlfui, 298. 



Angbywertbedd, »m. nou-equivalonce. 

Angbywertbol, a. not equivalent. 

Angbywartbydd, -ion, sm. what is not equi- 
valent, or equal in value. 

Angbyw«rthyddiad, -au, nn. non -estimation. 

Augbywertbyddol, a. non-equivalent ; that 
does not make an equivalent. 



Abghtwilydd I 

AnghjTnlydd, -i»n, *tn. lack of shsmo, mo- 
destj. or decency i BhamleasDeM. 
JafiftcUidk fv unlluiigtii uialmljrdab nHidhwl u ar- 

wrdnjon odhl eitJu, — Vm/>orik ^r Sviid,t8 (cf. &)■ 

. shamelessnesi, impu- 



or modesty ; uusbamefaced, -onbaahfu 
AnghywilyddguTwch, tm. (uuhamefaoedneoH ; 



Angliywilyddio, v. to iiiEike shamelaBa; to be- 



U V toi ef BT dir 
Tiwylni 






Tan oeddut tl mot agkjrvir ft hjimy wrth j ^wr ath 
brioda* . . . krn amglifmni a hTimr nc Uaw Tyd y irrelc ji 
wyt jn perl uhen]nli^aw Aj nb yr awr hoo oe hachawa. 



Dolnr a wnaf I'm dwrlaw 
Ai r dnf anfliYwir draw.— £. O. a>Mi, t. liL ta. 
BI hull KTfamioD a tnaiit nf^ftrlr ladi.—Onl. Iir. i. t. 
2. inaccurate, incorrect. 

Talr ^omm g^irybodatiCJi : celfyddyd amuntli ; doapaMh 
mgkgvnri aciailh aneglnr. — Mgp. Ank. iii. BOI, 

Ang'hjrwirdeb, ) *m. injustice; dishon^ty; un- 
Anghywiredd, J faithfulness; insinoority; dis- 
in^enuit; ; inaccuracy ; unfairness ; inequi- 
tableness. 
Af^efvnrdfb yw aulolwch y dha y aialh. 

rnturMrr fjuid, IT. 
Ao aoham yr angismni'b hwnnw ymottel di lasofl. 

Si. U«iT(,IMlcf, lia,n«). 
Dyma^t felltJtb a aiff mJlan AT wyneb y dclaiar am dn; AjT' 
titirMi.—Kd. lamr,.- Horn. 1. »9. 

Anphjrwiriad, -au, tm. a rendering onjnHt; a 

making inaccurate. 
Anghywirio, ) v. to make unjust, inequitable, 
Anghywiro, ) or dislionest; to make inaocn~ 

rate; to become unjust. 

" "mII y [ual 

Anghywiriol, \ a. tending to make unjust; 

Angbywirol, j tending to be unjust or in- 
equitable, 

Angbywlad, wledydd, >/. a strange or foreign 
oountry ; a country not one's own. 



Ai^hyw-lad, -on, wleidiaid, am. one not of or 
in the same country with another ; one not 
present in a country ; an absentee. 

Anghywlad, a. not compatriot; not of the 
same country (with another) ; not prosont in 
a country ; out of the country ; expatriated. 



Ac »l Mn n kyt butt maeh et ny dylylr y otjB «f hny paUa 
y kynnofjn. Ny dyly y kymagrD paOa tn to dim ar y 
helT atalbo yr barivT. 6iit byd dim a Ullw oae a dluoiclid 
y maoii a ImaT, nu y pjwir ef yn didim ; ai y gslirir y 
maoh, maab droa didim ; a dry ^yndUi yi^ y vaeh dna 
didim m pywlat ao m agkfFictal. 

''tfi^Ulim' Cfmn, iL IM. 

AnghywUdol, a. expatriating. 
Angbywlaidiad, iaid, ant. one that ia out of 

his country ; an expatriatod person. 
Angbyvrain, ) pi. einion, a. unskilful ; insc- 
Angbywraint, ) curate; awkward, clumsy; ig- 
norant, rude ; ugly. 
HldwTt baidd moladiry aitHtvrriM. 

Taliai*.- K.A. f. 71. 
O lodimn ziiiau rfay ttnakrteraiitl. 

Madat Dwffnat: H.A. 1. 4a. 
liyvad oywtaJnt ym mben anahgwrAini. 

Z>i./rt. (M.A. iU. IM.) 

Tr Mbot pwysfawi-acat a ddlddynm rtwJ senmonlaii, 

ydiKdd « camart«r bwy cyn beilsd. mown rtian o bcnrydd 

dallliMb fao-gwfyddol y rW angti^wtaim ac ajinvi»™]lir. 

Um/' Giaaiiti aifrvlit (Am B) 



Nanya oal dyn a dyuno ar Tenrwnn lUaym wtUi 
linyvmyr B[v]yivam. kyn ng/tvvranyrl a bnmy yd eUvv 
ynteu y Iri.- fuana i, rWl> &<«■>>, Mil. M. 



Tij pbetb a iMfkpc 



Anghywreincleb, \ tm. unakilfulnesa ; inac- 
Augfaywreindar, j curacy ; ugliness ; inca- 
ADgl^wroinrwydd, ) riousuuss. 

Yi ammbDriUnrydd . . .'i mi •nfknnti.dd, o bwya alia 
dygvydd, na Ihrwy nigcnliiadTa na Uitwy ddlabell. 

UmUU, Mrtkau, : Bf l>ir Olygiad, 13B. 

Anghywrainio, v. to make inaccurate; to de- 
prive of skill or art ; to render unskilful ; 
to make unartistic. 

I a aa^jhrtortiHUjai fi«rdd, neu ymadiodd: piri 

I I ac anmywraiat a yfl wyr ; aa anyatynol ddevU 

Anghywreiniol, a. wanting skill or aoouracy. 
Anghy wrya, a. tmcontentions, not quarrelsome. 
Angbywryaedd, tm, a state Toid of cont«ntion 

or quarrelsomeness. 
Anghywydd, a. incompatible ; inconsistent, 

incongruous,' discordant. 

Til ptaotb aivit|«»^ t Daw 1 anffaird ; anolr i ae an- 
ohajth.— Amidiu, i. MS (d. IM). 

Angii, a. rang+ir (^L. ira): of. ir-llawn, Vr- 
danc, ir-dant, ir-ad, otr-ad, 4c.] awful, dire- 
ful ; horrid ; intolerable. Also written etigir 
and engur. 

Angir, tm, horror ; awfolness. 

Angiriad, -an, tm. a rendering awful or direful. 

Angirlo, v. to n:nder horrible ; to make awful 
or dire ; to amiize. 

Augiriol, 



_ a^vful, direful ; terrible ; in- 

tolerab'e; amazing, wonderful. 
Angirioldeb, | «m. awfulnoss, horribleness, 
Angirioldar, j direfulness. 
Axtglodd, -au, am. [dadd: C. andtthyat, ati- 
cii/thi/aa] a burial or interment ; a ftmeraL 
Arilud yw yu bud bed anotad Uadavfl 

HodnrlHlidd aneoad.— Cuacafjrii.* H.A. I. 4W. 
Omn ^dyr tywyiawc yr 
bn^fiui ae bnawt wast ae agK 



Jm V_.(,K)t;iL" 



ly J mail T*. a«i 



Prtgtth angladd, a foneral Mnncm. 
Can angladd, a fnmeral song. 
Dt/odau angladd, fimeral rites; obsequiM. 
Angladdol, a. pertaining to a burial or to a 
funeral ; fimeial, funereal. 

Udd, a fona^ynjrdd iitfthAvl, 

lofa TricSraf: Budd, S. >. 

Prtffeth angladdot, a funetal witnon. 
Anf laddwTf wyr, An. ui undco^taker. 

Yt ocdd hull nfbidJK^ r ddlBU mewD Uim WBlth. 

QvlJulfarvr, T. M. 
Anglaa, -an, tin. [cf. E. nn^, anlace, tmeiaoe, 
atidaa, analoMe, with other variants ; and in 
Latinised forms antlaciu4, a/ielaliua. It is un- 
known to the languages of the Continent ; and 
no origin has bean assigned to the English 
word, which makes it not improbable that 
it was adopted from the Wekh. It is used 
in the latinised forms anelaciva, aaeiaiiut, 
by Uatthew Paris in the 1 3th oentuiy (of. Dn 
Cange, b.t.) ; and as an English word in the 
following centuiy bjr Chaucer and othen. 
The Weuh sometimes use glat to denote the 
gleam or sheen of weapons; as, 

Eledynsirr flat gha 
VKbj ear A^uuD.— f?«f. 7. 
ttMg tbatia oleddylkn 



ir intractable 

An^ptadu, V. to act perversely or petulantly; 

■" cross or obetinate. — Dji/ed, 
Angnawd, a. [gnawd] unusual, imcuBtomary ; 
unaccustomed. 

Si golrohtt uf UM belidd a Ttythoo, 

Taliau,: 11^.168. 

Angol, a. [ang] capadons; wide; extending, 

extensive. 
Aagor, -au,-ion,»m-/. [L, oflj»ro;Qr.'i»yxupai 

C. ancar ; Br. at'or, keor {^W. heor); Ir. 

angcaire, anncoire. ingor, ingar ; Qa. acair ; 

Mx. oiter] an anchor. 

Dot uftfT bsdm bud aUruBf . 



And we may compare the common esparession, 
arian gleision for ivhite or tiher money] a 
sward (of some sort] ; an anlaoe. 
The English weapon bearing the name arUace 
or arulaet is described as ' a short two-edged 
knife ot dagger, broad at the hilt and ta- 
pering to t£e point, formerly worn at the 
girdle;' 'and the Welsh an^^ may have been 
similarly shaped ; but no description of it ia 
gJTen, and the word is read but once iu early 
oncuments. 

Angiat avwrdfiQ ]orl«o 
l>Tp}ktf'th« >« law luric wehyn, 

Amturit: Gododin.SM (A.B.ii. Si^lLA-t. 11). 
.i^iM, deddjl.— flnWuAjm W, Cgmnal. 
Altgl&wdd, oddiau, *m. [clawdd] a cemetery, a 
burial'place, a grave-yard, 

Tn nam Uufth elnyd dotrd u dyt 
Yn DuiT IIlweHaBd anglaiil knglrt 

OfnMelv; M.A. L MB. 
Angot Dlavt mflinM uiglod.— O^oAWw.- U.A. I. IM. 

Anglef, -au, ■/. [ang-1-llef]aloud voiceorory; 
a hollow noise. 

Bi hno-gmitli, Uis hcn^^KOi Iwrd, 

Yt gitrw mi^'k/dui fTan^lvTd.— ffngfycid Bmtllus, 

CljwB niif Ir/Krtfa dm twtlij, 

YmgroMaii, nl amiBli i.— Lcvti Mnm, l>r Ddylliun. 

Angnad, a. f anynad P] intractable ; perverse ; 
cross; petulant; peevish; disagreeable. 
O* 0*1 Mil fydd y nrnmnv, dunrwon > mrioa fvddsot, 
■urMtoeiE na oeb a^.—tlMngtm Mfld/ai, a. 801. 



gona.—MyMdi' : 



M(Ef.ai 



L. 1. 1 



M). 



dolfiUai,: 1I.A.I. lW(Bf. IM). 
AerdATf UTDUg aerdorf OH^fv. — Cfvlddm; M.A. i. WO. 
Ef oed lie* llew la agkiir. 

LlrK.aiUnKlf.- U.A.i.ne(el. 148}. 
Yd MMm, lis _thr nuDr, 

OwTlu ser Uftw msrian mOt.— 0. at «>{I»h, edl. 31. 
Wedi idd^t Fwrw pedali mv^ >Uui o'r Ut*. 

Ud (odd 1 lloog If getatot 
Heb raff, Iwb hwjl, hah an^ffc, 
YdFW*r wouu dwriuhor. 

Pw Urnges pond girell oHwr 

Na lln i oim«a'r mSiI— OnnnFir Ohoh, W. 

Blirv tjA mairr u bd*a Hon, 

Yog ughyifaudd « a>f dWdi.— /Inn ITjfii .' Bl. Alt. MT. 

Angor llu»go, a kedge.— (P. 

BwTW angor, to cast anchor ; to anchor. 

AjC >ao r bwTTaiwit a^gionu allan ac t 
jnuj wjrthma.— Snd Or. ai Arikur: M.A. 11. 

weigh anchor. 



Bod -wrth angor, ) to be, lie, ot ride at 

Oorxmdd xarth angor, j anchor. 
Angorawl, a. anchoring ; relating to an anchor 
or to anchors. 
DrwT hall mtftmual dnnl Uoogiitiuth, 
Dswr «i mawihTdi am faemdnath. 

Dan Wrm: m.Alf. 06. 



anchorage-groui 

Mot dawal ydyw ] a'l HamfBr/a km, 

MbI pe yog aghmg ym myairaa dawd mAr. 

/. li, OaJrwayiU.' Oeir. 1( 
^ mae^ far^Qfaf^ JU jagjimn tt 



m-vai: 



mabfv ailei 
2. a road, roadstead, or hay. 

OadavowD ty ngwaa Valdrod jo% Nvhalro tSyAM'va 

orfaeth , . . a'm llunff a aronsfci vh Atkgofja Alecaiuidria. 

H'. Lami.' Dwy Dnitk, !». 

Kl phortlOadd, wrth dnt u'l tm enir [Bhod], ydrir prif 

aMfOr/a lloogan Ajtti TwnL 

Ai». «>*>rft.' Daaarrddiaetli, 180. 
Angori, v. to anchor; to oome to anchor; to 
grapple. 

Ae jna. paa ddaetA laaon hfd jn ^uy^la. ef a OHf crru 
el km^ yui mhottti SuoDfDta. — YtUiri Dand, )G. 
Uoog oedd gr^erbrn mava 111 

rwh»rgs,yiia '■ ' 

A^fOlhwiLoa 



,)gle 



Anoobiad 1 ' 

Angoriad, -au, tm. an anchoring; anchorage. 

Tn axTlnirglur J (nwlii tTeintad 
ttheninu hyrwyild i fangre'r .iNy"fiftf / 

/. I,-. [/.rXo.jrrfrf; (Jeir. 106. 

Augorwlad, wiedydd, -owld, im. [an — l-gor- 
wlati] a country that is not foreign ; one's own 
loiuitry; 'a ci'ntral or inland country.'— P. 

KheMt diffrydiod 

Anothor rcumBioti of the same poem gives 
' angor gvi]ad,' tho auuhor or stay of the 
country: 

I{i«ct itiff nvlyst 

Clot ior itf/nr [.r^ Angor^ ffwLat. 

Cf. ' Arfon angoriad,' s.v. Aiigorind, which 
K'CmB to uouuteiianee this hitt«r reading. In 
cither c&so the expression appears to bo pe- 
culiar to TaUcsin. 

Angoryn, -an, »m. a small anchor. 

Angradd, a. without a degree ; not graduated. 

An^addol, «. non-graduated ; without a 
degree. 

An^aid, a. [graid] without heat ; unecorched. 

Angraifft, »/. See Aughmiffl. 

Augramadagaidd, a. [gramadeg] not aocord- 
ing to grammar ; ungrammatic^. 

Angramadegol, u. ungrammatical. 

Angraddf, a. without ioBtinot, principle, or 
quality. 

Angraddflad, -au, im, a diTostin^ of instinct, 
nature, or quality ; disqualification. 

Angreddfol, a. devoid of instinct or nature ; 
not instinctive. 

AngrsddfU, r. to deprive of instinct or nature ; 
to disqualify. 

Angreidiol, u. not scorching or burning. 

Angiyd, (I. [gryd] with trembling or quaking. 
/'. 

Angrydiol, 'i. troiobling or shivering.— P. 

AngrTin, «. [grym] with vigour; with strength. 
/*. 

AngrTmua, n. very vigorous.— i'. 

AngTTmuader, -au, sm. vigorousnoss. 

Angu, I', rang] 1. tu contain ; to comprise ; to 

hoia. 



titToet mywn ty, 
' (vlTyiKu mwy nm 



mu ynff iwhrfur 



Nr' xmywn ty ydnnlynt luirorn 

inrb cniitTvf u'l Hr|iIwyd<linetU ... a 
liiWbOiiiAwd y lunula yDddi.--A.'y.'d ir 
Nl '•'•v iDcwn Untr oud ■ fu judo [<tl. 

L [=ongi] a. to deliver ; to loosen, to oitricato ; 
to iwaixi, to elapse. 
O wytbwih ■ HtwyD s llwyu«in 
Nytnr>ff«'>ullny uelunKleiD.-.<<Huri,i.' Gud.MS. 
Tru nunm vn gwr nyt aii-iMntii^Ht. 



ASOWEDD 

. to be delivered ; to give birth. 
Angu ar. to be delivered of; to give btrtb to : 
to bring forth. 

a on lieirhj'^uc hd f*- 
»(ij™y"V';'.PglMiieyT 



Oderuyt vstat' ^,_. 

flftrer»hrKftlt*Tydhyor pJi 
burner bluydyn uueyttryti 

rodct u«U yny He yhugiirycl hyt pu 






O derfydd beiduoiri iprewidavK ^ chaeth, y neb A'i 
beirhoco ft ddyly ix>dai ^mrinidAW^ unill i vajiaiiu'tbq yn 
ei IJe yny inao^ ■ meithrm «i nuib Rwodi at^oo n dAHoAmir 
i'rncbbieufoydyn.— J(,,.. .li'S. iii, ;k1. 
Anguriol, a. [:=angirioJ] awful, direful ; ter- 
rible, horrible ; intolerable ; auiazing, won- 

luda* a't Thki oedd ^yd ft^ ef . . . a orcMygftHut y ddiDM 



Hibtut luddfii ' 

[dr> inryiit ym mhab pulb yn 
.'i wuedd awjui-iot drwj'*r heol , 



Dakh aiiguTiol, intolerably proud. 

Ond cto er hyn i Ayd. y mae amo ynti^mp yn difwyno'r 
ewbl: J ntae yn /nlch SMmrtol; y niie cfe evn falchod k 
LuwoiBer.— flol;. Llu-id; Lluj-brHyff. ZM (ti. 187, «*.) 
Ang^wael, a. mean or low.** 

Ni bnniijmHiyrboddllMl laTMl.— TWinnn.- H.A.i.tS. 

Angwar, a. very tamo ; docile. — P. 
Angwardeb, ) tm. tameness ; docility ; geotle- 
Augwaredd, ) ness. — P. 
AngwaiUL, tm. disgraoo; shame; reproach. 

Nag ystai yn anttwjadyl 



Angwiuthedd, i 

Angwarthiad, ~i 



1. a rendering disgraceful 



siiameful.- 
Ang'warthuB, a. shamcfkd, disgraceful. 
AngWAdd, -au. </. [an--f gwedd? cf. otigurdou, 

(gl. eita). Oxf. Gloss, ii. 41 (Zeuss, G.C. 1058. 

8!)U) : cf. also angweildi, engweiidi, agtotddi^ 

valuables or rarities (viewed collectively) ; 

precious or valuable effects; treasure; a 

Ef u orchymynvfl yr ifvyr kyweiriaT y gnrff yn enry- 
do^LUH vn^nluniaw] ay dwyn y Ua«r Wint . . , <KDya yno yd 

""''"" Bnl n .9-1. W" ; M,A. ii. M3. 

In another passage of the same Brut {M.A. ii. 
539) the word occurs as eiigiifl {=e»g<otdd) ; 

a»f«U Pvbvro yn lie y ^etwit Kenguth Vaohau ac ajluc 
yao yboU 'u^ucd ay wrric ay veibiun. 

The same transactions are n^lated in ' Brut 
y Tywysogion ' in similar but not identical 

Ac ynteu a gcrdawd hyt yg Kaer Wynl yny Ue yd wd 
■wUt y broihin aeTivnhinolyDQoLiidoed.— if. ^ T. Gl. 

Ucialt yBlinrt rmuro a mdwalawd luMcIl Kenari^ 
Bycbui, at aiuudi awnavth yno, a flefaau yua y boll alud- 
oed, ae irreic ae clifedyDn »e holl unniiylj-t.— A y T. M. 
It probably denotes what is out of sight,, a 
hidden or concealed thing, deposited in the 
penetralia. OugufiUm in the Oxford Qlosses 
is evidently the same word somewhat differ- 
ently Hfiplied ; and Zeuss no doubt was right 
in considering riigueiluii the mure acvunite 



DgnzsdbyC0(.)t^ie 



form, but he was not aware of the fact that 
mgued and angueil actually Giisted. The 
m'lnnguriliia (gl. eitorum) of the Capella 
Gli>s«ee(4) ap|>ears to contain the same element 
with a prefii. The gimilarity of fitigicedd 
(an^ed) and amgufdd (amgucd), both in form 
Euid meaning, ia noteworthy. 
Angveddi, lau, »f.=^Agweddi, Egwtddi, Eiig- 

An^wrea, »m. heat; inflanunatioa. 

Ejc Ifd [aL ciRlf-n] dan di^iiD dra Chymrt [thrwawt] 

Am vpdd Dyntfjmin Dbwyffcdawt 

Arbes tjwin aitffAuns pechawt.^Jfjp, Art^^ I. 7S, 

Angyryl?y 

Prfndrr pwittreeidTr nyt tnrjt mat wrlh 
^uduBt amsKu nerth prciil OHtrnffyAt, 

»«i«rrrf,i..- M.A. i. IM. 
Ajigwyr, $.^I<inguri/r (ag. iangwr) ? or^^»- 
tryr {ig, anwt) ? 
& n«iTd •ogBU rhi» mgwfr [ol. MghywjT] Ltoegyr 
Ki lyVTAV TT nuwnild 

If i ddfdiAiiar J-iHDcdd, — LlytcanA Hm .- M .A, 1, 116. 
Tn amwTD QwenystrHd j ewdid eotrr 
HMg ai-fw»7- Uawr Uudded^.— Z'<ifWi'.' U.A. i. IS. 

Aiigrwytli, <i. fullof wnthorauger; wrathful. 

wem rein °^,^^^^j B^c*fl».' M.A. i. 383. 

11 In some of the preceding words (beginning 
with aag-'f, which I have only found in dic- 
tionaries, it is not easy to'dedde whether the 
prefix is the privativo.particle aiiy- (^:an-), or 
e syllable qtij. 



T^n ddeallodd IDomitiaD} nui ymrydnt tc anfylaidd 
oeU unau jt I««i, ■ttoliodd d nvalondcb. 

C*. Rlv^rd,.- Han. rFffdd.M. 
ISmc^ ohwKiit djuol dJi^'ai^ rn aetyJl rnp- a^hanol f 
^ dTHgwyddol, jr Imn Bydd hub ddechrpiuid. 

Win." iiirjd- YniniddMd,Ti.7. 
,^ c^dgerdd nafrJauf'r fa utju Arwyrmin 

Cart'ad angytaidd, Platonic love. — Dr. W. Bi- 
eharda, s.v. 

Ir cmya angylaidd, the seraphic hymn. — (/». 
vi.3). 
Angylawl, ) a. angelic; of C 
Angelawl, ) angela. 

Tt angjIloD a (rrowyt oil 7 Bjt. ■ nyt o nn BOirel. metyt 
f s^twt yt cilh dhynian d nn dyn. wrtb hyony vh ditig-t a 

a btynnai. ar UuiUh oU a vydhynt odhydUir y pryajiedig- 
«aUl.— /.itiilir. j 14 (ct. K). 

Fan welo dyn «i fnvd wedi dychwelyd oilmith 1 gyflvr 
mmftlatrl, pa fodd y gail et unseo an'i Kara ef ) 

Angles, I -au, a/, an angel; a goddess i a 
Angelea, j nymph. 

Gmie n« chawn ifan haidd an jjiJu 



fxBneigmM 



pertaining to 



Da/i/dd r«oii«u c> Drrgrou. 
Ni a welwD mor feiluhlon yv llawer (yn pmrnli^ gwta^ 

by^utin, neu yn b«tbau amffenaoh ds tnercbod ereill, 

Aslcrl Xl.ivd: Uvybr Hyff. M. 
Aawylyd olm-bijid lln, 
Attgnttt ^ynhoi n ^wte-— - Oro. Ovj^ 28- 

Angyliaeth, ) -au,*/. augelicstate, character, 

Angeliaeth, ) or-OBture; aogelology. 

Ah, inf. the exclamation A {=A lU, q.v.) is 

sometimes thus written, apparently in imi- 

tatioti of the English spelling ; hut no Welsh 



e pronounced 

A dyvAlodd ToHua. Ah, th, O Atfrlwydd lor. i ba betb y 
dygaiat y bobl jtub drw yr loiddim™ F 

Alia, inf. [ira.]aha: ah! ha! ha ha! alas! Th<> 
seiiqcs are distiugubhed by difference in the 
modt' of utterance. 

Bid ahn byddir bid umdsl ofaud, 

Ahft \'il. ha ] ha :] gwiuig y Bwa Booh I 

A'J waff a ddywedodd wrUw, Attft, ty meutrl pa fodd y 

O bfTwydd dywedyd Tjtus am IcnualFoi. AAti, torwyd 

Aha. fmgvTO™' at tj ngwrthwyncbwyr. 

Ai, adi: [iae : a+e=ef] an inteirocative (fol- 
lowed hy the radical nound) used before all 
words (substantiveB. adjectives, pronouns, in- 
finitive verbs, and particles) except &ut« 
verbs; a being employed in the latter posi- 
tion. See A S. It asks a direct question 
without anticipating whether the answer will 
be affirmative or negative : and its force is 
generally expressed in English hy placing the 
verb before its subject ; aa,ui liwii / isitthisP 
ai efe I is it he ^ ai inijfi yivf is it I ? 

GofyD Aoruc OwelD ue dyn bydawl. 

J/aftucyton, i. 31 [ct. ii. 31S). 

Ai Uai fy rhan □ anhun 

Na Hen a bndd, gar Uys bun !— D. itl> Gn^t'*, oxxxt. 1. 

Ai dyma'r g^rr a wnaeth i'r ddalar ^rynu X — £^a. xIt. tfl. 

Ai tfdi yv JT hvn vydd ya dyfod. rti im arall yr ydyu 



Ai tydi yv yr hvn vydd yn dyfod. rti lu 
rn ei ddi^wyl \—MaU. xi. 3- 



i ffvneiithurvyr gwyitluHu j 
Ai nid ? (generally, like L. ntnine, expecting an 
affirmative answer) is it not? 

Jj.^'/ } is it so? indeed? really? 

Ai e.CrmTaoediBmtraPbfUb'.— an. Owaii,,3i». 
Ai givir hyn? is this true? is it true? — Dan. 
iiL 14. 
Ai, con. [tue: modf. of the interrogative ai. 
CI. A 8. a] either; or. 
Ai . . . ai. either . . . or; whether ... or. 
Atbebin yv gennyt heb hi nadoclta ywnbunt beb lad « 

Puy kynt ae Cyiij-ll o- golouat '.—Tuliuii : M.A. I. fa. 
0» obeilb K«iDyt ti ar gnlTvl dy ellwng nt yr ?nr n^ yr 
arysal at yr ^lut preswiiaavl. ae or catvcot ac yiolad f 

Ena edfliejt e kpfroith na vyr nop betb eu hy ai moruyn 
ai ^orvia.—Csi/rfitM^H Cgmn, i. SB. 



a. Preceded by naill. 
Naill ai . . . ai (sometimes, but leas accurately, 
jieu, ynle), eittier ... or. Naill ai hwn ai 
Aumw, either this or that. 
Cymmer i Ci naill vi fair blynedd o nevyn ; ai dy ddifetha 
dri mifloOafo dy vrthvyuebwyr. — 1 fron, xxi. II, IS- 

y^m ai gwueweb y prm yn dda, a'i ffrwyth yn dda ; ai 
gvocvch y pren yn ddrwg, a'i (Trvyth yn ddnrn. 

-VniVf ai llwynog "' Uwyn rhedj-u. 



,,Ct>(-)t^lc 



6. Proeedfld by u 

rnaihiraaihi 



; either this or that. - IT. 



TJpddir Imynt nn nl Irwy ™ nsfiho, oca Intp ™ mu i 



:. Preceded by ^ ti 

«i .. of )Ti J eoriT. a 



r^ vn ■ wTueChom Di 



■ bpr i fynir i'^ rfaBgDrfRintuq, 



Ai ■>■ Dj D ddig, HI o gnucb, a( rote D blcbder. 
d. Preceded by pa un liynwu/. 

Pa an iyinaf ai ds ai dnr|i, 

S ''or. V. 10 |cl. Pnit. lii. 14 i Bhof. xiT. 8. 
Fa DI bj/naas B WDCloDt si KWimndaw oi ppidia. 

£.<c.ii.T(cf.6 

/\j an bymag oi nrDphwydollKoUiAn, hwT A ballAQt ; c 

tafodiu, hvf * badiBot ; oi fuTbodiuth, lu ■ ddifluuu. 

Ai yntf, or else ; or (on the other hwid), 

A ^iil ddyfod i ti aalth mlTiudd newyii yn Aj wUd 
neu ffDi dri mia o Own dy eJymoa, a hwy yn dy pHidI > 
(rqr« bod bunt yn y ^Ud dn dinniud ? 



rrlh y itun y uiwrlvcn hyt ns < 
J Hc nHt .1-, rf y Vnv. Pn-dfyn 

/i™i <,r, ab .Jr««r.- M.A. U. IM. 

Ai, pi. sent, t'. ;frd pora. sing, imperf. of 3h (m^ 
.-I 11): went ; uw-d to go ; was going ; would 

go (^<'lai; L. iifd). 
Anna brophnyd™ . . . yr bon nid oi allan o'r drml. 
I Ym mUm hvyrdrwm olwynini, 

A thkVfllBbswaloi.— JVfM,- Ovvil^ 118 (cf. lie). 
Aicb, pt. cichiau, »/. a scream, screek. or screech ; 

Aid, pt. eidiau, mi. life; spirit, auimatioii. 

Crllwpiriwi all aW.—ZV*'''' "*""*»">» [P-) 
ipiiolhod, '.pohfrym rUntoA, lli 



Pn nn ai b«Mb, of o gyrtwybod, al s,u o ddnin obiith 

. . . y mHent bvj yn HTSHT^lo a^ ynciliuoddi wrth airDuw. 

Uorit CaJftt : Diffyniad. It. 28. 

A'i, pi. S.-U [=a ei. ac ei: con. a (1)+po8s. 

pron. ei, m. and f.] and his; and her. 

Ac at hyny y cyfeiria ef d boll weilhredcH^d . . . m^fyi, 
dull «i fu'^bodd, pE podiF c)'fc>il]ach^ a tfviafrvd vi dilillad, a 
' dulleifrbx^b, o'l vpi'ioD. i^'ymddiddanionin^^Tmarwedd- 
lad, a'i ^IJwair, n'i eArychiud, le, "'i gnddMiad yn yr 
heolydd.— i)r. Join Jliu'i'.,- Uyfry Bes. 11. i.M. 

A'i, pL 4'ti [=4 ei, ag d : prep, a (2)+ei'] with 
his; with her. 

■ lebn ii't dnutd, efs t 

A'i,ji;.a'u[=aci: pron.rcl.o(4)+ei*]. Soo^4. 
Onytef airyT pptii or 117110 (^eiarwidi cbwi, ny mD 1 neb 



i,f ?.a'u [=aeir eipl. adv. o(5)+«]. B^A 5 
a'i digamrgodd, ac a'i pluMidd 



-Am. » 






absol. part, a (9)+o]. See 



i'i, pi. 

A ». 

i'i, y^ tt'u [a ei : verba ClI)+«']. Soe ^ 11. 
Dan draed yr E yn y dnn. 
Arwaered yr a'i werin.— OimHw ««*ai-».- OwaiUi, i. «. 

I. 2nd pora. sing. fut. of «fu {sef 



Aaidisyd*' 



i«« yi^ dryd^iHli^baid. 



Delb yw'r dymodiaa jcraid, 

UyKlilawnhurT— /'■HI, /)iIk [LienadyiO«>,l.ae8). 
Aid, a. full of life, spirit, or animation. 
Milwr aid am I.yr ydwyd, 
UunrTddA gflrff Uurviddig wyd.— /fuai Ca' IJtegd. 

Aidd, ;>/. eiddiau, *ni. [Ir. atd, ead. \H ; Os. 
«(i(; Gr. oiSof] zeal; warmth; ardour. 

Uwrthcbai AdiUf iddi byn mewn «iM. 

H'. O.Fajbr: CO. ix. MB (cf. T. »M; ii. Ell). 
BmfUodi] aulil h«i asian 

Blackurll : Ceinlan Alim, lU. 
H?wn aiitfi taoctaidd a bivenUA Emmctyd. 

/. U. D'ino^fM; <iea. BO {ct. 110, US). 
CvnbjTflad i'r wlad. hir lea. 

iri la.tiT iiidd, ct I. rodAm.—Triil.- OTUth,ei(cf. lU). 
Oimeir byn gan Tait^ydallavermvy a aidd nady^tj jt 
Ht'bnieg a'r Uiuc«, i ddeall gair Duw.— .liJi^irfrdil, i. 1!S. 
AV/o/i'on riil'linu, celestial ardours. — W. O, 
Pughe: CO. v. 264. 
H For derivatives see Eidd-. 
Aie, adv. [ai+e=efl is it so? is it, really? 
is it so, indeed 'T 
Jri-. yrednoerrwydua, 

Afiywiog liw, friwing lyi l—D. ai ff kt/jihi, cmtlU. 77. 
'.^i'/ebrbrw ddieflyn ^warftamoeddR^r llaw; 'agaed 
dim enoyd i ddyvedyd chwedlau yuiiaLB \ * 



Aif, pi. eifion, >m. edge, margin ; surface. 
Ei fll'id entavr, anfartb, 
Aynt eu gnrw hynt yo gertli 



, . of the 

goes ; will go (L. ii, ibit). 
Soe^ II. Writersof the 16tb and 17th cen- 
turies sometimes make this person end in -iff ; 
as, rriff, gtceliff, for cdr, gwel; hence aiff 
(a-iff) for S. This form, though unknown to 
the earlier language, frequently occurs in 
Morgan's Bible ; but in the revision of 1620, 
and all subsequent editions, it is uniformly 
changed into S (=a). Davics'a disapproval 
of it is well known, and his objection to it is 
by no means groundless ; ' Jiundudum ob- 
tmuit ut h»c persona cormptissime rulgo 
exeat in iff. Quod factum < 



jM.V^.(,K)t;ie 



xaKB^itXict et pnivA imitatione anomsli eaiff, e. 
raffael. TJt eenjf, pro car ; periff, pro pair ; 
rhoddiff, pro rhydd, Ac. qu» nimqaam sine 
mdignatione audio. H»c veteribus ignota 
fuere, et ab oratoribns et poetiB, ut aum- 
ma tincta barbarie, semper vitata ; ut ne 
a monosjUabo qoidem a/, ibo, ausi siiit dicere 
aiff, pro a, ibit ; ne qnidetn post adTerbium a : 
Bed semper dixernnt, a S, ihiL'^Ant. Ling. 
Brit. Rudimenta (ed. 1809), 99. 
I>Twedsfwrtb(iii,l>o&(u:eriia>/.' uwrtb usll. Drnd, 
u rf m ddAV.— FT. SiUabtirr ; Luc Tii. S. 
rrllehwarriii/; rhiuda. 

Xdti" Clg-aif: Athr. Orint. SI. 
T>7 mA A Bj/' 7chfd% tn hwQt Vt lorddonen. 

£.^. *oi-jnti .■ a aaio. lix. S«. 
Duo Dad rw cyn onhAwned adoabod a chael Efrlvyi 
Dduw, odd^drnrnutodiif m^wnUawn-fijdi'Tr chciaia. 
JTanu C'luRii ; Diffjniad. it, 2«. 
T oeb ■ g-yramerD d&Eth rti llaw. ac a aiff 1 wlad ddielthr, 
Did bwTimi jddmw pui dd«lo ef i ryv dnf hrfryd . . . 
dnuliaw'r aioMT. ac ariH yn rtay-hir gyAaa bwy- 

A™ Zmi.,. ; T^iT m. Adfyd, lU. 
l^Toa'r fellCith a di^allan ar wyneb j ddaiar am anghy- 
wirdeb.— fiUic. /amM.- Horn. i. B9. 

0« di^ chwant 7 cnadur allan oddi vrtb ei ^un a'i 
wniddya ei ban, yniiDUie'ninjni'd i'r mwa Ewyllva 

Mwgan lAtej/d- Ymjodd. ri, 8- 
Fe aif tt MeiBtr Bion yn Blonrn. 

It.w JVcnu .• Eoa Ceilue, i. 337. 
Ei Diad ef yn Ota aif. 
Oa Todor gaiir mAadn. 

OKaOlrr Xec^ain ; OvaiUl, i. SSB. 
Tchydig- of/ i-w rbnAii.—B. l/acii: Telyn Dawi, W. 
I ffwi^d Did aiff oi hajddwch 
EiniMlhfawri'rUaurna'rllwcli.— Tf^.- OwaitI^ OT. 

Bj some vritera, especially of the present 
century, the form tiff is preferred : 

Dali^ Hylv. na bydda J tail yn aydh : ofl bydd, lo eiff ar 
din wrth n gynimywu gyda obalcb. 

H-. O. i^^ie; C.P. 6. 
Aiff, }]f. eieian, )/. [Ir. aigen-=iW. eigiou] 1. the 
sea, the deep. 
If i thau fy mben am WeDDO, 

Oolwg yr lis a gU gto.—Tudur Alrd. 
Unrara^wrdd^tmoryrfi^^^u, 

Rhitrrdin: M.A, i, 1%. 
A RWyUo rhod a'r ewaelod, 
A Aiiyfo'r ai* rhif yr od.—D. ai Giui/jm, cm. 17. 
AH yw^r paun i Uv'r pcDwaig 

O'lbaulgBBTblltOgav.— C'^i/ritFO* Dafgdi Oack. 
Pfoiddriyui' 1111 tornun llawii.-/<>«>i i( Tud-r PriUao. 
Rbylel, yn gavr, sy'n rhwyfair 
Fal lonnau'rai;, fa] dnig draa. 

Mo «Dr«ii>u'f .' Salmail, ii. IW. 
Pyr« yr aig, sea-reed, sea-matweed, maram, 
halm (^Arundo or Ptamma areiiaHa). 

On bydd dy wallt yn diwniddio . . . golch dy ben a^ 
wvivell Kwnudd isra ur did, ac Hi cbiryrap. 

L&ncntf Ml. I. au. 

2. tidal bore, eager; the bore in the Severn. — 

lolo (Houary. 

3. a shoal (of fish) ; now generally written haig. 



4. a herd ; a flock ; a drove. 

5. a troop, a company ; a noraber or body of 
men ; a multitude : hence, ptn aig (oftener 
written penaig, q.v.), head or chief of 
chieftain, headman, or leader. 



Liyte. ab Llfto^iyn: H.A. i. mf. 
Owyr Rydderch enaid-«nh anwydsedd 
Eia Leiiraw a'a Imrddav enw harddedd . . . 
A'n puiav a^u breiwaw I'd brwyw^dd 
Aiff eur-banh ac aitiied pob BaLir«ad. 

Da/gdd y Cmd: H.A. 1. 107. 
Aelan ddyicTrcIi a ladd eiaiau. 

D. ab Sdmvml. O.B.C. 1C6. 
Panaf aig fwjT, paun cywiriajd. — Graffgdd BiraiiAog. 

6. a female, a woman. Cf. hen-atg or men-at^. 
gwr-aig. 

Gowo yw Meir glandat bofthetr . . . 
EenD yw bi not goleunj nyt ffelynairl 
Lloer «ylron a ewrvdon lic waredawl. 

Or. <ib Str^sid: M.A. i. W6 (cf. KO, W»). 
Fob rbyw aig a yagai. — Diarrb. (M.A. i. 16.) 

7. a source or origin ; that which orginates or 

Ha«L ffuiad pnavd^ dsfawd rin. iaim aig 

l>ynoLic>D hll, nu pnodoUkb plltlk 

Holl gyffredinlaD GwynFa. — IT, O. nighe : C-Q. iy. B18. 
U A lake in the pariah of Uanbedr, Carnar- 
vonshire, is called lAyo-Eigiau. 
Ail, a. [C. eil, eyl; Br. til; Ir. ala; Ga. tile; 
Mi. etlry ; Gr. 'a^Aof ; L. oKm] 1. second; the 
ordinal of dau and dwy. 

Yt ril onnes oed diaspat adodit pub nu kalau mei. 

Ef aglywei di^reoh nawr y mywn kost ar eil ar drydHl. 
Mabinngioit, i. AO (cf, 81). 

Yr ait wailh, the second time ; the second torn. 
Chueugtynt «ticygyl koitaf am yt e^l gueyt punt. 
A'r oa waitb yr adnabowyd loaepli gmn *l frndyr. 

Ail Ira ail, 1 by course, by turns, alternately, 
Boh yn ail, ) in alternate order ; every other 
turn or course ; every other. 
Bob ail dgdd, i every other day; on alternate 
Bob yn ail dydd, \ days. 

Bob ail iios, ) every otheruight; on alternate 
Bob yit ail iioa, ] nights. 
Yr ail oreu, the second best. 
Yr hmm a dywedir y vot yn eit goreu or byt- 

% Ail, like the other ordinals, precedes (with 
rare exceptions) its noun, which it governs, if 
masculine, in the radical, and if feminine, in 
the soft sound; aa.yrail mub, yraii ferch; but 
many recent writers disregard this distinction, 
preferring the soft sound in both cases, and 
thus mal^g ail in this respect an exception to 
the other ordinal numbers. 

At ei f airh yr ai f *erchwyD, 

Yn y llu ddue yn lien a ddyn ; 

Yr art dydd a'r wlad i'w ol. 

ArbedwarowjThydol.— IWicr.4(fd.- G.B.C. i31. 

Efe a ddfdbrauodd adettadu ai yi aif dydd o'r -il mi4. 



Yr him lydd yn jrorobfyru, nl i^iaifl d 



id gan 



Trwy ei aatbru ef dan ei draed. a 



Am yr aH pwnc, ynff ngbylob ymarfer beunydd o veith- 
edocdd ds.— Cr, J. Damci: Llyfr y He., i. », a. 

ail cme^bodio ef . 
IJytjryK«.i. vi. W. 
Yr ail peth yr oedd efa iV wneuthar enjw ofldd bodlooj 
Da« am «iii pechodau. 

EU. Hamatt: Holl Ddyleds. Dys, Rbag. 20. 
O'r ail radd, of the second order, class, or 
degree ; second-rate. 



2. second (to); like, similar, aometitues fallowed 

by i, and somotiniea without it. 
1. With I before the noun. 



Tnnifichiriaiirebix. 

N«w. hul, o Gynjn. ni a«i«.— fi™»»» O™ 




ErjTi.— C™»K.^ Obo.u, 99. 


. Without .". 


EormslHin 
YuUaww; 


dot drfloTthn ffww^in. 

^^~->.r.■n;G«ludiIl.TM 
budaldnlurntti™ YTHW 
uidaw gau 'il Ind». 


^« KolMt olhr ffi-niant ffnirf. 

O'-i.ffsd'l nt 3l'r,'lyd^: M.A. 1 


Merch ; iTBlwydd, ad Ifcirchidn, 






■nDcwi!) 



rf,S»}. 



1[ In the poets, ni7 Homctimos, but very rarely, 
comcB ait«r its noun: and when the yrt-p. i 
is omitted, it is not always eloar whethw n'l 
should bo taken in its first or its H<>cond ac- 
ceptation. Buch is also the case in the in- 
stances in which ail follows the noun which it 
Qualities. 

Ilni Bovrym Hunt i SciriDrl 

YnKbA^r acg Amfhiurtd tif, 

Gr. ai MtrrdgM: M.A. 1. ISI. 

Doe'r oeddwn dnu oreti-ddaQ 



Ail, tin. a second ; one that is sitcond or similar 
to another ; a supporter. 
A hwjfbau iri>dl ordK^m bjvhfuia ao ouDjifArnu . . . 

EvyfxT" Brwthwi' ( l^f'^Khwr heh ei til^.yr li^-na dder- 
yniudd yr YBpryd bid wrthfemir.— /ff.Ni" iju^'i, 111. 
Pwy prilii i/n ail itUio I who was his second ? 
Mi B fjddBf JTi" Wtl", fl)*' BJ"f«ill.— H'o'irri. 
Ail, »c. a son or daughter (liko ab and nek), 
used in pedigrees; as Morfran nil Tcgid 
(=Morfran ab Tcgiil), Morfran the son of 



tegid; Dylan nil Ton; Drych-niY Cibddai- 

" idd. Comparea mth uft it is oi 

ee. and still rarer when it denotes 



Owyn ail Nudd. Coinpe 



fl Ail. denoting («v>«rf, or the eeeond lime, may 
be plaeed before almost all nouns and verbs, 
and ofti'n adjectives; but except in the case 
of a few long-established forms, and where 
the acci-nt requires it, it is preferable not to 
unite it with tho word which follows, as in 
almost every case it c«n stand alone; e.g. 
•lit /fldii-l. „il yKliiTinHk; ail frddylied, ail 
;/sli/rieiI; ail urfu. nil tlilufniM. A considerable 
number of words fouBdinserted in some dic- 
tionaries may thus, without any inconvenience, 
be omitted. A il may often be rendered by re-. 
but it is not coextensive in meaning with 
thnt inSFiparable partiole. When prefixed to 



AlLFSDTSDtO 

a monosyllable, ail should become ril ; as, til' 
waith, eikhwyl, tildrtm, nldwym. Wlien thus 
employed, wBethor separately or as a prefix, it 
is now generally followed by the soft sound. 
Ail, pi. ciliau, »/, a wattle, a wattling ; what 
is placed alternately; that which is twisted 
or woven in alternate order; a plait. See 
Eilio. 



Ylyfyt 






Ditw a roM, dilJ jw'' "U.-D^/iiM at Oicils-, «lnl- »- 
AU&drodd, v. to repeat, to rehearse, to recite ; 
to recapitulate; to describe the second time. 
Yd yr a^l Uf. }t wyf 1 Km uu (nuiAd Oist tuiw at ddyn- 
fon. ond rhaid I'r ucb a fj-nai r[ fjihiru'n ^fylbiHTi, ait- 
mtrt^u boL] hann yr >'fi.-ii|ryl, rn- ymhi^Wlhu ami. 

II. Ii'ti-ia : Bywyd Duw yn Enaid l>yn, SS_ 

Ail&drodd&wl, n. rejH'titious, repeating, rv- 

heiirsing; rGeapitulat<)ry. 
Ail&droddedi^l, a. repeating, repctitioug. re- 

lieursing; recapitulatory. 
Ailadroddiad, -an, am. repetition, rehearsal. 

recital ; recapitulation. 
AUadroddwr, wyr, sm. a repeater, a rehearaer ; 

one who recapitulates. 
Ailenedig, ) a. bom again or anew; regenf-- 
Ailanedlg, ] rated. 
1> aileneiligioii, the regenerate. 
ddyv^ wyt. Fe ddy 
fffd : CTfarvydd. S. 

Ailenediga«th, -au, «/. 1. the second or ne'w 
birth, regeneration. 
Don wpinidogarth AmbrM y dwbjnlodd Awatin tt ail- 

n'Ait„;l..-rk.,rl,. iy,™rd.: Han. y Ifydd, 1U8. 

^t aU'iirdiaaOh yw dyfodiad dyn allan o'l paUl fyd i'r 
U11Uyj1ybyw5dy1na.-Jf01-y.1n i'liTd.' Tri Ad.Sl. 
2. the afterbirth, secundina, or placenta. 
Ailenedigol, a. regeneratory ; reproductive; 

bom again. 
Aileni, v. [genii to be bom again or anew ; tu 
be regencrati^d ; to regenerate. 
Wedi pich a<hm. iiid a had llygredie. cithr anllyKredig-. 

1 Mr i. «8. 
YqiyBwch befyd arwrddion anaimiipdiA ac argoeliou di- 
anunhrUB, wnh y ihai y uulta pawb wybml jn hywir eu 
bod iredi ni aan^'teiddio a u fini'g'Tti. ac y byddont ia&w- 
^Ig.^YmuowyrboarwyddLonaaodaudidvyU yndajiffoa 

Nobrri Llu-si: Uwybt Hyflordd, 8S. 

lira, tnri.v .■ liryeb Yigr. 3M. 

Ailstifedd, -ion, am. heir in reversion ; next 

heir but one. 
Ailfad^dd, -iau, gm. a second baptism, re~ 
baptism, annbaptism. 

Hii-ui- ar iilr..iy.ij, V rhai a ddalianl na ddylid bedyddia 
Dcb, byd oniil oaia roddi bancs (mputhnr cyffH) o'i ttydd. 
WaUert, a-v. * Aiiabaptiats.' 
Dyn a (edyddiwyd unwsJth 
Tri y Dhudod, wiwnod waltli, 
Pam y ertd i nilf'dgdd 

Tn ffi«, fal yobwnc o'o ffydd I— iHrflM I><\fyl4. 
Ailfedjrddiad, -au. am. rebaptieation ; a bap- 
tizing the second time. 
Ailfbdi^ddia«th, -au, */. anabaptism; the doc- 
trine of the Anabaptists. 
Ailfedyddio, r. to baptize a second time, to 
Tebaptize. to anabaptixe, to rechrieten. 



AlLPBDIDDIOL 



TT TitwTll bob blwyddyn. 

f*orla Edward,: HSB. y Ffydd, S9. 
Oan fod 7 DoiutLatlBid ai? enill yn ait/fdjfiidv j rboJ a 
fBdyddJAsid gKa ca ffwrthw^Qebwyr, penclprfyuwyd tiad 
oedd J rhu aa <Kdd(ikt g-wedi <^u Iwdydaio ya enw y Brm- 
dod tianctaidd ddim i ^ael eu fuxU/rtl^iUio. 

D. hur: HiioM CtBtydd, 9«. 
AilfiBdyddiol, a. rebaptuing, anabaptiatical, 

. ftnallflp friTrin g 

Nm chyauDDder hwvnt dh IddyBt edifarbau, h cbv- 
hoeddiu ddiidfunu ea lumirir n'u kail/tdfddul UDirruKdd 

AilfedyddiwT, wyr, im. an Anabaptbt. 
Yr Aitfedgddwfir, the Anabaptiats. 

A'u tnedd Bt bob tywjU.— KifiMrrf Ai/j;rfd. 

Ansbaplista . . . Ai'/-li/M.r„: N.B. Nid y* y bobl s 
riwir felly ynarddel yreaw.— /^r, Pr, Hkhanla, i,v. 

Nid oe« yr un. fel y mno hwn, in v^wyddorimi y bobl » 
fimhcnirir yr Aif/'di^iidtosr. 

Ab'l Uorgan : E^wyddorkm y Gref^ GriaL 8. 

Ailff^gddv^r y ^Iwfd hiryitt y pryd hyny, o Moifid eu 
bod ya Iwdyddio y rhai hyny mewo uolrma, a^ ocdd ^wedi 
naiel ti bedyddlo o'r bUea yn ou mvliyd, 

li. I'yUr: Hun. Crrf. 4iM. 

Ya ol ea gnly^iadiia hwy bt f«dydd. nil/fHi/iiiii.'yr ydym 

ftdifddtcgr, J rhbid i ni ea hj-HlyriM hwy yn ddifcdydd- 

I«i„pl, IhrA: Uwuith. £31. 

, a regenerating: re- 

... ^1 falh bcl 

tr— ft. iJ«»i*: LlwyhrHyffordil, 
Ail^ylbdiod, -au, «ni. reaurrectioii. 
FBI y nllent wy gul ailsgfo(li<id h fat weU. 

£j^. ft. IM.«>.- Heb. li. Si. 
Pwy tminag yn owyllyaifBr n dyngo imudon w mncliiadd 
efovyl Oriat, nuient hwy ya hidlol yn jinvTthiHl A thru- 
^anidd Duw, ei ddaiaDi cf, ii'i •Trionuld, hanliliunt gauwl- 
V*etli, bj'wyd, dioddcfaiat, mu-voUctb, ni/gg/ediiut, m 
ogyniad ein luchawdn- Uulrt. 

Edunrdlamrt: Hom. i. )«. 

Ailg^ymmeriod, -au, sm.^Adgymmeriad, 
AilgTTch, am. See Eitgynh. 
AJlgywair, weiriau, »m. the figure cpanorthosis 
in rhetoric ; a correction of one's Belt in Bpeak- 
ing. 

A iigyiriir rv Sa^t InnwcddAwl, yn iralw itriir yn ?^ ot u 
ddyw^pwyd iinw^ith. er mwj-n dywpdyd yn wU, aim ya 
dynunoiviJdiach. — Jf^nri I'ci: EgJ, Ffr. xxxdl. 

AilgTweirio, f . to correct, to amend ; to eor- 
rect one's self in speakiug. 
Weithiau to «»ygic-irir y unit blurnomwg fal lijii . . . 
'KtitbaatTrSAtoni'.igic.Wii-ymui-a ul dy wedvd. uu uM 
jm.ntiaea.~Hrari l-Tri: Eg). Vir. imiii. I, -i. 
Ailundeb, »m. a second union, a reunion. 
Ailuso, I', to unite tie 80(»nd time, to reunito, 

a dininmheu y byild Iddl, 






liniitliu 



■y«. Mil 



corfT drachcTa. 



luflwyddau 



Ailfmgyrch, -au, am. repetition ; cpanali'psis. 
a figure in rhetoric, when a sentence end'* 
with the same word with which it begins. 

^i'^rijjrrfA yw dall ar OKHliadi epf, poo eymmcnr yr 
onrhyir kId yn neL-lirru ac yu niwfdd uo ounnud - . . 
DaU anil ar Aili/manreA y syrltl, pau adnjddir y cyffelyb, 
a'T^rdawdl iuuauiyn^dwedd,Ta nwlireuad a diwL-ddiHd 
nn iMoiiQd.— Hntji /Viri.- E«l. Ffr. nxtili. 
Aill, pi. eillion, ) em. t. an alien ; one not en-' 
Alllt, pi. eilltion, j titled to the rights and pri- 
vileges of a natiTB ; a stranger. 



SiUotnaiTaelb.— Taliain: A.B. U. 14B(tl.lSl). 
AiUlti <am ef ni chyd gtmia. 

. OeridnAnx, Mrridin ! U.A. i. OB. 
Ny Ilafaiaf eu ar Tyn trwydet 
Noc nlloD OeaOaBth gwell kaetb Dytst. 

dyJedugioa, a 

Xid jrm ni amgea na^ r^ilinit. a Rwyddwyr y llys hwn, ac nid 
lAmnBtm Bi IT I^a.— DiijyM Fgchan: Efeng. Niood. i. 

Paa y breiiuT y corddi newyddion ; h IModiDn, ae tiUion^ 
ac Cfltronltia, a guSaot eu duguau o'r tAir abenbged. 

Gwyddoch yu dda iava 



mai merch nm yw fy nawraig. 
Iiii/sdd /■•i,t/ia«: Efeng. NicodTi. 



I o addwynder girar«nledie conedl 



Taircludgyrch frei 
Kurwiad 

dangnek. — jdi0r4w j/wmiji^d.- u.a. lu. km. 
Mab aillt y beiriid, the protege of the bards ; a 

Crson not belonging to it admitted into the 
rdic order, as if by adoption, the bards 
being considered the patrons or privlorion. 
Cyfaillt [al. cyfaiU] a rant uiV/i [■<!. aill] y brinld. 

2. a villain (in the feudal sense) ; a farmer that 
rents land; atenant;anativo tenant; speasant. 
Mab aill, \ 1. the son of a villain. 2. the same 
Mab aillt, | as aill or aillt; terms of common 
occurrence in the Welsh Laws; aill and aillt 
being used convertibly. 
Aguedy mtirh rani '1,11 punt oe y Mignyll chumgeyot. ' 

Ao [ va6 nif'l y bydd ei brfodawr, ac i hwnw braiat rhoith 
B ddylit i Gymro eyiuiwyaawl. cr diwy^iuw crim ei wr o 
ifb -li'tt. A.<;\ vtbaHlt yn mrainC mamwyH y bydd cyviawn 
OHWdd Jtebi-euodl. . . Ac db argjwydd pricidawT it'th aitfl 
ei liunan a wnii yn n^bam ag ev, ae yu aaifbyvraith. nawdd 
argrlwjdil y tyvwlh iddo, neu y brouin. . . Ac nia dylit 

Cj-ntuf o'rnaw Boreagyn yw m-b ailU: mt yw nub ailU, 

Aillt famwi/t, ) 

'Miib aillt mainieysol. j 

Tri rhyw wr y aytld. . - wjft '\iift ra/Jravywirf, tev a vo ci 
vam yn GymnieB gj-nnwytutwl, uc < illwn yn mniini iii>Lia- 
vyn a'u gelwir y cyfryw ; a brodorioa, seT yw brndi^tion. 
Cymry Cfiinwyaain. hch fraoth, heb ulltnd, heb lediich. j-n 
y gvuid. ae ar y pedwiTyirirr y iwiv bralaC brodawr, neu 
Oymro .ynnwynawl ar -..;« . .v,™,^.,. cynnwynawl. 

<V;Mw« (■;<",■-, ii.B2fl. 
ISniiloT ae aillt, a native and an alien. 

Tri ffwniri'ion (rwyuwyddedig Yny* PrydaLa ; l>ewj ; Pu - 
dam ; a Tlieilaw : set u'u gi-lwid fi-Uy am y,ld eiyunt yu 
wF^reiim i dal bonedd, a gwritnt. b t-mlar, if tillt. b<li gym- 
merjd iia rhudd na gubr, na bwyd dh U^n. 

O dfyrn 1 aillt, from king to villain. 

Sot i.'u eelwid t<«y am f yncd. ci'u iptlt fodd. holl wjr 
Tnyii Prydaia o d-gn, i liui ya wJt iil.lyiit, 

7ri«.W: M.A.U.ttl. 

■noeuuawuacm... a ™.™ «u .a'^e" a'^^'fnwT' 

Aill, pi. eillion, i a. 1. alien ; not one's own ; 
Aillt, pi. eilltion, j unprivileged. 

Tri brea[n a fnaut o feibioa rillian ; Gwiyat vab Gwmn 
ynyiKwIeddj a GhadaTu^ vabCynfedw yng Owynedd; a 
Byfendf fab Blriddie yn DdKubarCh. 

TriitAd: U.A.ii.lI. 



alien by maternity. 



Frhslm ■ 



1, fdrych betb ■ idH y gui- 



CpmrtHg (V Giil, 1 
Oui J bydd »rwtli iti ffi 
o rywiriiud irrad ■ brm 

Niilnei[luor»rtbarlDl«haW(.— fl. ai Owilsm, III. T. 

2. ille^tiinate ; basebom ; bora under Kome 
. legal diasbility or disquBliflcation. 

Eitbr « heb (ronedunvUi Tdd ji-b. o'r hon j nue piwb 
pherth, bairlardi 



b. Uwjma 



'fyd7ch." - 

Ktg. rn^Ma^ BaM.- H*. ih. B. 

3. 1&7 (as opposed to clerical). In the following 
quotation tbe lay brothers of the reliprious 
houses may possibly be intended : but Brut 
Tysilio and Brut Gr. ab Arthur (B) have ' ys- 
golhaic na llyo ' and ' yacolhoigion a llygyou ' 
respectively. 

Ac ni orfwyuwd a bjt put diAirwiawd taAU«>h fr fault 
tnjn or mor pw^ Jfilyd y^rt a llad e m«bioD ^i^'ij-a ai 
efeiieit am^eigian arclodyTi'u. 

^ Pughe ^ves ' othvr ' as the meaning, and 
only meaning, of ailH, both as noun and ad- 
jective ; but I do not find it used in that 
sense. Davies has ailtl only, which he Ten- 
ders 'vema, servns,' with the remark, 'dc 
natiui tenentes dicebantur. ' 

Ailldu, im. Sec Eiltdu. 

Aillduol, a. See EiUduol. 

Ain, a. bright or shining P A doubtful word, 
found but onco : and occurring in a passage 
which appears to be corrupt. 
'Wjx Owenwynwyn wyn a wiu rfaKia gorphcu [iiV. ^or- 

BlFJddiu T (toeen [if. BMren] <■<» ei ififfirain. 
• Ef Nudd rjcd ddilDdd txiYnx ddilun. 

Llgtrrlyn FanU: M.A.. I. 3M. 

Aimc, pi. einciau, »m, grecdineaa; avidity; a 
craving; desire. 
OwuHpth drwy nnf ai Frplnc fnwt uiheilwg 
Ac ererrd s eniyd m chnta ddEHirg. 

£i«w» at Uniog <•!• RS-^<al: M^. i. 3». 
Yn Ro* a PhnmrD tu rTauaeu FVeinAc 
Uwyl«djc y fi«3i ja n-jtra. 

l.'mad (--"T,- M.A. f. »45 (rf. «S|. 
Dyn yw . . . llntr it'itt tamgfaadwj. 

H'-Aftrri: Bgl. Ffr. jd, 
Y netb y nuie unw? yn ei itrbcd. s VJpir ymaltb yn 
fynych ^an itibry ll«ldr.— (rr. If'^'tn.- Yatyr. i- ? il?). 
i4 iTic I fwyd, a craving or apputita for food. 
4ir) p'. eirion, sm. brightness; lucidity. — P. 
Probably suggested by the pi. ririim. 
Pe bai'ii Bwmp neu un twiapttji, 
ffiWMbyd, aTiirianbath.-«™f B'.»»,- Blod. Art. 118. 
Air, pi. eirion. a. bright, lustrous, shining, lu- 
minous; gorgeous; fresh. 

Air, Urtn, Iraidd. cruew.— <>. P". 
EsgyU eirion. gorgeous wings. 



Oblitb. 



itai an PI esgyll inoh rhiw 

rem yu tted, o jts^ta dvytbaw fry 

diidrwylawnNef.— »■. O. l-uflir: C. 






y tnKhid gyot 



£ir-f yssdd menihed ludah. 

C.,.r/nll«>rl, (DiwyKiwr, iv. SM). 

Airon, >.p'. bright or luminous objects : more 
accurately written Elroii. 
Rhifer y »er By oiVcn rtij-fodd I— i. fl. CaWr, i. n. 6. 

AirOB, int. scarlet. See Eiroi, which is the 

better form. 
Airot, ysgarled. — ffci'Wji /''■"/" W. Cymoal. 



^./.).».pl.Bndd.[C.a< 



laths; spars; thin narrow boards. 






Aia toi, laths used in roofing buildings. 




h. darts, missiles, shafts. 












* ' j«.™.- 


Oodc>diB,MS. 


Owstan LDfvr j'tam 
Ovelaia li. yn iwa 












ir.A.1. 




J. ribs. 






Kinboedhinuwy". 






Etgl^ion B,<U<t« Xil^r 


; A.B. li 


M. 


Ny thyrri. rym breich rygirdwys yr ™. 
piiui a bocUuir HO pflnba.— tlrmn-a ffn 






.- A.B.ii. 


H). 


U<inla ym bon, hum hunglwyf 






UlvaMi trwsyw d«n u;. TO*|,'7f ■ „ . 







is (ot. «sa). 

Ei (dlhring tyJd tyth rhwDg r •>«,' 

A pbaipu yn phyryf hyd eonyii 
Yn eis memr a meircb yu cochwy*. 

Cn-Mchc: H.A. i. t». 
Rhyftdd Tw-r •«. ■■n rhitu. 

FnldooglwydlJe tynwyd to.—Ievum Brgdgdd Hir ttf. 
A Keiriaa di^Dtoa ■ fa TyntctbyDt, oni miia* Oadmladr 



Ybyra 



' the short ribs. 



Ait llong, the ribs or rib-timber of a ship, 
Llysiuii yr ait, ribwort plantain {Plantago hin- 

ctiJata), 

CaIb audd llytdau Mair, a Ufiiiia'r aia, Uwyohldydd j'\ 
gelwir.— JffiW^M MyM/iti, ii, MC. 

3. the costal region ; the breast or bosom. 

T tun a naMh new yn T air, 
AgM»f,ad«gmi.l 

D. aft UnrUfffK, rxriu. 1 [cf. clvii. 1), 



Culyi 






Uairer irwaith y daiUnia 

O'Ifa wJT alaeth yr wylal^ 

Ac yno'r aetb naeu-*a yr nu. 

ITili:!!! Lltrm: O.RC. !NT. 
A ohystadd di fudd i T oii, 

AnndiU y afiriduiiii 

•Jwlad fy nuetfa, tu glyd i'm oil. 

/nan Krtd^i Hir : Omitfa, S3. 

Ai«,siH. want; nPod,n©cei»sitj; absence. Some- 
times treated ax the sing, of eigieii ; but the 
latter is always sing., though, like many 
similar words, often written in the pi. form 
(ei»t u u). Eiiitu, eiiiived, eiiiu-edd, should rather 
DC considered derivatives of ait. 

X aJ a'n x^ant daw'r fanbua ; 

Tn bo y hyd. Cyr bob •».— finvi »>■ .- BI, Art. 140. 

Aia, a. wanting; in want of; destitute; lacking. 

Disgybl Bias wyd rii-rwUglal, 
Oyiit wyddla, plald eWteddtod. 

Edm. Prg,. 1 W. CyninJ. 

Aiag, »m. the sap of vegetables ; juice, sap. 

Jwji. noddUysiao; mg-uarhywbetb.— O.r. 
Aith, a. [It. aith, Cormac's Gloss, 8] sharp; 
pointed,— /'. 



Aith, ».ri. [cf. E. health') tune, gorae {f.7«x): 
the same as eitkin, the tenu in general use. 
AHh Ufa tithiii man, dwarf furze {Vitsc naaut). 
—Hiuih DaHet ,- Welsh Bot. 69 (cf. 154). 
Pnun nodnjddBii fm diddwrn, 
Peafar o at(«, jnm u Trwyn.— t. O. OilAi, i'r Ttxt. 
Aith, am- fthe assuxaed radix of rithaf: O.Ir. 
ethl} the nigheBt or extreme point ; the acme. 

Wrth ddirpi r Uib cjmtcflfc Idd j bjA, 

• : OolfUdd Owyiudd, U. S17. 

Al (a), pi. elod, eloedd, »m. [C. d (pi. e/erfA), 
(iiV, angel] ' universal harmony ; beneficence ' 
power; an appellation given to inteUectual 
beings, or angels. There is an ancient al- 
legory called " Tmddiddan rhwng Cedig ab 
CjTimonwTa ThTwyBOges yr Elod." ' — P. It 
is doubtful whether the word exists at all in 
any of the senses here attributed to it; for 
they appear to be nothing but inferences from 
its use, or supposed use, in compounds. The 
jj. elod or rloedd is evidently formed from 
et, q.v. ; and di/d of the ' Oododin ' (467) may 
possibly be a plural of the same word. 

Al (a), -ocdd, «/. (Ir. and Oa. al. : allied to L. 
al-o] that which is brought forth or produced ; 
a product; a litt«r; a brood. Also written 
atl. 
Tr at gyntaf, the first litter. 

2. the young of animals, 

Al, p ob pgth ieuuu. Ui y mu plantyn, ebol, ejw, »'t 



KhT fowiA u beo al »dJ.— C.d. 
4. progeny, ot%)Ting; a race, a nation; a tribe, 
sept, or clan. 
Al y Cymry, the Webh nation, the race of the 
CjTury. 
Al y lAoegrwyt, tiie nation of the Lloegrians ; 
the Lloegrian race. 

Twr CiwiUird addwrn Tnj* Prydkln ... ail oeddynt id f 
UnfTvtt, a ddsethuit d dft Qvu^wjn. aa n tuUKeddynt 
bnf ftracdl t CynuT ; trjiTid ofddTJit j Biytbon, u o 
dir Uydav y dovthiuit, a'n hajua o ffynefln nl a Cttmy//. 

r™«W.-k.A. 11,08. 
Nmd fymmravd ni jf C^nr^ 

Got oer fro ogleddawl fry,— H'. O. FttgAe: H.O. 68. 
UMgTT aJuaenrmUmelyn.— CiriufiMv; U,A, i. SIS, 
Al Wyddyl, the Irish nation. 

TUr dwdmrd uwdd ■ ddaethaiit i Ynys PrydlUn ... ail 



«dd yr <ri Wffddj/l, Ac yn yr 

OoTfu al enu! da, the best pedigree or extraction 
is a good name. 
Al {a), a. [Ir. all] excellent; superlative; utmost; 
extreme ; very. 

Bnuch nl hir Bnx*wel n'i hyd; 

Blif Onennityi ■*■ batt geayd.— Omiii aft LI^Ktlfn Mini. 
A1-, Jix. a prepositive particle followed some- 
times by the radical sound, and sometimes by 
the soft, denoting irry, great, high, excreding. 



It is 

or Alclud; and of rivers, as, Alain, Alan, 
Alun, Alaui, Alwen, Adal, Caihal, 



lidonally a prefix, and rarely 

1 of places, as, Alban, Aldwyd 



3 Alap 

Vdtyr ' aV ■ yw rhajoTHWl ■ (fwych, 

DoM byo ya hymiyfl i fardd ; 

A *bert* yw b«rtn, tfalr Cytnrae^, 

Albert, KfpwThyiiodhardd.—:r>vi<f.' awallb. lite. 

Alaeth, -au, im. [al--facth] lamentation ; 
mourning ; wailing ; sorrow ; mournful grief ; 
a great, deep, or Wtter lamentation. 
leuaraunuethtnll u: al'b-iA.— IHfL-iiii; H.A, i. 90. 
Ovan yn oL rweDvyn afai-th 
Qwawa wodd awla a loodd a'l maeEh. 

Cl'i,f. ab tli^ldd : M.A. i.4M|cr, SSO), 
Dielld Hab Dun dygn alarlh Hyve], 

Peru "<> Cti'/i' ■■ M.A. i. StU. 

T llaw ^n wag. allynawaetfa!— Y>. pb Gieiif/aifeliTu.lB. 
At hoU beuau Cai Uoab, a'i beolydd oil, y bydd d^'iA. 

/tr. ilTiii. sa. 
A dUy> oa laid lUnrH 
I Fan am ei meibion muth. 

Untw, (hMiy IS (cf. Sb, IW, 118), 

Alaetheg, -au, i/. a moiunful or plaintive 
song ; an elegy. 
Y mae genym ddaii gyflelEhiad aiall a'r alarl 



Tyu:^ 



Uaiie, 1881. 
AliMtliiad, -au. em. a lamenting, mourning, or 

bemoaning; lamentation. 
Alaethol, a. mournful; doleful; lamentable; 

wailing; bemoaning. 
AlfMthu, V. to mourn or lament bitterly; to 
lament, to mourn, to bemoan. 

Tmwnn^wcb mewa sacUIain; alarlhtivli, a gvlblirch 
dan y gvrychofidd. — ler. xlix. B [ct- xlTiii- 17). 

Alaathua, a. mournful; doleful; lamentable; 
lamenting, wailing, bemoaning. 

»..f-,r ..-',- <-..°<fabiddeuDydddau'iDdfaon 



Alaf, -oedd, -au, am. wealth, riches, opulence ; 
treasure; what is rare, precious, or valuable. 

Gwae hwyot peoacThau o clivant atavait 
A dyr derodau ac a'u diva. 



AthdiraUide 



ir^t^'"" 



MeigaKl: M.A. i. 180. 



elyf atb elnch 



8 (c{. 3 



. m). 



Dyhopcyr aUif elyf doiL 
GwBdy dwyn o Vbido y nuucbdgyon o enya Prydeyn e 
liyTodaRaDt gwyt er enviiaued ewyd sd y cbyica ac annyth- 
yaw en enys n]Tdieu o boll amylder ^lut or a oed eady o 
eur ac aryavt ac alu/ofd nvyll. 

Br-l <■>. at Jrlinr: M.A. ii. »3S [cf. IBl]. 
Arwytain (tdch Criat a oreuraf , . , 
Elen ai tafa^ itlaf yaprydavl ! 

br.i-bilrr^tdd: M,A. I. 481 (el. W9). 
Ac ynsyreir oe boll alavoed a« haiuu^cu. 

Mabiaoffion: ill. Ifll, 
Ai loywf eirdd yn cael fli nlafas. 

Or-ff. ah Ucni^ .- M.A. I. «I. 
CyVTaint a'i iml, neddalr nUif, 
Bunbydei- ^"-- 

Fy nlV arbedat fa ddarbodna, 

Diai Wipi: Blod. Alt, 110. 

Alaf, a. rich, rare, delicate ; expert, dexterous. 

Ala/; blaaber; petli hardd Den hyfiyd ; aDunenlliunaidd. 



Ultbredawr Uyry Uon oand. 



,>gle 



Alafedd, -ai 

DiigyiultHi 



m. wealth, riches ; produce. 

'"".(n'.irin/Orjdodln.ffla. 



Ala^ar, u. loving riches, fond of wealth. 

Afttiimc VT^ cbgHT wrih r irilr'l- 

Tali-in : U.A. i. GO fet. A.B. u, 399). 

Alafog, a. wealthy, opulent, rich. 

Keuciit elurdtn a/o/oiri: 'prinled iUik.-' niyiil. 

Z,l,.i<™rrS ai Ll!,<rt!i-.- W_4. i. 30*. 

Alafon, -au, »/. middle part, centre, middle. 

V»l J kynodvit kymryt tunie rntea yr etl llpchwuew 
noe<l acn y law. ju* oalf ar (Mi haL ae aruoH aoruf? Umw 
mah Gffacd. no oilif jntni ike wan yn ainr.on y dwy uion. 
hyt pui dardawil yr Tneui^uya allaji.— JT'^frinoy^, ij. 2^. 

Alafrodd, -ion, »/. a pecuniary gift. 

Gretyf ciiyawn ny gnva ny iryny (formot 
Ala/rol Elifry.— (.'jiuW-Jm^.- ifA. T SST. 

Aloid, a. superior, excellent ? 

CYHefin im byd a fu eiMywyd 

MynEldi alfi/pyrnam dyweid.— raliMia.- H.A. i. M. 
Alain, a. [glain] bright, ahining, lucid, brilliant. 

-^lulo Gliiasary. 
Alan, -od, -edd. tc. [Br. alnn, alata {=W. anal). 
breath] 1. an animal, a beaat, a brute. 
Ynteu Pcrrdur a (fycbwynnwys rai:daw. ad ad«uth y oaet 
ynyal- niDWIhyr dynyop tdk al^nnl ajs ^weLei. Damyn 
(rwydwell a llyMeu.— JfnftiJiojioii, I. MO. 

'i. In the Welsh Laws (i. 20) attiwild appears to 
bo the game as elanedd {ig, elain), fawna or 
joung deer. 

B koc ar dy^teyn pr«ii crruyu anan ncryhyl, seT flu ei«y 
hsiy. pyt aniK'v J dflueyt ar huyn ar inpnou ar yrch u 
u'OH'-r, apopanyucyl man a del yrroeu yr kecyn amdaiiau. 

Alan, tin. colt's toot, eoughwort {Tu$$il'igo).— 
H. David : Welsh Bot. 78. 154. 
Alan fflawr, comiuon butter-bur (ru«i7a>f<i 
prft«j<f»)^rf<it7 y try fan. 

Alan hychan, common colt's foot [Tuuilago 
/ar/ara)^cam yr ebol, paychlys, dail traed yr 



1 Europofuia).- 



ebol. 
Alan hen, asarabacca (A» 
Meddygon Myddfui, 290. 
Alanedd (a), on. respiration, breathing. — P. 
Alanoan, ) »m. asarabacca, hazelwort [Asarum 
Alannon, j Eiiropaeum)'^mm yr eM y gerddi, 
gwrthlye, llyiiau y eyfog. — Hugh Daviu : 
Welsh' Bot. 133, 154. 
Kymryt Iridi™ (tudnc or llyawu hyn ; y kyjget. ar try- 
dun, ar troetrud. a gwrthlya yr aiannni. 

Mrddi/giiit Muddfni, i. 11. 

Al&nu (o), V. to breathe, to respire. — P. 
Alar, -oedd, am. a aarteit; loathing; disgust; 

distaste. 
Ptri alar, to surfeit ; to cloy. 
Alarcll, pi. eleiroh, elyrch, -od, »c. [C. elerch, 

derhc (C.V.); Br. alar'ch (pi. Sler'eh) ; Ir. mla; 

L. olor'i 1. a swan. Generally maBC. in N.W. 

and fem. in 8.W. : as, alarch gwyn (N.W.) 

^alarcb wen (S.W.). 

Ueinli eilir iMrci a n^irch ^wehi 



fforcAsn il<lMtrw 



ll(rf.M 



GorwiD piflc tbth rleirrh t^iu. 

I.lg«^,d- ff™; M.A, i. IM Id. 4M). 

Ll«triUuarbdituIh'l».vV— JVa^x-.!. MJI. 1. 181. 

Ac yno y dan^nws y nwr boDpdd^is" iddo yvtafpU mor 
wycba'Tirwyrhaf ynyplni*,aA-yi>ddi Wf^lyoFanhld.^/'rrrAMl 
o fewn i babcJI aidaJiwiflir ornirtild. — IoIa Mat. ieD(c(. 244). 

Bbyii bael ym- a 



Bhawu 



I i hwn ufl einm. — 



Pu ffaDO Irya el ddbwedd. — Rptrimi Vaugltatt. 
Nid balcb and al«rrh.~IH»rth. 

.<la«(aiiawf(daniKo.— il'Ti- »>.■ Bl. Aif . 208. 
Oolchi Irard yr alarch, to wash the blackamoor 
white. — Dianb. 
Alarch ieuaiie, a youtig swan, a cygnet. 
-4;nrcA gaiylll (N.W.), 1 wild swan.— P«inan< .- 
Alarth Uwyd (N.W.), ( Brit. Zool. i. 119. 
Croeii a/iircA, swanskin. — 11'. 
2. Asinthecasoof several other animals of noble 
bearing, the poets often apply alan^h aa a 
complimentary epithet te their patrons, or 
the Bubjocts of their panegyric. 

Tudur Llwyd, hyder'y Ufrw,- ruJur JW.- O.B.C. MS. 
Alarcbaidd, n. swan-like; resembling a swan- 
Alarcben,/. 1 -od, $. a cygnet, a youn^ 
Alarchan, c. j swan. 
Alarchea, -au, tf. a female swan. 

Mae -larrh', inal iyrcbell. 
M6r yw CI cbyanor a'i cbdi. — Linwddrn. 
Alariad, -au, tni. a surfeiting; a loathing. 
Alarllyd,a. surfeiting; loathsome; disgustiitg. 
Alarllydrwydd, on. loathsomeness; Burfeiting. 
Alarm, -an, »/■ [al--|-garm: a modem word 
formed in imitation of Eng. alarm (^Pr. 
alarme. from It. aU'annf^U) arms ; Sp. and 
Pg. atarma) ; and intended ta convoy miich 
the same meaning, though the two words 
have no element m common] a great shout 
or cry ; an outcry ; an alarm. 
Mao y Ui yn y prntret yn dra gT»Bii(tarpditr, ond taenodd 
yr aiamt yn tubii, a daetb allan ddivon o lEynnoTthwy wyr. 
a«„lird)AI, iv. IW. 
Cami alnrm, to sound or cry an alarm. 
Clock alarm. | an alarm-bcU, a warning; 
Clock alaruim, ) bell. 
Cyn y ireliuiedd hon yn y guledydd hyn canodd rtof* 
'ctiir/f.SdHnrdt; Han. y Ffydd. ISS. 
Ond era ^rpbonn tin pnidd tfrchwyt hwn, 
DolelaiVjlocft o/nna at atfan.-BtoAi. /mn.af, at. 

Alarmglocb, glych, glychau, «m. an alarm- 






brtninawl fel » be 

"'"'' ' 'cv,MI,fc>, {C.a.U.-r.lU). 
give a great shout ; to alarm ; 



Alarmu^ 

to sound an alarm. 
Alaru (i), i*. te surfeit 

loatho. 
Alaru nr, to bo surfeited or cloyed with; 

cloy ; to be tired of. 
Alarwm, »m. [from E. alarum:=alarm] 

AtarwtA haf eloimwg- — D^^/dd SawMor, 



A'm dHfrGofl o*m crnton bliU' — Svm Uvyd, 

Bti> alarvm J chvcJI a ffndwyd ac m dderbrDiwyd gan 
jtholl Imm.— H-. tn««:Th.y b-Hh, lag. 
IF Sometimes it is thortened by aphesis to 
lartoTn, like Ens. /orion, or it is borrowed 
from the English word in that (onu ; but in 
any shape it has hardly been naturalized- 
See Num. I. 5, 8, 7, 9. 

A'r dduAT Toddal Itrvnt, 

OvirJddlufa dta^a dr9ta.—Trfid : OwBitl, IIT. 

Alaswy, a. slaughtering or killing. — P. 
But ongtT uigfTt o^aJviFv 
But hrrbyT gwvtd ffwve hruyr H vwfltwT- 

lS,mlJ./».- M.A-f.iM. 

The word is probably a proper name : com- 
pare the following : 

Ufmlrn U7W tCTTiwdd 
TlTIiidnd Ifliriurn u Alampg fllr 
I dPTTn DtgtBWT.—ifrx'. JrtA. i. soB |cf. Ml|. 
AlHtbr, a. polished; glossy; polite, accom- 
plished ; reiSned ; splendid. 

Byv ft ddjlya, Bwydd I'otAr, 
An mUi K Coa, bob Unn lifttbr.— /ob JTh. 340. 
A pbflnidd-ffidxu! tetrn, n chjwir latai, a ohidoii iitidd- 
flURji . . . ftc oJoMr gTTmeddfui aenh, ft bleg Ariui-ddwT 
yn Afonig eiTi^n-ddoL—WaiwtM- Jft 
Alathredd, tm. polish; glossiness; politeness. 
Alathra, v. to polish ; to smooth ; to refine. 
Alaw, pi. elyw, «n). and el. the lily; white 
wat«r lily [Nympkaai alba), — Hugh Dai-iea : 
Welsh Bot. 154. 

Ac jTrtimdnri nawjd kpin wynnet a bloden yr 

thmeryTTDdJ. — ftiiiipa« CAo*'" '*' 

Bij tnjiirdd, hydd azrat 
HvTiul rn Urn, ffwya niai 

Ovimaeh wd y lAnswd U 
u^win mDrriL— Am TV'i'i' 
T foo otm-U« Ihrli 

Uorfrdd, brrdpiln , .. „. , 

D, ab GtcilgM, ixIt. i. 

Alaw rreufyll, lily of the valley {Coavallaria 

majalii). 
Alaw diotgo, water aloe, water soldier {Stra- 

tiiArt alnifUs). 
Alau! gerddi, white hly {Lilium ctntdidum). 
Alaw lleia/, trogtat [HydnirhaHs niimu-t rnna«). 



Alau! Ilynnon, Blephara Mtddygon Myddfai, 

■2S3. 
Ala'w,-OD,-aa, «7n. 1. mnaic; ' the term is mostN 
appropriated to instrumental music' — P. It 
is now used in the literary language for any 

Tn CD mytg j oIttIt raavl 

Jtucnii'rbMddteuJiuiwI.— /. O. aarianyild: Oeir. 6«. 
aiRiiBl uiuw IV gyWTBW 

Tn Ilawn aiaw, oU yn vialan.— TV^.- Omlth, 88. 
^ d/oH aaid a Hmluit eflwron [ 

W. O. Pi,fkt .■ B«ild, iii. i. 
Ymlvrbnt niTr o ^leh y bertli, y oat, a'r dyffryn Ecg, 
I WTondaw ar beronuth lerth y ffog, a i Ao/uv chwe^. 

Baril'i alaw, doctor of music. — P. 
2. a tunc, an air; melody. 

Xi* irellir pu-l perffcitliiAch alaui na'r oughraiff t yma, yr 
han lydd yn Bysunnd mor bylithr ■ obyd^nylltiol M DU 
gellir mcUiQ y cjwamoi.—J. JfUli,- OnjD. Cerdd. im. 



.' M.A. u. 



AlawoH, mnsical compositions, tunes. 

O"! hyn y dyjtwydd^ (od yr alutrm hyn;;. y [hid s bmnt 



aetbsdwy i ytipryd y 1 
■nliuanaiiK.- Han, Cym- ^ 



Glau 






Hwddn 



..a*f.- B«nld,iii.S. 

Am yr hmerlad loai trwy y dyfodiiid byti o (rerddorioii 
n't Iworddon y cafoild y Cjinry en hoU wybodnsUi o nlawoti 
■ cheridorineth pelriannol : nis gtHal onil rhyfoddu n 
lodd y <a(odd PuweI ei nrwain i nrfpra y (ath yTnadrodd 
a^Ageirjneiwidih.—f'amKua'i't'ccr' Him. Cym. Baa. 

Mae tirywpn byd a nl^fcon CymreU na chyboeddwyd mo 
honynt mewa aodau ymarfentl. — Prr/lfmn, iii. 3SS. 

Mot hyfryd »myf (fli-wM eatbl dy lo 



arllawe 



yUwynf 



3. >/. the air, or leading part of a tune. 
Ala.wiudd, a. musical, tuneful, tunable. 

Cattu yn atawaidd. to sing tunefully. — ir. 
Alawedd, sm. music ; singing, caroling. 
Brwynedd alnwM ran na liwia. 

'^ /on»««a*»C»™;,.' M.A.i,SSS. 

CftD fot hyd no* dan wu 

Olwynion lOam'mii.—DniA Wff - Blod. Art. IM. 

Alawi&d, -au. tm. a performiDg or uttering 
musically; a musical flowing or movement; 
musical performance. 
Dwfr iach aloew ; dUyrwdi ?wlad, 
Tnrilia'iVnicarf.— T-fjuJ: Omilh, JT [cf.7§). 
T mae yn rbitedd (od yn y cyfirw ndym ymiolhlad o'r 
byeedd y Bweddui ndmniad a bEToriaeth yn ndwcdig-, 
trwy en oelfydd-dm. ym mhlith yr hoU aiawiadav dwya, 
a'r aoalnf rydbletbiadau dyryH. 

Canthuaiawc: Esn. Cym. Ml {et. 6*2'- 
Alawol, a. muncal. 

Byddai , . , If or Ceri yn arter ifwaliodd et ffyfeillion 
avenyddairl ac ntauoW. bob Nadolig. iddytod i ymnelM 
ag et.—Ci/lrlfraKm, li. lot. 

Al&WT, 1 pi. alorau, alorion am. [the same word 
Alor, j as Alwar, q.v,], a receptacle ; a plate. 
Tri liieUi hoSaidd i wr ai oi pniaw : oyllell awehuf ; 
pwynod flsfDllcia ; an nlaiiTglin.— TVwrfd: M.A, iii. 7». 
Alawydd, -ion, am. a musician. 

Hwu, I llav nlaiKi/dd modrria. 
Ao i theiialad bardd ffurddi^a, 
TaiBW cainQ a wnai jn aydyn, 
Bnidd oi dolef, ar y delyn. 

/-•so Tricluvg: Bardd. i. 1 {of. Oi. S\ 

Albon (dn), -au, sm-f. a cardinal, principal, or 
primary poiut 

Ir albaruiii, the (four) principal points in the 
ecliptic ; the solstitial and equinoctial points ; 
the solstices and equinoxes. 



^Dau iryfrif y sydd ar flwyddyn; nnyv blwyddyo 
ag ynddi 9SS o ddyddiau ; lusll fvt blwyddyn Ueua 
TDddi JiM ddyddiau ; a*t dyddiaa dnM Zi«a rhif blvy 



blwyddyn 



Tsir (^Isdd a famer yn nawdd Duw a*[ 
^wleddoedd y pedtdr alAati.—Barddag, u. 6S [ 

Alban arthan, winter solstice. 
Alban eilir, vernal equinox. 

AlhAn f^ir yw palan ^mawTU.—Iliinldtif, 1. 

Alban hefin, summer solstice. 
Alban el/ed, autumnal equinox. 

Alban rl/il yv ojan iiJ&nd.^Bnntdiu, i. 4 
Pedwurban hatd; «cf jj uXhan a^t^^Jt^, yx 



tal fayn a' 

dangoef, t 



,)glc 



■Ply crntaf yw'riT/MiiiTWArr>^,B'iflymiu'yddcvfodddydd 
D fis Rbai^FyT. pan y bjddo dydd byrsf y ^nBf, nV dydd 
byny y cyiitaf o'r flwi'ddynn'r FFAuaE, hpnri'dd defM yr hen 
Grmry, a ^yfiif y beWd herwTdd h^n irof h cbailw. Yr 
iiiIyw'rolinnriVfr,s'i>>-Tth«ryddc((fetl " " 



lyrth «■ y d(ir>efeil ddydd o fla Mi'htlti, a dydd 
■--*— - '-1diiwy»(yrhat. Y palwcrrdd yw'r 

^lerff^d ddydd o Oi Medi, a'r 

A ^^fyd dydd cybydtdd tianl 



dydd cyntif o'r a,. -,^ - ^ -, , ... - — 
y mnyryd. Ac y dyddiau hyn 
J-"-n a'u cadpinau, 



. Ydyd^oaa™ yi 



dydd blaei 









AlbrM, 

Altirast, 
Albryat, 



QwanTyn o'r nlbtn nrAmt l*r nlbftit 'iltr, ac o byny hyd 

«. ^it. — i..„'^ ^cohyny haf byd JT alb<in fljtd; ACO hyiky 

itbtn nrlfi^n. — Birddaa, i. 41S. 

_._ -,-,— J y cybydddd, albanau, neu Tadd cyntaf yr 

hwnld, y crunc. y fantol. a'r afr. 

Bob. Bolnrlt! eeryddJneUi, 74. 
To iaitb yr ben feirdd. All}an ai-rtnn a Brwyddai fyr- 
ddydd iTauaf ; Albam ritir, cyhydedd y ^waowyn; Attntti 
Af/a, hirddydd haf ; ac JIMn <//«(, cyl^dtdd hydref. 

Albenaidd, a. relating to the aolatitial and 
equinoctial points, or solar quarter-days; 
quarterly. 

Tnyfl. 1806, Hosodwyd i fyoy yn Uundflin ^'•'"^^'■d 
*lbaitaiM oeu dnmiBol, tan eiiw Y GtcaJ. 

(IteaUIir MrrliaiH: Onitb, ij. ISO. 

!-iftu,«m.[O.E,a(Wae(r*; L.L. a76a- 
lieta ; O.Ft, arbaltite, mod. arbaletr: 
from L. arcubali$la1 a crcma-bow, an 
arbalest. 
m fetba fratb, 
. . [al, k't] niirai trwyddo'r efl-btalh. 

h'Kfydd ab Qu/itjfl», xdv. 51. 

Mardh a ducpwyt idair ocd ryut y ivdei noc y kerd^ y 
qnaJTl pao eUyvit o nittrajl aiajLTa. hyt Da *iniacth J>u« vn 
Uwdynarall kyftot kc ct. -tanpax Cl,..rii,<aan,iei iel. JO). 

Nadiaf dyniatrt ■ ohwBMl megys pei delel o nVftru.i ac 
yntorav ymporned y ^loiyD Bocd yn y neuad Eeyrbtooii 
7 brenliin. — ft''. Orcul, i 230, 

^I»ry>,bn<sroa,Bcio«bov.— If. Ailuaoi^, n.T. 
Albrysio, v, to shoot with a croaa-bow i to uae 

an arbalest. 
Albryaiwr, ) wyr, am. one who shoots with a 
AlbrasiwT, j cross-bow, a cross-bower, a croaa- 

bow-man, an arbalister. 

Tltliau, alirgtlm; tntkia, 
Tadodydd defaydd-wydd da. 

Dafydi ab aviBfn, icix. 47. 

Alcam, ) »m. [according to some, from L. ori- 
Alciui, ) thaieum or aurichaitum, a kind of 
biaas; according to others, from althemy or 
akhymy (old forms, alkamy, tUkamye, alcamy, 
aliiiamy, alcanamy, altomy, and other va- 
rianta), ' a certain mixed metal, which having 
the appearance of gold, was yet mainly com- 
poaed of hrasa,' Bometuues callod 'alchemy 
gold;' ct. 'Paradise Lost,' ii. 516; 'Prompto- 
rum Parvulorum,' S. Unlesa atcam or alcnn 
originally meant orichakum, as explained by 
Oaviea, and not tin, the word is probably of 
native origin (al- -(-can), denoting uAi'fe metal, 
which is characteristic of (m, but not of vri- 
chalcuia or alrheaiy'] tin. 

I a Un bmf dy goOiadi, 



Mi 4 ddychweUf fy Uaw i 
lu a dynnt yntalth dy boll > 



m cyn amlcd a'r pivin. 



Prcfl, aco/ram, ah«iani,a]^inn, ydyntoUyngngfauul 

y ftii.—Mft. xzii. IS (rf . iirvil. lij . 
Dylal id gwpui eacmmaitaidd lod o aur nen arian. gTrdr 

aea al^an, ac aid o bridd.— Krului; BrntaaiBna, 4t«. 
% I am not able to trace the word in either 
shape further back than the second half of 
the 16th century. .^Jcanis theforminDarieB, 
B.v,, but in the Latin-Welsh part he explains 
{mr:halnt«t by 'lattwm, coppr," and etannum 
by ' plwmm gwyn, ystaen, and so after hint 
does E. Lhwyd (1707); aUan in Thomas 
Jones (168ft). alcam in Bhydderch (1725} and 
W. Bvana (1771), ahan or alcam in Th. Ri- 
chards (1753). iifrnm and alcan in Walters 
(17iM) and Dr. W. Richards (1798); but at- 
cam in Morgan and Parry, and all subsequent 
editicms of the Welah Scriptupea. The word 
finda no place in Salesbury. In the dictionaries 
here enumerated we see the influence of the 
Bible tranalatora on the one hand, and that 
of Dr. Davies on the other. Pugbe, it -will 
be seen, is not to be chu-ged, as he often is, 
with having forged o^coii out of almm, what- 
ever may be the origin of the word. It is 
unknown in the other Celtic dialects. The 
oriibimnit (gl, aurieahura) of the Oxford 
Codex (Zeuss, O.C. 1061) may posmbly be 
intended for what we would now write aur 
y myuydd, mountain gold, a name which it 
ma^ have obtained from its yellow colour, 
aaaiated by the confusion, existing in Latin 
itself, between aurithalrum (from nurtim) and 
orirhakum (from wos). In some borrowed 
words the Welsh has a t«ndency to change final 
n into m; as, taffnimt (E. taffron]; rheavtm 
(E. reason ; Fr. raixm ; L. rafion-fm) ; patrwrn 
(E. pattern); offrwm (L.L. offerenda; M.E. 
offfrat). Cf. Zeuss, G.C. 821, 822. 
Alcanaid, a. done, plaited, covered, or coated 
with tin ; tinned ; made of tin. 



vwntbi^ofdd 
tyUJefyddaid- 



Dioi yn aivtnaid, ^au yr up pvyll. 

ItcdJgfon Msrid/ai, 887, 
in ArtbuT a ddodes ddosparth y Ford Oron, & 
JUA ei marcbD^on, ar ddataiai] f«^ 



, [Bl--|-cun] 1. asovcreign chief. 
— i". ^. a man's name : Alcun ab Tegid. — P. 
Alcur, -iau, am. extreme pain or affliction; 
deep sorrow ; distress. 
Tna ydd aWbwyj hen (aioh aynwyrgaU rf, yi him a 
welUHilawcrodratFertlitoDn tbiofvdeUu byd. ac a welaaai 

ei yiifydrwydd. — io!o Mts. 176- 

Alcwyn, -aii, »m. [al-fcwn, cwnu] a high thing 
r obj ect ; a high point. 
Teir alcv'iin la y twyn t^.—SIm Crri, i'r Pawl Eaf. 

Alch, -au, if. a gridiron; an iron or brass 
grate ; a grate, a grating. 
Alcli bra, a brosen grate, a grate of brass. 

Ae ete a wnaeth i'r allor aid bna. . . Ac «(s a fwrlodd 
bedair modrwy i bodwariwryralr* brrt, ifyned am dioa- 

Njdoodddiiu MnjnjTatiA. — Qwiftifdjidd, viL S82. 
Camom ditn mawr o favn gveii eu peaCyrni ar en 
BJlydd ar j Uawr, hab aWI o nn nutb. 

Tieid : Adroddiad Addyig. 84. 
Akh gledrog, \ a lattice-giate, a grate with 
Akh ro'yllog. ( cross bara,— IT. 



jM.v^.(,K»t;ie 



Alchas, -I 



lu, •/. a grated hole ; a window. 

T llechini i a hyn^ yn fr ngril, 
A go gyftedln gwnal yrhnan trwf 
Yr nlcAu srliri unsl gyda gw«n, 
A mod lenni mMrya jn ai laith. 
'Ai a Bjdil TUMI I '— faw/aUiiPc*. 

Alad, fl. [Ued] cTen, flat, level. 

pan AdaKer y til- rng ngoipbiT' yo g> Imellt. ^wnsla 
«f moT dfatf a« a f o acAo« ; <aju oa ■mg«n j bvdd, perygl 
liTwyd eidioa ^wan ja y ^uaf, lle'dd el ar a gefn yn y 
nyr^ fal naa gallo ffwim, ac yoo y veill hwDW farw- 

Cynahor Tad Tui /'oi {lolo Oloag.). 

Alel[P] 

Udc yr doc dyrel du^ymiyal aid. 

Oorduui C,Kftlsr,: A.B. ii. 8G loT. U.A. I, flO). 

Alcliwia, pi. aleliwiau, sf. [Heb.=:' praise ye 
JahorJehofah:' Gr.'AAAiiXoifiai L. ^He/uia] 
Alleluia, Halleluiah. 



Ai: ar al 7 potbiui hyn, mi a slywalA me^ya lief ocbel « 
dyrta f am yn y nel, yndywedyd, -ifaloiii. . . Aoolwai 
7 dymdamit Aieliua,—Dad. lis. 1, 3 (ct. 4, Si. 
% A ^ord; Heb. expreBnou, bat conunon 
derotioiial Welah poetry; more usually and 
'y written and always pronouneod Ha- 



Aleliwia, *m. [E. alUlaia, halltlty'ak : said to 
bear the same name in Qerman, French, 
Italian, and Bponish, and supposed to be so 
named from its being called in the south of 
Italy Jaliola. It ia hardly entitled to a place 
is a Welsh dictionary, but being found in 
some Welsh books on botany, it ia here in- 
serted] allelnia, the wood sorreV (OaaiM aceto- 
uUa).—H. Davim: Welsh Bot. 43, 154. 



A1&, t/. [=aelfa ?] a high place F 
AjUiar aideRhawr wydfa 
Ha cIidU poTdd or ^/, 



Alforch, -au, »m. fbarch] a spear, a lance. 

Davies explains it by ' gwaew, ' without a Lat. 

equivalent; and Pugbe, giving 'gwaew' its 

doable meaning, has i ' a spear ; a stitcli, or 

pricking pain.' 
Al&rchu, V. to shed the leaves of trees. — P. 

Almarcha (q^v.) is the form in Davies. 
AityAA., -au, tm.=Elfydd, El/fa. 



lo Ja Cnji fydd rbwii^ tri al/yd. 



Taliain: If .A. L SO 



tation of alchemiat, though a2 in th 
the (Arabic) article] an uchemist. 



iadaa gorea o at^*rgUltKth,iiea yr ymchiril 
r athntnydd, yw y canlynol i OBifyddyd yw 
ft lum y aaa e{ deehno yo gelwydd, el 



Algrar, tm. [al- + carw?] 1. the unicorn. The 
word is rendered 'reindeer' by Pughe, and 
others after him ; but a comparison of the 
three passages in whioh evidently the same 
animal, said to have its strength in its bom, 
is referred to, shows that the (imaginary) 



ouioom is intended, in the first and second as 
well as in the third example. 

Ifetth gtUgarw yn ei goni-~-if-A. iii. 53. 
Narth animm jn ei gorn.— JK.j). iii. 178, 

The fabulous unicorn would be much better 
known in Wales at the time when those 
aphorisms were composed than the real rein- 
deer of the far North, which has two promi- 
nent horns, in which its strength does not 
particularly lie. Cf. A/aac (2). 
OUien (old the poor latrmUm that all iU [the nniconi'i) 
■befkEth lay in Ita hum. and tluLt Then pnaied hy them it 
iroBld throw itaeU from the pinnaclo of the higheat rocks 
bom tareraoet, ao as to pilcb npon it, and Uiao quietly 
m&rch off not a whit the wone. 

2. in some recent writers, the reindeer (with the 
pi. algeirw, from algoTw). 



rhyfiddaf, a 



D adull et gym. 



derfyoa 



J cyich pflgynoL— 
Algarw, geirw, im. [al--t-carw] the reindeer. 
Quite modem, and suggested by algaT. 

Pan f yddo yr al^eirw yn bwrw eu gwiag o flew cyntat, j 
Buxat ai- y pryd yn wiseu, 

TDiaiar uV CfcadurUiU, i. 806 

Alls, (wi. the lowest point; hell. — P. 

The Welsh call Eowena, the daughter of 
Hengist, and migtress or wife of Qwrtheym, 
Alii RoQwcn, as well as Bhonwen; hence, 
when the spirit of antipathy was strong be- 
tween them and the English, they nioknamed 
the latter 'Plant Ali>,' the children or pro- 
geny of Alis; and more emphatically stiU, 
'Plant Alii y Biswai/,' the dunghill onspring 

Id OtaOTgnD tbpycelltbedesixDdanUolEiKlisb taml- 
liM, ' PtanC Alis y BuwaU. ■—/«!« Glou-r). 



tempt.— ZrfWU Morrie 




eym Owrthenao, ae 

Saoion gyntat I't yn 
a briodea Alts Ranwn 
jr jnyB i-r mat a tu 


yiPrydain: . . . Ail ydoedd Owrth- 
efe, wedl Uadd Cji-ltoyn FondiKHid 
s o diaix ac snrhaith. a wahoddcs y 

id^i'fL^^ijE'tt'^r.d^ 


Ovillicyni ... a ej'minFrth yn wraiif iddo nid llal na 



Dafu^ral rhag [it. i 



n o faonom oi ^ efat 



% 11 Alitw ever used in an appellative sense, 
as stated by Pughe, I have met with uo in- 
stance of it, except in such writers as seem 
to have adopted it from the dictionary. 

O'i berygl daelli 1 Baiia, a'i (ywyd 

AftiarflnnHi.— n™' Wna: Blod. Art. 314. 
Malumi alis [from L. alrea"], alcea {Maha ulrea, 
IAun.).—iVeddyg(m MyM/ai, 282. 
Alisant, sm. See AUanf. 

Aliw, -au, sm. [L. loli'.ii] 1. saliva, 'spittle. 
Also written haliw, which is the more regular 
form as compared with the Latin. 



Aliwiad 1 

CymnwT wwiddsm jreUhwg 7 mmt, ■ phno tt; ac ot 
twll yn y dwit. dod 7D<ldo danuid o'r pvreiddFD, a Kochel 
Ijucu^th aiiw, cutn gveafrnillvd vw audd y Rwrvirldvn. 

)l,ddssm MgJJ/ai, b. «. 

t , . . 7m pm poeri rmaJtfa 

<'ilrbivt/m yr alim, the salival glouda. 

2. tlie sap or jtdce of plants. 

Qoreu amnr ou caiiglu, dFfndcT TBruuaf o Wyt Ajidnu 
i Wyl EWr 7 Qtnvyllau ; a da csnglu'i- UyHCwrn ^r^bVTdd 
W^IngoiOslHiOwuif; bc n- «al ai Uydf, 11ob« ahvy'n 
wyrddoD, cyn 7 poUont fin haJiv. 

MfMaum Mg-id/ai. ii. 7*8. 

3, aliment (of a sappy or succulent kind). 

Ni bydd by* cyw heb nlia.—IMirrh. (M.A. lii. 180.) 

Aliwiad, -au, tm. salivatioa, a salivating. 

AUwo, } V. to salivate ; to produce saliva or 

Aliwio, ) spittle. 

Aliwog', )a. salivoua : containing saliva; full 

Aliwiog, ) of saliva - salivated. 

Aliwol, Id. salival, salivary, salivant; per- 

Aliwiol, ) taining to saliva. 

Aim, em. [from L. (i/uinm; E. alum] aluiii:= 
Alloy, H.T.— e.S. 

Almant, na. [O.E. almnnd, almaxmd, almond., 
iilmon; mod. E. alnumd; O.Fr. ahnunilt, 
alemun<it: from I* iim<)g'Mii\ an almond. 

Ac rfpUy J nmo tri pheth yn j fp^arri itlmtit : rtlatfyn, 
K bLi^ya, a ohD^vullyu ; kp uu ftlmnni yr. 

Untiuoyl rirfsmn'- (Seren Oomer, iv. ««]. 

Almar, -an, tin.-=.AImari, q.v. 

A« ynn vedy kynaatlair a divtryv yrlaC 0I4? y ledeutb \yi 
ynStnnt luu. adivreidawpob ptlh or Aoryvuniuiwef vno. 
(4c ytcyt a hynuy dijrtryw yr rslwjB oe Uyfreu u UkabLea. 
ac ih"/;nirra Ae ^mttoxA. a d^TU y hfidiim o hoivi. 

Almordiu, v. to strip off the leaves (of trees) ; 

to denude of leaves. - D. 
Almari, lau, «m, [O.E. ulmiirir, ahntrie, nlmern; 
nitmTy, aumbrit, amhrry, iimhrii : Ir. nntri : 
from L.Ij. alraarium. nlmiirin. L. <iniuiriv!it] 
H rcceptaclo for alma: a cupboard, locker, 
elosct, or pantry. A word foimd a few times, 
but not assimilated into the language. 

Oer ddiwaJst. arw eiddfccor, 

Iddi, heo tititfTri mHi- — tfln tiock, i'r UoDg. 

Uac luim y Toewn ei heUyU 

Ynddi, hen ainari hyll. 

[). «b Owtrgm, cxlll. 33 {et. irxvU. 4). 

A^Ktnri tieljau morJmdi, 

A gin yn llftc Rc yn ILt^i- — ff^gf .V-mHtor, i Dnrw. 

Ei ^enedl h ddipiondd. olinaTlaTi 



Almes, -au, am. [mes^] 1. fruit, produc 

— Iiilo Glotmry. 

atmer ooed yn fn'lmau 






Ac aimer ooed yn fn'lmau 
Hyd UDiltidd y tiredd t4U- 

rn miiibliij j 



2. a dainty, a delicacy. — P. 

AlmeBU, V. to gather the fruit, produce, 1 

Almon (u), -an, «m. [E. almowi, aim 

AlmarO] 1. analmond; the nut or kernel of the 

almond-troc. 



r I-ncs^, i Syr W. MutUiew. 



Alniouau, almonds. 



Cymmirnn'b . . . ychydig taba. te ychydlg tA, Uyiiiiu, a 

Ar wailh almonau, I in the fashion or form of 
O loaith almi/iuiH, j almonds; shaped like an 
almond; resembling almonds; almond-shaped. 

Tair padcU o ntth alxuiim, oup a Uodmyn mr on 

wyllbren ybyddpBdau'nidellu'initbiilwMiii. 

tcM. nv. 33, 91 [eS. ixivii. IB, W). 

almon), almond kernels 



U-uav. almon {eg. cnoi 
or nute ; almonds. 



. an almond-tr«e, au almond. 

leremSah, betb a wdi di ! Uimmu a ddywdaia, O1 



Yr unser yr oTuuil yr byn sydd nchel, ic yr amrydant 
yo y ffordd, ac y blodeua y pm alfnttn.—l^'g. lii. s, 
Almonen (u), ef. au almond. — Dr. I. D. Rhya. 
Almonwydd {eg. -en, /.I a.cl, & pi. abnond- 
trees, almond {Ami/gdatue communie). — ff. 
Davim : Welsh Bot. Im. 
Almu (N.W.), ) (I. to treat or impregnate with 
Almo(S.W.), Jalum. 



[al. 



.g] greatly revered or 
ighly courtoouB ; honourable. 
Dwyn SI' ilmyj yw dy gallinpb, a tbyn«T yw dy bwyd, 
ac ni rh'.-w a ed«)i. dy fat6.-/iJo Mh. 178. 
Aloewydd, e.pl. [X. and Or. atut+'W. gwyilif] 
lign-alue. Ugn-aloes, sebeston {CiTiiia ; Alw- 
:f!,l,.u). 
YmcBtynanl fpt dyffrynoedd, ac fel mrfdi wrth atnn, fel 
.•/'■'Tyild a binuodd yr Arjrlwydd, M y wdrwydd wnh 
ddj-fiuedd. — -Vu™. unv. e. 

11 A remarkable compound, the first elemont 
being on unnaturalized foreign word, unless 
we consider aloes, which occurs some four 
times in the Welsh Scripbu^a {Snlm. ilv. S ; 
Difir. vii. 17; Cun. iv. H; Iwn lix. 39), to 
have a right of dtiaenship. 
Br bod n/"-i yn bdh chwww, 
Uao o^ achub dyn rhaK nuu-v. 

Urav mor brid amldra nuvr hrcn, 

Ovgnlotr. j-d, ac olew.— n«ii Ifj"-' H'.od. Art. S3. 

f The common pronunciati^'ii is tilwys (q.v.) 
or alw) ; but aloe, which is postulated bj- 
alofwydd, does not occur either colloquially or 
in the written language. 
Alo£a, faoedd, feydd. s/. [alaw-^-ma: formed 
on the model of a(Aru/a] an orchestra. 

Ond oeir rhai nuaau dan griwiliau'r mynydd 

Yn dJvfl— orielau'r aw a*r per ehedydd— 

Alo/a anian -naturlieb jrelfyddj^ ; 

Mot swynol yma ydyw didiAln fywy d. 
' GioyitianfM.- Briallen OliD Ceri, i. 

Aln&u, s.pl. \jtl. of tUaw, lily ?] lilies ? 

Rboa aorcho^dd yw rfanddli* eioh rruddiau, ala/ai 
hrear-nwyf yw eieh noidrwydd, blotensoth cuiad gy'n het- 
aidd Uim yn gvaowyno ar cicb bronav, fal blodau'r eirin 
ordwinpaUianmaiiod.— ZJyU^rSero* (YTaliesio, i.7S,. 



Jm V_.(,K)t;iL" 



^ Ati obecore word. Davies, who trauBlatea 
it ' imici, alicni,' evidently conaidcrs it a modi- 
Scation of galon^igdynion, enemies. 

Alor, -ion, -au, *m.^^Alavrr. 

Alp, -au, -on, on. [Ir. ailp; Q&. alp] a crag, a 
precdpice; a, craggy mountain: 'not a com- 
mon mountain, but peculiarly a crag or craggy 
motmtain : a word common in the mouiitaina 
of Olamorgon.' — lolu Morgamvg. 
Alpaa and Alpon, <^Sa, predpicea. — lolo Mor- 



EUomn RliiffddiMth ; ji hvn » grpuwiv wUtta pob 
peth rheidnl at vfieuu«th dyn mewn rnj^iddiaeui . . . dir- 
prwynlon ; di«iittaoth ; msaureg ; trionglseth ; cynghtjn- 
meth ; mordwyaeth ; 4C aletrddeff^ 

El/nax SAi/tMuuA (AnJen). 

Al«oddawl, ' 

AUoddegol, 

Alsoddig, 

AlBodd«gwr, ) wyr, im. an algebraist, i 

AIooddwT, ) versed in algebra. 



AcDt drwy Uwer glyn 

Dflewyreh, Umn, a " "■■ 

Dna Uirer rhevlvd 

0™%.- ^ 



tannjdal. 



Dna Uirer rhevird, Ul . , _ . , , 

~ Tag, cflD, Qtd, cora, rhoB, a ^wyllioD anaea. 

' " '■'— ' ■ CoU ni^», ii. ! 



% There does not appear to be any early in- 
stance of the use of the word in the written 
language ; and colloquially it seems to have 
always been confined to Gwent or 8.E.W. 

Alpog, a. craggy, cragged; full of crags, cliffs, 
or precipices. 
Lie alpog, a craggy place or country: a place 
full of crags or precipices. — ItJo Mi/ryuiiwg. 

Alprew, -oedd, am. alpine ice, a glacier. 

Wnh r dm J HLtai S&roh. a hjiid o enethod k biw^- 
eidiaa o thwythau cfDunyiif^Mig k ia, wedi ei ddwyn o'r 
nipnrwr.— iJrviiui.- Ninefsh. lis. 

Alsaii), seiniau, »/. a carol, an anthem, a hymn ; 
a Christmas carol. The same sort of composi- 
tion is generally called cam/ Nadolig in N.W. 
Caon altain meim di»ia dmit,— WUiani Egwad, I'r Em. 
Yr eofl ?7at h nufalch^iTB Jn ddirfawr o benrydd ei 
pberlaia, a phob edn a1 gweolenhBi, oc a'i nlwoi 'Eloiy 
aiaapoed ■ a ■ DmriM y Dafl,' M K roddTnt iddi lawsT iawn D 
dmUi-liarch ; a'r fryaldjoi a ddaeth iV diani. ao ef a 
ariuniwya M aach Iddi mewit aistiiiiait a cbarolaa maloa- 

^ In some parts of S.W. aliatn has been cor- 
rupted to haliijtg (pi. -au, -od) ; as in 'Hal- 
siag, neu G^ newydd or Ddydd Natolic,' the 
title of one of these compositions printed in 
1781. The word hail {in the Ene. A.V.) oc- 
curring in the angel's salutation (Luke i. 28) 
may possibly have contributed to the error. 

Alaant, »m. [contr. of aliaantr, itself a corr. of 
AlexandfTt, so called from its Lat. specific 
name Alexandrinum. a designation which, 
according to some, it has obtained from its 
being a plant of Alexandria in Egypt] alexan- 
dcrs, horse-paiBlcy {SmyTniuin). Its Welsh 
name is dulys, q.v, 

Alsawdd, soddion, »m. [al — ^sawdd, as in ar- 
Eswdd, trysawdd] algebra. 
H First found in Pughe (first instalment). 
1T93; but not in Walters, nor in any other 
dictionary published before the beginning of 
the present century. 

AlaoddawT, orion, «m. an algebraist. 

Alsoddeg, -au. «/. algebra. A later form than 
aitatitld. 
Ac beb taw hTny. j maent [y eeryddionl tjnycbaf ju 
(pniCTd eu cyfriion gydag altadd'a, jr hyn sy'n iwneyd j 
peth [i^ ynuidAiisoeyiigaiiiailniwydyiyfli'rcyffraliD. . . 
\c rr ioi ymwrthod a^ itgodJtj/, a denirddio rhifoodao. 
n tewoBja mwy o dtaffi^rth ddaiAitALU a leiaf mewn 
rf.1/..- -.>wn4.inl hii i rqj imeaQjar liyny yn bresermcil. 

'. IT. Tliovw: Beryddiaeth. K, S3. 



yn nneyd inwy o dn 
eyhrfgn BHrjddol. bu i i 



y dyn arall, arodi or 

kytrdtbaca/uor 

it kygliawBscd y rwg y hi 



sheep and cows. 

O dBUyd y dyn gverthn dauai 
ae ^wertoo yr neb ■« pryno mad 
yDyrHJnflerydylyei ofu ^yntaf o kyfrdtb ac d/u or dana 
deu oen ; yoa y gailei not kyghawBscd y rwg y hawlwi 
kjmogyn.— Ciy'Mii&ia« Cjwim, ii. l«i. 
AloBon (f ), -au, »/. [Gr. iAnjfuwuvjj ; L. eleemo- 
tyia; Br. ulaztii, alezmi, ulizon, aluaen; Ir. 
atmaainl alms; charity: the same as elutea 
(q.v.), now the more usual written form. 

A miiincu ach vwediaf cbwitheu vnjdyr. yny gy m erwch 
^fawltbeu vwyt a diawt o'r aiumfn a'r gardawt a rodet yn 
[iia'rni4.— &<;b>MZ>ici.' C. B. Sain ta. 111. 



, - - edotbood i orymdeilh 

Bml Gr. at Arthur : U.A. ij. SIS. Si?'. 
T Uaw aWBlotat dl aelUr y oliyffelybu y aluMtn. 

SI. Grtnl, )3S (of, ISS, £30}. 
Heb wDeuthnr dim da. nag nn prut, nag atatim. 

BrtuJdai,d Fa«^,\H. 

Aluoeni (e), tm. alms ; charity, benevolence. 

Clocbelwch roddi deh a^uKpwi yn^ n^A^rdd dynian. . . 

Entjdd pa ham pan roddyth di dy almtni, na phar ganu 

udfom ^ir dy fron. . . Eithr pan wneycb dl Uy iluatni, 

na wypo dy law aawy pa b«th a wna dy law ddAoii. yuy 

bo dy n/u»-»i yn y dii«el.— Jf. Salribam : HaCt. Ti. 1 — I. 

Alwtir, -au. wn. [O.E. o?ner, avrmen^. awrner, 

almoner (from Li.Xi. almonaria), an alms-bag, 

a purse] a puise, a bag. The same word as 

Llywelyn, derwyn fal dlr, 

Ab UwDym. heb gan altaar.—L. a. CU*i, HI. yi. 8. 

0n faint ar y glun rw (o 

A^ d/mrranrbeg lolo. — (tuto'r Olr/n. 

Alvir, PWT», ODdell.— CnXK/rjrn tf'. CV"'™'' 

Alwerytld, -ion, am. a purser, a purse-bearer ; 

a bursar. — IV. 
Alwerjm, -au, im. a small purse. — W. 
Alwni,«m. [E. n/«m;Ir. a/um;I.. o/wiiien]alum. 
The more assimilated Welsh form is el^i/. 

llymft y pFtheu ywyd da tao y kic drwc ; nyt nmgenn 
fl^iDBtffwynnavaloynplyor. abwrwyploorhwnawamaw. 
Meddsi"' Mi/Mfai, i. 18B (rf. il. 61, m . 
Alwyn, in. 1 a. [gwynl very white ; very fair ; 
Alwen, /. ) very bright ; splendid. 
Byr Wlliam Herbatt, gwrKr adpyn, hardd. 
Hil Gvflym ab Wiiacfn . . . 
Byr Cai HIT mewn Brig gwyn. 

Alwyn, »m. [gwyn] albumen. 

Alwys, l*m. [E. aioes, ^alowet; C. aioea; Ir. 

AlwB, ) aloes; L. aloe; Gr. "ixXmi] aloe; aloes. 
Cymmer ddwy fflolaid o win )pvyn bob ail dydd. neu 
vyfod. cais dria^l. a chwart o win egr coch, ceinioffwcrUi o 
ifwoWrtli, werth tair crinio^ (ilicji, x'v. berwi yn dda yng 
nghyd. — Mfddj/t/tm ^j/ddf ai^ ii. 3K. 

Pren aloet, aloes wood. 



PuiMp^J 



jSjJ,ynn «;,!«/.■, ii. S50. 

j/. [see il/ium] alms; charity. 



Colloquially usitd, ^nerally witJi aphi 
the first letti^r. 

A jfOTphyniTn 7 baup bot yn itjvyA jv i^forchrmyii ef- 
ac srehi y daub lalu ); Duw ft hunin idyljlwl. nyt imgeo 

^< y Sorwn ,- M.A. Ii. BM (cf. 6aO). 
Ooh ■rtrlwyd heb y Melian .iliriiJHii Odd jtt 1/ MW fgyt 
eMd—St. Urr.,1, I IS l,:f. M, i;2|. 

Alwyaenig (r), 
Alwysenol (ir), 
charity. 

Synwyr & orug ^ iilw^afm.iii 
All, <-. [C. fj?, :|,/?; Br. «7Vo,lT«i7r, oH'e] Or. 
'aUo; ; L. a/i'iu; G. «far] another ; other. 



\ a. eloomosynajy; relating to 
\ alma or charity; given in 



TJyi 



?b win In 



TJ' TW hfb iniitli loi i'lr ben, 
>& (liAi I'v ymy 1, Da thiunen. 

TJwyr ne ddyn Uaiiaidd Huji 

1 fynod, dyn^H anifluU, 

N«ud buan mSi 



Brgdydd Ilir: Olrsith, U 



bod rn if / od 



It fn hudd. 
/. O. /^/A«; CO. iv. S28. 
Rhed Vt At, rhfir hydnd all 
Y dwyrain tjaji amll : 
Troi k mynuyn. Imm unnmt, 

Ei Uyw i'r cwr all a'r lut.— il'icf Wgf,: Bind. Arf . MO. 
Uawenydd a", bren pwl, nis meddl di, 

l<VoTric*nig; yBedd. 
Tr hmwT penllvyd, laid yi iciuuK do. 
Oedd flaenaf i fordeithiair Vr all fro. 

r*. Llfnd Jotta : Ceiohm Aven, 170. 
CW pelli, 'n gyntaf, dyig jr rheawm oH, 
Pn Bam na'th trnaed yn wurlBch, nm'n tmj dail. 

1[ Not preserved iii the older 
in derivatives and compounds, 
modem, auporseded hyarnll, except occasion- 
ally for poetical convenience. 
All, »m. another. If it has or had a plural, it 
cannot be distinguished from that of aill. W. 
Salesbury {Act. ziviii. S) has 'yr-eill;' but 
this ho apparently intends for rreiU. 
Allad, -Au, «m. [Hod] a hlessing, benediction. 
TauAir dyr o^throtL ymy wn vyg ehUoq, 
T»uH« dy fMhiawt. y rwg vyn dcu lygat 
Taiuw yr da nllal Rinm drciu j-m iaC. 

Ta!irni»: A.B. ii. IM (rf. M.A. i. SCIl. 
Ac yna bydd a Kymnierot I'lb got a'Ui fuddirl. ac i'tb 
bwyll a'th ddeall. yo rhad u all«d iti. -Da'.Uu, i. 380. 
Allaidd, a. \1t. allaid, alluigh; Ga. allaiiih, 
altuidh] ' wild, ferocious, barbarous, eavage ; ' 
foreign. ^f>. V. 
Allair, oiriau, am. [sU-fgair] a paraphrase. 
Allan, adv. [all] out; without; outward; forth; 
beyond ; abroad. 
Yt ai]enedi>ni^h y ^^odiad dya altan o> oaill Tyd i'r 
llall yn j bywyd yma. An (o'r enaid yn yr y«pryfi (meim 
poen dan wBHiai) yn tori drwy (twr> natnriaeth oddi fewn, 
Mb fynumg'i ddju yn hwyyiig- nghroth ymoddw] daiaro], 
ond er ewuetliHr pob croadur yn dyd-d nJ/nn o dywyllwch 1 
ol™ni, (iCii o frj-ntni yuprydol i bimlpb, <i«no o Ru i gar- 
lad aUa, o fHDlhlwed < rydd-did nefiil. atlan o'r wvhar i 
noli, allni o belynt y byd i vyniili^tluu amitaidd. 
fyDwencythi*!-'--''--— »-"- ' - - 

olinn o'r mawd drewliydTl 
DatnriseUi i Uaemlem neTol. 



t ; byd i ifymdi^tluu amitai 
1 1 grfeillorh angylfon I>uw, 



Margin i'lDjJ : Tri Aderyn, SI 



tb. (X.A. Ul. IM.) 
ODd otL adida.^i>. ofr UvUtM, liii. 88. 
.lUaa o olwg, allu reddwi.— ZJian-E. (U.A. iii. IIT.) 

AUnn o Uiw, out of band ; off band, forthwith, 
immediately, instantly. 

Ac sllaa » ia» y (ajodd elo ei olwg. 

;.•; xnii. M Icf. Man Ti. <S|. 

JfyHf(ia//nn, to go out; to go forth or abroad. 

Ny daw y nuukwy hwnnw byth yr Uya. nyt a Bsi or llr* 



A damchwein y kefflt chwedyl byth am neb o ti ado n t o 

O'r dydd hwn aUai. er n«U. er irneth. 

Llf/r UiniUi Ufffralm tPrfodu). 

y r-yrdtdd t>aaf ailan, the exterior or outer 
court.— £(«- X. S. 

Oddi al]an, 1. from without; without; out- 
wardly, externally ; on the outside. 

2. often used with an adjectival meBning(^:out- 
ward, external), espcuiatly before its conve- 
nient deriyntive allanal had become common, 
which latter does nowhere occur in the Welsh 
Bible and oontemporary literature ; nor is it 
found at any eariier period. 

Er Uy*ni ejn dyn oddi alian, ar byny y dyn oddJ mnni a 
adneirjddir o ddydd i ddydd.— a Cor. iv. 16. 
y wtdd oddi allan, the external or exterior 

Allan, a. outward, external, exterior. 

Cegin allan, a, back kitchen. 

Ty allan, an out-house, an out-building. 

y tu allan, the outdde, the exterior. 



Allanfa, faoedd. feydd, ^f. an outlet, a passage 
outward ; an egress, an exit. 
Dii(t*ylir i'r nreithh lod yn nU««/a i ddmladau brwd- 
trydig y gynnullcidta.— <fa»l. C.C. ISO. 
Allanol (d), a. outward, external, exterior, 
extrinsic; extraneous. 

Rliald L'r byd yma fypod beibio, ao Vt bywyd aiiamot 
fanv. — JIorytxH lAwifd: Ymroddiad, viii. 4. 

Y moo Ralwad alhnol oddi wrUi Ddnw ; tet gwaith cy- 
ifrcdiool yr Yspryd Ulin.— /-(o» Agrij-p<t (1778], 7fl. 

Ac yn awT at en cyflvr allai^l. Mevn pertbyoaa I 

jyflwT aUanol dy deulu, yr wyt i vrtyri J y ui pheth hyn. 

rndJiglad 1;, (sfiflBDf o( (IIW), W- 

Amddifadiryd teulu cyfan o'i stlftt iTel«dig aUaitol ai 

Atlanoliuti, externals, exteriors. 
mSSder,' 1 ""■ "««™rity. ..Imallly. 
Allaored, -ion. am. a running out; an outflow; 

an issue; egress, — Llaiiwer Jit. 
Allanu, V. to go out; to make an exit; to 
go away. 

Ac y Chcmbiftid oc eo gwyn-ddor boHll 
Ali^ikynt ary nodawl awr mewn oirf 
At eu ^wyLfaon nua ar gamaa cad. 



Al.LAKt:S 1 ' 

Allanns, a. oatward, exterior, external. 

A pliui vnelu trUj. rlwtiwm {tt him jir'r bj-v; dcnkdur- 
kidd) Hi all Ui oa'i olyvu «i bun )rn humm j cnadur. » 
thmj ™tUti y deiirfjid myn'd i mewn i'r Jrwll fnmol 
fw nujo ei hnn : Ttbra « (fwmi, mac yn ei dori bi bnn 
fiddi WTth Bylwpdd Duw . . . und f lOHe jn bwytA o'r oUajtiij 
»rlw»dd • piltnini, ur <Irtb hjrn)- m>e fn tjnn T gweowyD 
iddo fi him eilwuth, — MarfHH ijmyd: TmioddiUt iii. \. 

AUardd, a. [ail-\-haxAAY]-a^j; hideous; an- 

TywrM-wg, on te» .H.nli, 
IMlibrdidvyllobudd.~i>.nl>l7E<Iri]i, Uv, IS. 

Allair, a. re&dy, prompt ? 

Ki llmeic nep tr«iB troe 7 yRffor 

Xj cfarmwyll iwp tryU tyllii y dor 

Ny chymn nryf ilu affj^ic ^r^bor y^wr 

N J chymyrTJi ttf^itr td eiflKTor. 

LJy«lim FinU; M.A. L SSI. 
Allborthi, V. [porthi^li. porta] to export. 
AUborthiad, -an. «m. exportation. 
Alld&, im. See Aaia, AUfaf. 
Allder, -au, »m. Btrangenesa ; alienation. 

JOifcr, dielUirTCh.iwwidluit.— O.K. 

Alleg, -au, -ion, (/. [from all, as aralUg h-om 
om/r] on allegorj. 
Af tordd alleg, in the manner of allegory, alle- 
gtnicallj. 

HyQJK, > ffei alltgm^Pnlr Fardd: Mfl AwBn, 87. 

I'ydytod- 

T mu dwy ffordd jm mhs r«i y ginixed lUryaK o baiie*- 
iOD )T YagryUiimu.— Crnfedn t Btd. L 8tl. 
Allagiad, -au, «m. an allegorizing; allegori- 

AU«goli a. allegoricaL 

T mae nfyn, yn /Mtfovf. ya uirydda gorthrymder a 
tiMelbhred.— r*. (T^rlu. s.y. 'Oefyn.' 



AUeinit I'- to allegorize; 
form an allegory. 

nk ddhfjT BTDwyr jd BaO. 

idmi atVech uua ; 




mt. an allegorizer, an alle- 

lynnap, oedd y cynUt o'r nliitwrr gwir- 

. . -nj ouwtonau yr oedd dawinyddWui yr 

yigol"yr yn uogli yn jryf o hajnt yi olifmry- 

Crrdsau y Bud, 1. SB. 

Alleiiiad, -au, sm. [allair] 1. a paraphrasing. 
2. a paraphrase. 

Ooddet ofMriikl belutluBd ac eglurhld ar y Uatuil, 
vltM ■ iWWidisd geilian.— GKIIiJdiiiiiiHfaF C!/>»rnil, i, 188. 

AUsirio, V. to paraphraae. 

Uadcvaii a llyw dKoll. 
AUriii, faith T lloer oU. 

Dturi Wy: Blod. Arf. SOO (cf. nS|. 

All«iriog, a. couaiating in a paraphrase ; para- 
phrastic. — Dr. W. Richards. 
AU«iriol, a. paraphrasing; paraphrastioaL 
Allaiiiwr, wjr, ) »m. a paraphraat, one who 
AU«lrrdd, -ion, j paraphraaeH. — Dr. W. Si- 

AU«aig (c), a. [alias] outward, external, ex- 
terior; extraneous; foreign. 



■pryd^jl 



Tv ^Iwyaedd 1 



ilotDuKtli [al. eUi* blodau] gwig, 
-oaTTedd merch. 
ra«T-i«Kh.-(JKHs"i If 5-/1^. 



All&n, -au, ("1-/. another place, a differout 

ProJ! all/nn, to prove an alibi. 
AU&m, a. heterodox, unorthodox. — W. 
AU&rn, -au, «/. heterodoxy, unorthodoxy.— 

Dr. »'. fl.'cAurdi. 
Allfori, t>. [all+m6r] to export; to send out 

of the coiuitry. 

Att/orir IJairer iawn o vrarth«ff, dcfaid. a mooh, o'r 
daWth haa.—LIavil)/r Caia^ln, M. 

Allforiad, -au, em. exportation. 
AlUbrion, i.pl. exports. 
All/orion a dadft/rum, exiwrts and imports, 

Den^ya y ffuf^rmu canlynol dditdferion tif allforitm Canada 
(pen yr byn y mae wrdi ei gymmeryd i mi'*D &'t hyn y 
mae wedi ei aufou allan) am y flvyddyn tryUidol IHB^. 

Llairls/r Caaadt. IS. 

Allfro, friiydd, «/. [all-(-hro] a country or region 
not one's own ; a foreign country. 
Owriein Kys yn I1y» eii " 



Afiip nryd^dd.- M.A. i. ers. 
Allfro, a. expatriated, bauiahed, exiled ; exotic. 
Allftoawl, a. exotic, foreign, extraneous. 
AUftfledd, im. exoticism. 
Allftyd, -au, tin. [all-|-hryd] a savage diaposi- 



Allmyr uch aU/ry(. 

Tdliain : A.B. u. IM (iT. U.A. >. N). 

AUglud, -ion, tm. what is carried out (of one 
conntt^ to another), an export. 
Allgludion, expori». 

Pun orch^po^jtt [yr Athenlaldl Bicili, er enshimUft, 
oodasant y ddwfed mn q ffynnyrch 7 ddaiar, a phunt 7 
nnto werth yr allflid.Dx a'r dadglndion. 

Haul, C.C. xxiil. U. 

Allglttdi&d, -au, am. exportation. 
Allmor, myr, am. a Talley or dale enclosed by 
hilla ; a <Ungle ; a socluded place. 



Dyffryn . . . glyD, cwm. ystrad, aUmor. 

Th. CMarlft, S.T. ' DyHryn.' 

AUmjT, a. [all-)-m^. pi. of mvr ?] tranantarine, 
beyond aea ; foreign. 
Fenuaf rt Oraltot gmid eryr Prydein 
Prlodawr tud ailmnr. 

Llyw.ab Llffu*lpt^ H.A. i. 900. 

Allmyr, im. a place beyond sea ; a foreign 

region. It may possibly denote foreigners or 



Mynud WTth nolud wrtb utiwyr ba gwrt 
Bd gotdwT ar i^lnrr 
CadTi wihyd btyd Bian vab Oyr. 

Wyunrcft ab lAn^'Isn .- M.A. i. 389. 
EUywod GiLtBaeth tawr vygediiuc 
Affmffr a maen gwinloaaTC [n/. rviyonawol. 

Jfjn.. Jrci. i. ]eo(rf. S»j. 

Allogt -ion, «m. [modf. oialum, a/unt«R/]aIum. 
Allogi, V. to impregnate with alum; to alu- 
miuate. 
Allogi, 'done with alum.' — Vaughan Cfloit. (in 
Lhwyd's Arch. Brit. 213). 
Allogiad, -au, arn- an aluminatjng. 
Allor, -au, «/. [C. alter, altor (C.V.); Br. altor ; 
Ir. and Ga. altoir ; Mx. altar ; L, altare, from 
altui (=W. allt), high] an altar. 
Ruuawu Hir ef rodei eur e allniar. 

.Inran'x.' Oododin, M4. 



,)glc 



I: M.A. 1.890. 



Ao ar hynnj/ j UTodA] hwnnw ftdl^ymuwd 7117 th v 

V gyninull hirprw gain illnriaa- 

ar. ab Mrrtdiid: H.A. 1. Ul (sT. MI|. 
An odiyw y doeUunt brt u alio' fat y Phyll trt ew ) y ygn- 

Ar iT^^w 1u beiluw barddao. — Tolo Vu. B3H- 
A Noah a adeilulodd riUor . . . ao a offrymodd boetli- 
wffrjiaau ar yr allor.—Gr^. Tiii. SO. 
Ar wedd attor, after the manner of an altar; 
altarwise. 

Cchd atlor, high altar. 

YaiMiil iillor, altar spoil, sacrilege. — Uy/reithiau 
Cyinru, ii. 366. 

f Pugbe gives ' brass ' as another meaning of 

allor; but on what authority does not appear. 

Allorfa, faoedd, f^ydd, «/. the pOace of an altar; 

Oyfartoant ger 
Diffoddawl hnmr ifayv allor/a garth, 

lafo Tnctnig (Oinian Amn. 111). 
Allorsafvr, wyr, em. [all+gorsaf] a soldier at 
an outpost ; one of the outpOBtn. 
E[ allai tddynt yru rhai nUaMfl/irjir y cynghreirwyT jn 

AllorWT, wyr, im. one who ministers at an 
altar ; a priest. 

Ni bn i^n t^lad neb yn tflaa 
Alhr^ gweU ei elrian. 

Rh}! Jooa <i 'W. Wyna) ; Owailh 411. 

Alloap, p/. ellysp, >m. [all+osp P] a stranger P 

Vq vid vrneld y rltywpv bid gelleist pdrtblant. 
HocthiJ hir ac vw. a tii^a j Hlfw trri arCimiant 

Alliyw, a. heterogeneous. — W. 

Allt,yi. elltydd, «/. [C.its: Br. aut, act, aod, ot ; 
Ir. (mV/. all; Oa. of;,- L. aftu«] 1. an ascent, 
accUvi^, or slope ; a hillside ; a cliff. Equally 
oonuuon, or rather more so, with a prosthetic 
y .' fiallt, pi, geUtydd. 

O rit t main aritgsf ar bitlr uant mal i due diuiuid, bet 
JblaiD bet al{t ir ncbran diblaJn naDt ir bebnuc. 



Pan dvyf ya erbyn aUt atuyd }vder dvyuitn unaf 
veithiOLi. lichyllagvat. — Xabinogvm, iL 130 (cE. f. 7]. 

Cyfram^ alU a gaUt ac ecbicydd. 

Taliaim: U.A. i. 71 [cf. 19, 87). 

Tfllhi ych yw oredig yn rhych ac jng ngwellt, bo yn 
niii ac yng ngwaered.— Z.*pefl H a/^uvi^, 111. v. 9 (67]. 

Ovnldir ra'r aBI a gwj'dd y fr 






Trythyll dan fentyU fydd. 
t>nug Tyllt yn dragia ellt^tt4.^0. 
Ni bydd "lit hcb VKfjrd. — Dvmb. (M.A. iii. ISO.) 
Allt J«^r, a sea cliff. Cf. C. al». litus.— C.K. 
(Zeuss. G.C. 1078.) 

CenynC a ddugam ni ddygerdd eraltl 

At "'" nor \tiL alltmor fte agwdl ar werdd. 

CV-uWr/K.- M.A. 1. 1103 (c(. Ml). 

2. a wood ; a collection of trees (of any extent) ; 
a grove. Originally, wc may suppose, applied 
to e, wood on a slope ; but now, in most parts 



2 A1J.TRODIAETH 

of S.W.. applied indiscriminately to all col- 
lections of trees without any referenoe to the 
character of the ground on which they stand- 
AUt goed, 1 a collection of trees, a wood. 
Allt o gofci, I These expressions may form the 
connection between senses 1 aud 2. 
Fy nwllt dan fltrw ri/ijiiirf. 
Fy htetch af hi>n fwj-fwy aj-dd ; 
Fy nillyn^ mirynyn maawaUt. 
Fy nghrair, ni chair yn uchr ttlll- 

II. nb c;y.-U)m, ixii. 9 (d. ecnfl. 88I. 
Tta blddo dwT y mOr yn hallt, 
A brdw glciniiin yn yr nl/t, 
A thra bo'r frin yq ocilio'i nyth, 
F' anirylyd lach, ni ddeuat byth. 

hn-Mut IBiyUioB. ii. MS). 



Nidoe 



b.[S.» 



Pel y owynp boll ddaO yr aOi. 

Klirt Pridutrd : C. y C. erl. BO. 

Allt&f I '"'' ^^' ""'"] ^ stranger; a foreigner. 



Ovaharddudd y brenfn adael 1 bapnr a phlaood gad Ai 
diryn i flymm , . . f al y rbvyatrai hyny gyfeiliaoh llylJiyr 
rbwnf? Cymjo a Chymnj, a ihwng 7 Cytarj a chenedj g<v- 



MOldl taidar.—TrioHld g Lla/iavr {I 

AUtra, prep, on the farther side; farther. — P. 

Alltra, -on, »m. an extract. Originallj in- 
tended (CaerfaUwch, E.W. Diet. s.t.) for a 
choniic^ or pharmaceutic extract, but in the 
following quot. used in the literary sense : 

Telir banner comn iddo h«ryd am bobilUra ana o-r thai 

hya.^Jo*" unit: Inddewon Piydaln, B8. 
AUtraw, -on. im. [all+traw : C. allrou, f. 
altruan; Br. aatroti, dominus: cf. Ir. altra] 
a sponsor, a godfather. 
Ag cnny chedwch gyvirdeb tn aa at ydi olUrrAVK. a 
chadw Dyw Sul ya gyfnadsdlg ddilaTur. ml annjoaf 
(ymh«l]o«dd arnawcb.— flTuJ^icyrf I\iict, ( II. 

Y peth cynCaf tuo^ at gy&wni y ddefod y^w devil 
alUenio i't plcntyn. . . Ar ol dewia yr oUlrtHe, rhald pra- 
daifynu ya uene.! qit y bychan, 

J. MilU: liiddoinm Prydain. a, ? (nt. 8, 11). 

•AUirav}, tad bedydd, roi yeilata in Boelll.'— ii, ' The 

pl.tf/framniflueedinOLamorganehircforthegoflaipfl; but 

Alltrawd, trodion, >m. [all+trawd, trodi] a 
foreigner ; a strtuiger. 

Alltrawaa, -au, </. a godmother, a (female) 
sponsor. 

Alltred, -au. -i, if. [aU-i-tred] a place or ha- 
bitation that is not one's own ; a strange 
place or region. 

Qwell bach yn nhrpfred na mawr yn iiUirf4-—tHareb. 

AUtref, -i, «/■ [all-Htref] a place that is not 
one's home or domicil ; a place belonging to 
ether than one's self. 

Qv«ll bwth yn gartreT na Uya yn alUrt/. — Itvrda. 
Alltrem, -iau, a/, [all+trem] a wild stare or 

AUtremiad, -an, »m. a wild gazing or staring. 
AUtremio, i'. to stare or gaze wildly. 
AUtrodiaeth, -au, »f. banishment, expatria- 
tion ; estrangement. 



AlltTodio, I V. [sUtrawd] to banish, exile, or 
AUtrodi, j expatriate; to estrange. 

Pilmtiau glodfavT. wedi bod hti uubct jm m^diuit } 
wnedloedd, a toddwyd . . . ya ttiteAditicth i bul dewlaol 
LKcib, nH iddjnt »el eu A^UfrA^v ymaith drwy r^na 
cLoldyf ^affftnol rllffo^u Rliufeijii^. — f^wwaei^ U. 146. 

a the 



other Hide 
TwTRWrgwidd 



1 nd withKULt o'bic 

bWd neid ffrym car ca jugtiAofdA 

-w leKKdd dortoead darfa. 

Omjr^ ai Mfrrdtdd: U.A. 1. U4. 

AUtud, -ion, tm. [aU+tud] 1. one of another 
people or another land ; an alien, a foreigner, 
a stranger. 

Kian A Dd th diff«itli cmaA 
Dnf otnch pen bM allnd. 

flaMou XUyrtr: A.B. U. 33 (cf. H.A. i. M). 
Yna bydd Brrtlum yn nrdumnon 

Ai^I'mtk: M.A. L96, 
2, in the Welsh Iiaws, in which the term is of 



r, in Till 

der; a no , 

synonymously with taiog and sometimes with 
aillt or aill. 
O mjn yr atUitdifon mrnet r urth eu hugla^y kyn 

ndunt. — Ac oa or ynys hon yd honynt ny dylyoDt tri 
jnniilley toymayOUndOlta.— C^lA^iMJnu CVmm, I. 
I oa pryodoldar yay no 



Ac nyt J uelly y dyjgyn d; 
alMivl.— Cji/rWlAinu C>iiini. 1, 

O demyl roy 
oeono e^reyo pa arall. — CyfreitMatt Cifntntf j. 

Ac with hyny ni tliU mab aWud, p hwn a i 
bDH, ddf^ed d rieni db'I gydeEitvddian. 






AUtud o vyTaig:=AUtuda, 

Odcrvyt • alUul rgarrgc my 
n lalot JT aepjttiSo etyr 



.IfftiKl cenedlog, an alien bom. 

O dcrTydd bod alUiid rfuXtdla^a. ef a ellir dodl rhiith 
amo iDWTB HT Gymro, Betyr alitud anhediatefff dyn y bo 
ei rieni [oV. genedJ] yiv Ngbyntm, yny orddnFedder o n^- 
ddynt tm>dyT. a cnefnderw, a chyicrddeFW, a chyfnalalnt, 
tiuitJBt, obmiibo'rttaibfay. —Ltfii IVoUiw, v. il. W. 

AUtud priodof, a native bondsman. 

Vab altlt bTmin neo frerr, yr bWD a Mw crtaith yn 
'lUtmtl pri^datel, yr hwn a dnoa ^da*i aiglwydd jn ddl* 
lymmad hyd y pednerydd dyn a bob paitb. 

AUtud tratnor, eta alien from beyond sea; a 
forei^ non- proprietor. 

AOiuditm immor, nen a wlad aiall . , . ni ddylyii am 
fwyd, oBc uc ddiiird, sn dieoyddn. 

Lifa Waaiou, m.iU.M. 
AUludion whdwyr, Tillains holding of free- 
holders. 

Y gyunrfth adyweyt y dyly y meybyon ncheJwyr kadu 
argluydyHtli ar en AaJMud^fon Dul y dyljr y bnobyn iwdu 
y oj^lnydfaeth ary alttadsim irynteu [ynteu]. 






I stranger (not necessarilr t 



■ from another 

The usual 

sense in the Welsh Scnptures. 

Nmd vyt oUiud drod a dralgl dy 'Wendnd 



Ath irendorf am danof . 



CywfcfalW; U.A. i. 364 (cf. i; 



-Li/. axT. M. 

j'd ! 'oWu'd'wyf . 

(Inxnag Oicaim, M (cT. 8&, IIS). 

. an exile ; a banished, exiled, or expatriated 
person; a transport, a transported convict. 
A modem meaning. 

Nid oea ond pump nev cbirech mlynedd er pan y nue y 

cyfreitfaiau penhynol i'r nlita^iim wedi oael au gwoeutbnr 

mor ga«th yn y wind hon ag yn Neheudir Crmm JJewydd. 

Cylckgratint, i. ISO. 

AUtud, a. 1. alien, foreign; strange. 

Ni chelalaf (nid af I'w dnd) 
Olod u eUtydd gy]td •liUud.—Onnw) Omin. SG. 
2. expatriated, banished, exiled, deportod. 

Ac f e deby^ i unryv deoluoedd o^T luddewon aUtud byny 
ddianc i Scotland.— W./^iM.- Uwy Daith, B8 [of. 168). 
Otixu alltud, a fugitive servant. 

gantawyn Ihetiat byt at vrvuhinoreoiawQ. Acynaydan- 
noried mab y brcafain oT Uiya aorhydedfaua yn ol y ywtu 
alhtut, ac y oitwn« y breuhia creaJawn bmnw. 

AUtudaeth, } -au, i/. 1. the state or condition 
AUtudiaetll, j of an ahen; alienage, 
oadw alUud^aeth gaift ddfn. 



Mae ya en brawth ag oUiullasU. ac t bUndaan trynlon 
ereiU, oa aoHddeut yD ecbryalon yn el habyn. 

Yn yr alUndafiJi hon o'r rhai damnedig, ni chynnwyair 
IddynC mo rydd-did herwyt aviU, y rbal yn ynyi ne wlad 
ea deoUad a sUant aymmud lie y ewelonl yn dda. 

GnfuM ll>B^.' T«yr. ii. 6 (17B}. 
Y mae Uawcr yn elu gwlad dI yn tybied tod alUudiatUi yn 
■BfylUa o MnwyUider a bawddfyd. 

O^afnwa, i. 130 (ol. 110). 
b. sometimea used of volimtary exilement. 

YioBc ynrhyfedd. pan feddyliwyf am byny, [oduorbyw 
gylchnewidiad mewn bywyd wedi fy arwafa yn wirfoddol i 



Alltndedd, -au, sm. 1. alienage, alienism, the 
condition of an alien. Cf. AUtud (2). 
Trydyt yu gwreyc arodho y chotwdyl y^ystyl altduda. 

Cj//r*ilhUii^ i'ginrii, 1. 174. 
Trertadawf , wedi bod yn hir yn ■ilU\iiedd jm n«wlad 
efltion, a dycbwelyd wedi hyny Iddei wlad el hon, a cEafael 
ei dit ; od a ev ollvaith yn ddfiyi yn alUviftUi^ itid ymehwel 
dnchem tawndor.— fji/'"""'" Cuam, ii. 6W. 
Dioddef •UlU'dtM aewn dieithi^wlad.-Zi. 
2. baniahment, exile, deportation. 
Crin oawn erwybyr ar vsd 

ChweTria BT»nll yn alitwted. — Ll/tvarch lUu : H.A. i. 133. 
Pa hyl y dyodsfy ty en Iniaiy nyac en a(/(i.ifcd arghryd 

■la,,: H.A. i.34S. 



Cwsteanyn.. 
Ifat gyrihandguiiharniMud»<.- 
Guawd ee law y laTur cof bwet 
Y ^chwyn Allmyn Alltadti, 

Ac yM diwed jwedy dl«ygyow t 



ifyUT 



_lC yny diwed gwedy diff 
choelawd y dref y dat. — Br 

A Uawer o rrenhined a gymbeltwya oc eu teymaaaoad y 
oUtHdid.—Vampaa ChaH^mam, l»3. 

Alltudes, -au, »/. I. au iJien or foreign woman ; 
a female alien. Cf. AUUid (1, 2). 

Oobyr alUadrt yw pedeir arngeint. 

-V-vMi-i. Cyn., t. TOO let. 310. BS8|. 
A dwnacby wtaig oepUabonedd fam atbad. oOyrary 
, lie y bo felly, ei bnint iddl o Oynuaa vtd- 
hyn nil gellir i ii'llwlo, neniteidiafabaUlt; 
i honno ftaiut Cymimui ddyledawg, cyd uai 
h a aillt ac aUtiulu ach a boDedd ei gwt a'i 



X.; 



Alltiidiai> 1 

2. B woman who is a stranger; astTangowonian; 
a shungcr. Cf. Alltud (3). 

Kvmrjrt allitt'lft hqd^ ra vrevi? yt ny udo«t ty |ja Is 
paabenyw.— Arnl Gi-.ab Arlkur: M.A. il. lia 
Pkhuu r cetmiH ff«f r yn dyolwg di, fd y cymmerit gyd- 

3. a female exile, a banished woman. Cf. 

Alttud (4). 
AUtudiad, -au, «m. a banishing or exiling; 

banishment ; expatriation. 
Alltudiaith, ieithoedd, ef. a foreign tongue; a 

strange lan^uago ; a language not one's own. 
Aunrdflo ■ diffothin naith Daw j nwe pavb a ddy^mt 
AT Hjf«r oiriau nlliadntiDi i> (lyouae^. 

ri/fritiach y Bein/d, 39. 

Alltudo, ) t'. to banish, exile, or expatriate; 
Alltudio, j to alienate ; to reduce to the state 
of au alien or stranger ; to transport. 

TmiJioelul T Loegyr, a chTimulJaw dini»WT 1b y gyt bc 
Bf H detholodwyoa ymlAdTyr Ooegyr & Normiuidl a 
Pflaodrya b^ Amrlw a Gwotf^rwia a holL Brrdcin a dyuat hyt 
y (JroDfl Onr^t gan darpam alltuiTnw a difetha yr twil 
Vrylanyfit. — Bmt |r ZV^ywyifffj, TOO [cf, 160, *41). 
TB^wyd ef gui nebun pwaa j-chen, 711 dlaird dJ/Ju^Afv. 



Gfllir diflirwTl ^Uvngdud, Ran y rhai a alliHiiiwtfd 6jrm 
bedair blynedd ar ddflg, arddiwedd dwy raDudairo'ram- 
BerhwQw.— Wciemuo, i. IH). 

H The forms with i {alitudio, allludiiieth) are, 
in the modern stage of the language, much 
later than those without it. Ttey are un- 
known to Davids, and not fonnd even in 
Pugho ; while they are the only forms'found 
in some recent dictionaries, 

Alltudoc&d, sm. a banishing or exiling; ban- 
ishment, exilement. 

AUtudoc&u, I', to render one an exile; to banish, 

AUtudog, a. banished, exiled, expatriated ; 
estranged. 

Alltndol, u. banishing, exiling ; estranging. 

AUtndryw, a. hoterogeneons ; of different na- 

Tob edn a'l byd nlltHdruv 
A'ibacdd; oiid Iliyf edd el byv I 

D. ah ffinlyn, cIzzziT. 83. 
AlltudwT, wyr, •>». a banisher. 
Allwaith, weithiau, sm. [all-t-gwaith] lit. an- 
other or second time : a term, in the Welsh 
Iiaws, for au ox that ploughs the second 
year ; as cynmaith is for Uie first year ; tryilr~ 
ivaith, for the third year; and ehwecktdioaith, 
for the sixth yoor. 

lyi oUiMilA (ydd 






l^f« 



Uhydy] 



UK). 



I^ yw «iuia« ddyn damdwng aDifcit a ymadaw ay 
dyledivTwydd oial buch dru<i y oawfet II0, ych Art)* y 
cfiwMhflt-eitJiooHaMil*.— CKfrdilMiiu Csm™, U, 84S. 

Allwedd, -au. -i, /. ) a. [C. alwtdh, alwMdh, al- 
Allwydd, -au, m. j wfih, altued: Br. aWhoua, 
alc'houe, alr'hktie, aJhnee] 1, a key. 
Kyvarchaf ym dlvwwr vimot ' 
^ftiMrfbydinbudnBr.— Jfjirddia.- H.A. i. lU. 
Yn Abertftwy tcrrwyD aiiKfl lAoe^jr 
Ncnd Uwyr weCw y gwnact. 

Llnu: ab LlyK-'a- : M.A. I. MB. 



Er «i nJoD domt o'i fim Mw^ufrd 

AtliefOd bfif aCTDBdd uta undavd tJfA- 

DtMr* tidu Arfixi: M.A. I, 410- 

Y vlwydyn homin f colln Ma«l(rm ab Fthyi tdtwf^ieH j 

Curw yr aUmud calon. 

Eiflyium t Climil.- M.A. i. 1T4- 
Yn inianc yi aeth o'r Un Newydd, baun. 

Aaoa'bi«KaUui^.—L. 6. dMi, I. arr. a. 
Clo'r Uief HIT aT air aT cwydd, 
rtWpUidoracaM»,A(,— ;.. (V. Corti, i. ntrti. 41. 
Ac y mae a«oyf yr nUwuddam nffno a myTfula?Ui. 

TkenuullMa: Dad. i. IS. 

A!lm.ld pob do, j ' """"^r-key. 

Allwedd rotlrel, a bottle-screw, a cork-screw. 

Alliorildau Hair, i ash-keye, the fruit of the 

Atlwyddau Mair. ] ash : said by the old bo- 
tanists to be so called from tieir resemblanoe 
to a bunch of keys. 

2. the key or clef (in music). 

Y dallun yma Tdyw yr xllwrdd, ac a yBgrifaiir ar yr ail 
liDell o'T ^Kielod L fyny ym mhob Uaii o'r erddynn, ond 
yr inlaw. A Uwrdd rr mlaw a j^rrif ™ir ar y bgdwaredd 
lincU u'r ffwmelod,— ^mji fioBier, xx, 1101. 

AUveddor, ) -ion, tm. [|Br. o/r'AouAer] 1. one 
Allwyddor, ) who carries or keeps a key or 
keys ; a keeper of the key or of keys ; a key- 
keeper, a claviger. 



2. a treasurer. — P. 

Allwaddorea, 1 -au, >/. a female claviger or 

Allwyddorea, ) key-keeper. 

Allweat, -au, -i, a/, [all-f-gwest] 1. an enter- 
tainment, a banquet. — P. 2. grass; pasture; 
pasture ground. 

.17/irrf'Tbyirlawg tirmeilliaiiawg, 
Hyd wfoeb ton dolau glciakm, 

migi GorJi lib Btiiari: lolo Vm. tM. 

AUwg, tm. [a- •(- llwg=Jj. lux\ the dawn ; 

morning. — Qeirlyfryn W. Cynwal. 
Allwlad, wledydd, ■/. [all-|-gw]ad] a foreign 

country. 

Bel y daoTonu Dyoawt att Amtin y Tanwi idaw nat oet 
daylwnf? ganto «¥ br«eetha yr bob! groylon ani a datboed 
o Micliit irwy y tvyll aj brat.— Anl Ttcilio : U.A. li. SS5. 

Allwlad, a. of another country; foreign; alien; 

strange. 

Aetbym yu flotimQ i'm brDdcr, ya yn aUalad [misptlnt^ 
■allwat'l 1 blanC fy mam. 

Llji/r GKtidi Osffrtdm ISST (Balm, lljl. 9). 
A wyt tl ym titdg yn ddicltbr [* niivftid'', yn Caen 
ao nj wyddoot y pethau a ddaifu y dyddiau byn I 

IK, SaUtbrnry ! Lna s 

Allwlad, -oedd, «m. a foreigner; a stzanger, a 

sojourner. 
Allwladiad, -au, wm. expatriation. 
Allwladu, V. to banish, to expatriate, to exQe. 
AllwleldlwT, wyr, »m. a stranger, an alien. 

CntyU, gwermll, a ganifni, 
Yn taeru bawl i'n t£ bwn I 
A'i boll byd, i gyd o'i gwr, 
A'i hoU led, pm nUwl^iiDi-,— JCka Varii: Owetth. fttt. 

Allwy, V. to pour out ; to empty ; t« shed. 
Allwydd, -au, «Tn.=.d/fufi«f<f, q.T. (rf«. and <})«.) 
Allwyn, -iau, sm. [gw^] sorrow; grief; sad- 



Jm V_.(,K)t;iL" 



Cerdd allwva, a song of lamentation or moam- 
ing ; an ele^ or monody. 
Ac fTuU TD rlun 

Klue Hr aU f^H.-Taliain: MJl. i. M W- A.B. U. 17S). 
f^ Even if oil gwin is a misprint for allviin. 
aa is geueraUy assiuued, it is aoubtful whether 
it stands for aliwt/n. 
AHwynig, \ a. sorrowful; mournful; sad, 
AUvrynin, j pensiTe. 

A'r Uo jna vn aJfwn^ caeth. 

OragfAd ••>> Mt-^Sid. {P.) 



Bebcor aor 4ewrod h/wled hojTrliii. 
Am hvnin dewin dor Abcrrffimv. 



. ua <cf . s<6. «J 



Al bed] euid si'a d 



Allwyr, a. [llitTr] entire; complete; whole. 

A IlTsen meddre Ue ailtcar waOn 
A bdrdd « bli>d«a a ^uddig bertliea. 

Allwya, V. [cf. or-llwya, ar-lloed] to pour out ; 

to emjitj ; to shed ; to evacuate. 
AUyn, -ion, -iaid, im. [all] a foredgner, alien, 



jlUraaul, rmOnulaii.—O. V. 

A phDriU braima bt gig r drndlon, 

A throi BwliuBU A chnu aiiyitiim. — Utaoi^r Ht. 4- 

Anifprep.about; around, round; at; concerning. 

1. of plAce. 
a. about,' around. 

AiAtjmrjX twel o vliiuit B*rn twdodl an vyovgl Owein. 



Bf ■ wingswd Iswnalot am j droM deheu 






mynyd— BTiTn 



Dyro wregyi am dugattol ae eayidiaii am dy 

draed, put a girdle around thy middle and 

shoes OQ thy feet. 
b. opposite (with the notion of going around 

something to reach the point) ; over against. 
Am y tdn S'r brenin, around the fire with the 

b^g; by the fire over against the king; on 

the other side of the fire as regards the Idng. 

— Lege* Wallicar, i. ix. 4. 
Am y lidyigl ag tf, around the dish with him ; 

by the oish on the dde opposite to him. 

Gwody hymij y penbebogydd, a'r troedui^ am y ddysgl 
iigef. . . T poqgwKiit™i«d y n"! j wlfl i'r brenin. Vpen- 
pniydd r in* y ooifl d'r «tfdri»d umlu. 

Ltan WalXitae, I.I. 1. 

Am y pared, on the other side of the wall ; 
opposite, with the wall intervening. 

A gwedl bwyd, myned o't Pun a'i mu i onredd am j 
pucd A Gvgan. — ArtilM Gvg^H, 

Ovtod ft QaX, Aion Ooniflon an j terfyn 4 chyfoetb 
Obdifynydd, u an Aloa k FfOTllvB a Oweat fayd Ffir 
EoyllVB.— /!«• JfH. 88. 

T mu plwyf TJunrrin a 

A melbioa IohI ... a 
nJH yi TDrdJonen k Iflricho, 

2, of time : at ; for. 



Am ddeg o'r glork, at ten o'clock. 
Ac aa> bsDoer noa yclywynt diupadsln gint. 

Am hum mlynedd, for five years. 
Am hir anurr, for a long time. 
. with the personal pronouns. When am is 
followed by a personal pronoun, the latter 
becomes a pronominal affix to the prep, dan 
(tan); and when emphatic, the pronoun is 
added, as in the case of all the pronominid 
prepositioDB. Am dun (without a personol 
pronoun) forms a compound preposition sig- 
nifying ab<mt, around ; on (after verbs of . 
dressing, putting on). 
A g*im ^mdan J gwT a bali ooch. — Mabinagion, ii. 3TB. - 
A derw heb ef tIksit gmdiai > gmaync hwnnv I 

MMMga-. iii. Wa (rf. *»!. 

a. (I) am duaaf, about me; around me; con- 
cerning, regarding, or respecting me; for 
me ; for my part ; as for me. 

(2) am danat, ((>» daitad., about thee, £c. 

1 m. oTO dano, am daiiaia, am dtiiyw (m. 

(3) andf.}, onirfrfniw. 

( f, am ilaiii, am daiiei, am dfni, amdili. 

b. (1) am danom, am danam, am danan. 

(2) am danoch, am danauich. 

(3) am ibinyiit, am denynt. 

For am danynt, in M.W., amdanaddynt, am- 
danaddu, amda^iadydd, anidanu, and avtddytd 
are sometimes found ; but these forms are now 
obsolete or archaic; and so are amdaiiaw, 
amdfnyw, ainddaw, amdanei, amddi, amdamtm, 
amdanan, and amdatiawch,ia the other persons. 
Am deni and am denyat are conddercil local, 
thou^ they are in colloquial use all over South 
Wales, in most parts of Powys, and fre- 
quently occur in tne Iit«rary language. 

Cnod a cluiDd a fudyndaniduif. 
At morynyon & 
A pban darocd udunt tjmnu y ar 
(}wy^uch wyr anhJaoaiPH^I. 



Hyd nadywedit am vn vorwyn yn ynyi Prrdeiii vwy n< 
a«da»n'.-VaW~nyio™.ii.*8(ii.mi (.14). 



Onawd jxa rl ratooirt a i 



-Csnddctu:: M.A, i. 



jhdfl unanCeU o paLi melyn ^mdaK.^Mabii 

da gan Dduw gam menb , 

Mwl anddi dlMfirch I— J(yu. Arrh, Ul. 144, 
Dacth Oraln Glyn Dwt i ForguDTg, ac a 
---" - thret faer Dydd ... a chusfell Pen 
Fer o'r pentnfydd a'r c^lvyiii cylch ac 



In M.W. almost always 

amdanaf, ymdaiiaf, &c ; 

are generally separated, a pmcesx required 

Komc easi's by the aci^ent. 



<ir«. 96. 
the words 



jM.v^.(,K)t;ie 



Ni &*1i fendiUiiim am Fin crtKdiKAeth, im tin oidwrmeth, 
Ho am hoU fenditbion t bfwyd l^wn ; eitbr uwch Iaw pob 
dim^ni dy HnTfltdrul nrud jta mbrvnedigiuth ^ byd liwj 
Bin Hsrylwydd Ifm Grim ; an (raldinn gna. Be tm olwith 
^Dgoniant.— /^- G. Ogffredim (Diolrh CyifrfldinoL]. 
Am hyny, for that; because of tbat; on that 
account; therefore; wherefore. 
A f^Tmrjt butit agoiuDeiiit roof am hgnig^ 

Brwyig osddwn i thk, u a* Vof oi chimiialiii B (in- 
mod n Birr hoD.— Mo JTh. IW. 
•In tfiiiif etea'l galwodd hwynt i mewn.— ^ci. I. as. 



.jm ddgtrhafu o honot dy olteg, hj reaaou of thy 
baTing lifted up thy eyes ; beciiUBe thou hast 
lifted up thy eyes. 
^iH drftU Tnm nid o« dim ^byd 
Am diKii dyn dinun ndmkrl- 

iiVyJd am/ni..- M^. i, 8l», 
MJ jtbarwD dy dihenrdTaw am ryUdrbu VTihjt peth 
mor mghjwir iitjonj.~Matimitgii>n,i. 19. 

6. for 1 m the plaoe of ; instead of. 
Am ddim, for nothing ; for aught. 
Dtg am gnniog, ten for a penny. 

LiTgkd am lygsd, ■ dut so ddut.— Jfa«. v. SS. 

<-. for (noting a wish, desire, inclination, or in- 
tention) ; in favour of. 
Yr 



wgfa-. 



Yt wyf am wybod, I wish or want to know ; 
I am desirous of knowing. 
('. about ; concerning, regarding. 

lAwn Tmednia i heb hi dn benn t cmrw- 

.4in &«n, (1) about oraround the head; on the 

Ny lyinudswd Peredur y vedwl mwy no chynt yr ffWBlrt 
y poil^vl ao«d ambfi Kt^i.—ilajann^mt, \. 208. 
A OidA&tb ... A dyim&wd j belym y am ^ Vn. 

Si. tinal. IM. 

(:i)upon. on; against (with hostile intentions). 

Nosweith anil y 
urdawl llftdmn Rm 

Dyfvd am hen, to come upon (ul 

for the purpose of attack] ; to 
meet. 



Am ei btit {pt. am eu pen), against him; upon 
him. 

Ac Huory wyat ady^yfunut an dy pmn ac ath laduit. 

Tynu'r capui ooch at 

Tyiiu pobl am a 

AHhym am n ben, I met him. 

CuTchu am ben y ty, M to fall or come upon the 

bouse; to attack the house, (fe) to go or repair 

to the house. 

(;t) on the top or summit of ; over ; on. 



- abwiv kavEvit or dw^ 






A cbymxTt y kairo ainwi 

ampnun y ll«h. — Mabimoffio 

ApbiQ da elei aimiryt m 



(4) above; in addition to; otst; 

Ao am bfn byn oU. ^vfiiiffwch gBTiad- — Cot. fiL K. 

Ac am ftim byn, yn Ub maddygon i dria «i dwyfan. j 
DKiTob ihyfel ys yMnitnki dnw u nu dro* J iiwjtna 
tnuln.— r*n>. EWu.' D.P.0, 1.4 |1«3>. 
Ant ben hyny, above that ; in addition to tlutt. 

(5) niixed or compounded with ; on ; with. 

Ptryn'r melyntlyi am to Uutfa geifr, a hldl di-wy nag. 

&JU, am. because, for; for that; on this ac- 
oount that ; so that. This secmg to be tbe 
prepositional use with the sentence for object. 



Uadylyaw beb ] 

Am 1 cfawi anufi 



iRlwydi.— JfaWwvfon, U. i 



Am J ooflo to, nl metii nAddo pvy a foddo. 

Diarri. (MJLiU. ITS.) 

Am mai, because that. 
A'm [a (1, 4, S, 9) and poss. pron. ym=/y, 
my: Cam]. 8oe-4; and cf. -I'cA, -4'i, .d'n. 
A'r, A'th. 
Mi a'm tad, 1 and my father. 

Has Tyagveinaii am diraitWTr.—MaMwrim, iL tl9. 
Efe yv fy miawd i, a'm obwaer, a'm num.— Xou. xii . GO. 

Y neb a'm codto, he who believes me. 
Hya a'm lladdai, this would kill me. 
A'ra daw, that will come to me, 
A'm doddyw, that came to me. 

Dolnr gonnodd a'm doddyir.— iJ. 

BtgyllutJi am dothyw.'AInU^ Ftrdd: HA. 1. 36B. 

Bivdyr am bwyad innaa.— LljMnpet Hm: X.A. i. lis. 
A'm la (4)+yra=fy : cf. C. am] with my. 
A'm Uaw, with my hand. 

Lie bwyf ^'m pen ar olwnydd, 



A'm [ti [ll)+ym=fy] my . . . goes Or will go 
=dfy. 

^ Am, prep, governs the soft sound; and ti'm 
{a'm, a'm) the radical, the government being 
that of the possessive pronoun ym. 

Am-, J)J. [Ir. imm, imme; li, arnii-, ambi-, am~ ; 
Gr. 'afi$/; 0. Gaul, ami-; O. Bar. vmbi ; 
Oerm. um, \ umpx] an inseparable preposi- 
tion, generally followed by the soft sound, 
signifying ( 1 ) about, around (rtVcum, circa) ; as, 
amgyUh (cylch), amdaenu (taenu), amdroi 
(troi), amddiffyn (di^n), Om, in ojocobloent 
of the Luxemburg Glosses (Zeu8s,O.C. 1065), 
nkay bo an old form of the same prefix. 

2, denoting variety, diverai^, multitude; as, 
amryir, amliio. 

3. in some oases it appears to be used to enhance 
the meaning of words ; as, am^atad, amdritt, 
amdrvim, amweddi. 



jM.V^.(,K»t;ie 



Am-, px. a eiiphonio mutation of tlte priTatavo 
an- (q.T.), used before b and p, which it ohaugeg 
into the nsaol sound (m, mh); as. ammraint 
(braimt), ammalch (balch] ; ammKarch (parch), 
ammhryd/erth (prydfcrtn). 
Am, *m. a modification of ah (q.v.) a son (in 
pedigrees, of very rare ooourrence, and found 
onl7 before m) ; as, Mabon am M«Jlt. Cf. 
Ah (e). 
Qrmd an Madavc ar mad doded. 

Llngad a<cr.- U.A. i. 373. 
Amad, a. bordering all around.— P. 
UiTTtid pob unhyd • pfaob anad yodi. 

Uyvrltni FiTdd: 1I.A. t. Kl. 

' Vid, an idem quod bad.' — D. This conjecture 
'o be correct; at all evonti the word 



can haidlv be employed adjectively by Uyw- 
slyn Farad. See Amitnd. Atahyd ac amad 
[=«myd ac amhad). various kinds of com and 
seed ; grain and seed of all sorts. 
Amsdaw, B.^Ymada-w., Vmadael. 

Ac J ^yt A hyimy amviav « wn&eth m« wieyc prrawt 

Amadiyw, a. I. alive on all sides ; very lively. 

~P. 2. barely alive, nearly dead.— S. W. 
Am&dlaeB, -ion, a. slugnsh; drawling; very 
heavy ; mournful, sad, depressed. 

Arvydon kjlln aOachus yat . . . hwyd yo 7 iryneb. di- 
lengm ya aynydi a golwo y m itfoM, ft brytheiryaw 70 
ujnycli.— *«Mmo« Mifi4fai, i. 189. 

Atndl amadlaei, a heavy moiuitful ode, lay, or 

T mw nirdl tt> unadlacj 

A limut a i Lau Fao.— £. O. CdlAi, 1. v. IS. 

Amadrodd, -ion, tm.^Vmadrodd. 

Ac o dyna yd uitodh ef Uythyr at 

" "srvi'o': o* ArU.^: M.A. li. 89 (rf. 



work ; a trail. 
Amaelyd, v.^i'maelyd^Ama/aeli/d, Ymofli/d. 
Amaerdjr, dai, tm. a dairy house, a dairy. 
AmaerwT, wyr, ant. [maer] a dairy-man. 

im. [am — |-aerwy] 1. the 



... - i- + aerWT] 1 

ir border of a garment ; a purne ; lace ; 

Aiil Btwyn dy 1 



ly Tonmi modrwy. 
TWhu; A.B. ii 



IT |cf . M.A. 



O bonynt y gwneir amamniiau i ddillnJ y btenin. 

Itga WcUieai, it. SM (ct. C.C. 1. MS). 
Alii In ul oaQ un lEdd 
Nid eidduD iledwydd dyhodd 

"''™''' Llyinardi H^: M.A. 1. 1* (of. Ui. 147). 

Neod 11>«FT ym Uify lliir oxionvv tonn 
Ban llpwych y bron ser y brelchrwy. 



T petliaa byn ft'th nduit ym m! 



.I.e. il. 88 let. M.A. I. ftTS). 
Amaerwyo, v. to fringe ; to make fringes ; to 
■dom or border with fringe ; to form a skirt 
or border. 



Amaerwyog, a. fringed; bordered; furbe- 

Dillad amatrvn/og, fringed garments, 
Amaerwyol, a, bringing ; bordering ; skirting. 
Amaetta (d), pi. cmeith, -iaid, »m. [cf. Ih am- 
bactu» (Caesar. Bell. Gall. vi. 16). a servant or 
vassal, said to be a Gaulish word. See Zeusa, 
6.C. TT, I06; Diez, b.v. 'Ambasdata;' Tbur- 
ueysen, ' Keltoromanisches,' 39] a husband- 
man; a ploughman; a farmer. 
Amaetk aradr, a ploughman or husbandman. — 
W. Saleibury. 

BranmiAnydeletalasreucbenimygbryhu, . . Et-hkui* 
ade]« konflhc^^ ekeylguat odulfl er oochen. 

Cj/reMuiH Cynni, i. SIS (of. asa) 






Tnry djut ft bayam d yatj ryw y dynanoed o 
M odyno kyimy y kiidy«dy^y<ni gollidoed a 
antffftkeau y tyred yn IJwyr. 

£nl. Or. at Arli^r: U.A. li. 10ft (ct. Mi). 

Mi ■ ytraf (To. at wyth nuUtyr odidlhyr y dinu w yr 
hoU Twyntuilcit odieitiiyr y coedyd. at tmriiH a diwyll y 
tired THCOfya yredyn.— Comjum CfitirIs"Vifn. |14. 



SarbUd brenin Abetffraw, fsl hyn y Cellr. . . Owiiloi ant 
vyhyd ag ef «i bun, a cbyn ttmd a'i fys bycbao, a obyn 
dewed ag swyn amatlh ryfo nmiwUl naw mlynedd. 

Hoab, tad y byd newydd, 
Antarlh ofM et. mwytb?* ddydd. 

Dnil Wipi: Bl. Art.88(cf. 6B,9»). 
NId boS gan DniuMiniil da ^ymmeryd tiniedil y «wl a 
ormena or bawb ay dan a grafanffau. 

AneuHn Oam: AmaeUiyildlaetb, 8. 

^ Oocasionally, in some recent writers, the 
word is found erroneously used for amatth- 
iaeth or amaelhyddiiKlh : 
ra«th ^pniaed amartA d 
aeth onuulA Rotg a tbi 
'(A pwTta«tb fo gvall. 

Amaetha, v. to follow or pursue agriculture ; 
to farm. 

A«d miry wytbnJUi a'r byd i amaiOta, 
Llawer rliyv filwaith Uai 1 ryfela. 

Dem W^ : Blod. Art. «I. 

Ama«thad, ) -an, snt. cultivation ; husbandry; 
Amaetbiad, ) tillage. 

Ni ddyly neb gymryd aaanlutd [lU, Bmaetbiaetb] uuaw, 
t't ni wypo wneuthur y irvfdd. a hiryliaw yr beiym. 

Legct WaOitac. til. (x. 81 (Ef. C.C. i. SO). 



Yigrifcnyddion tiBSttiDdaa ar amacAiad ydynt yn uool 
yo ei famq Pod yn dra niwddiol. 

Ajttitrim Owen: Ama«thyddiaetli, 0. 



Amaetbadol, a. agricultural, — W, 
Amaethaidd, a. like a husbandman, farmer- 
like. 
Amaethdy, dai, em. a farmhouse. 

"Wedi cyrbaeddyd pm y mynydd, pwelwn wa«tadedd 
helaalli a byfryd, ac nimtiMc mftWT yma aa aow u byd- 
ddo- — Cawrdnf: Meudwy Cymrng, ISC. 
AmatlMai luwer. a brthynod llwydwedd, 
Cartnfl dinivBidrwydd a tluuwa^edd. 

&irntad(lS70), 111. 



J;.wV_i(,K)' 



iglc 



Amaetuueth 



Ama«thiaut, i 



Blaei 



lit duglfyllt onwrWwiil UwjT, heb 



U)l/r)iddiaflli , Corn's. 1»- 

Amaetliol, a. rclatiitg to husbandry; sgricul- 

Hw}nch rr etyb yn well Bag f cymn w ol«1r, ■ ■muwH 

yr Auiisw Hunter mor dtHr, yu Amadrix[<lian j^nu'^AoT, 

H-. O. P.,*.:C,P.lll(e(.7]. 

Amaetlkon, -iaid, «Tn. 1. a farmer, huaband- 
man, or agriculturut. 
Ni bu T7 luuild Dipwn bri hon 

Z>nvi ll>n.' BL Arf.U(cf. 07. ee.e7, (8,70). 

A thebTgwn y gwnelynt hyny gu Dwl miiirUdniitid 

oeddyat, neu loi gor"' — ' — ' — — ""'" 

Elsevrhcre the 
'AroaKoii :' 

r nwl ddul s faelieat hwv 
O led tal »« A™™(Aoo.-fofl tfi.,B/fl, Ix. H)S7. 
2. a man'B name. 8ee b.t. Amaetku, 

Amalhaiin appears to be a variant of the same 
name. Seeif.^. i. 167. 
Amaethn, v. to oultdvate ; to do agricultural 
work ; to practise husbandry ; to till ; to 

Kyt keffych bynny y«yd ny chcffych. ajiuetit fe aiitntiho 
y tir hwnnw uu ee digoaho mot dfryi yit nyt oa nuDyn 



y ddaur ond yr ud petli & oiieLnio codi ObStell awynwl heb 
■ylf&eu oddiduio. — Sum, Hot^'fia: Giveifh. ST, 

Ud o brif vrttiddrycbau y Gymdeilhaa Qyitmaidd yw 
awatthu an baiddoiuaetli ccmedlaethul. 

loaeph Uarnt: GwdUl. 280. 

Am&ethwaa, weision, am. a farm-serVant. 
Amaethwr, w^, 1 mn. a farmer, a husband- 
Amaothydd, -ion, j man, on agricultmist; a 

cultivator. 

Amiel^l/itit oedd AddA c^-n p«hu. . . ATttarthKitr o«dd 
dn rbimu cynur pan yn gwma fel Hjglwyddi y gnttdlg- 
ieth.—Samiiri HabtrU: Oveith. 14. 

Amaethydda, v. to practise agricidture; to 

Ymholir yn fypych pa faint Dfodd neu ^yfalaf a yntjTlr 
'hfldwl i Alluttgi dyn B'i dcuJu f gycbvyn 
« rad rodd o iAr.—Ltatdafr Cawiita, 28. 



Amaethyddiad, -av 



Amaethyddiaeth, 1 -au, af. agriculture, hus- 
Amaethwriaeth, jbandiy; cultivation. 

Hu'n awr ra dysgn a wnaetb 

Tori wi^ a thni tircdd. 

Hau, llyfnu, BByrn fwriiA.—Tegid : Ow»tth, 189. 

■E£ ta^Oi eiao nnuttOluiriarlh.—BKaUUr MKhai^: i. 41. 



ffyuuoDo] 

vyd ym&fhrydain erepi 



Amaethyddol, n. asricnltural ; relating to 
agriculture. hutbaniLy, or tillage. 
Byvyd ntmn-ilisddnl ydyw yr iai-hunaf £■[ corS, a'r difyni 



Cymdeitkat amiuihyildol, an agricultural socjety. 
Ama&el, \ v. [am- + gafael- u] to wrestle ; 
Amftfaelyd, > to strive ; to strive together ; to 
Anm&elu, )lay hold of; to struggle; to 
contend. More usually written yma/aet, 
which form ought to be restricted to the in- 
transitive sense. 
Ama/aei c^i-ymji, to wrestle a falL 
Amafaei cwymp yv «i heff gunp. 
Lie b^tlia't 1 



A tbi'n utui 
Drwy'c pj^ \'\ 



r trenilif eotb. 

mddlm 



M»dl,, yw. 



I ffyneflu orchirylioa y byd, a goledd- 
AmaettiyddiiLeth, 3. 



Amail, eiliau, sm. a wattling, weaving, or 

twisting about ; a wattle. — Llanmvr M». 
A m air, eiriau, »m. [gair] a round-about word 

or expression ; a periphrasis, circumlocution. 
tAmal, con. [=Mod. W. ka/af, in the sense of 

"w'. /<tl, ftl: O.Ir. amail; L. simi7r»; Or. 

ijUfliMf] that {ut.).—CodBc Juvmcus, 32. 
Amon, -au, a/, a stable.— J7. Salisbury. 
Amandlya, -iau, »m. [O.Fr. amande, a?nandT*, 

almande ; L.L. amandota; O.E. almand, a/- 

mauTide, almond, atmon (from L. ami/ffdala, Gr. 

i|iiuy&(A)]) ; and W. Ilyt] the almond. 

Ad val y mae yn yramaitdfyr tji pbeth. n 
diD. H puiKlD. a chnevlllyn. kc elwH on 
val hynny y mae tflif person y [of . yn] un T>i 

AmanwsM, weision, em. a stable man or s 
vant ; an hostler. 

mar, -oedd, sm. [ir] a noise on all sides. 
Ef myd [mnd] et llafai el yn orddeat 
^hliryuy anarar vyneb d&ear.^T'a^ii^'in; M.A. i, 23. 
Adwen llyw yn llawd 
Ac edif gynnif snawd 

Edym trin wdjrym trydar erehwynyami 

Tmifd varrbawc "eitch amar.—ltgv. Jrrf. 1. MO. 

Amarfoe, a. armed at all points; armed all 
tround ; completely armed. 

Hal hyn imar/^ug vyf— Uy man bb 

Vj myw, ynC rhasof ddiflb ac iach&d- 

If. O. Ay*r; Tmton Ckto. 
Amarfbli, ' ) v. [mawl, moli] to praise greatlj 
Amar&wl, j or nighly ; to laud. 

Yma y codes y dylltian ae a ddwbn^uwys ]/mar/ttuil [ma- 

ulaull y rwidd. . ■ Ar hyny welc'r boll deulu yn edi7ch 

yn hy^ueh ar y ^olomen. ac yn bwrw aarrug-wnwr ami 

am na« aaarfoKtaaai y pflDcoTdd yn ddysyml foneddiicaidd. 

lalf 3t!t. ITS. 

Amaro, int. [aro, aros: ct. cyfaro] an cidama- 
tion of supplication ; pray ! I pray ! 
imaro, dovich ! pray, come here ! 

Amarwain, v. to lead or conduct about. 

Amarwel, -ion, «n). a view, a prospect ; a 
panorama.-- I<^ti Olotsory. 



ridias d 



ten J «Ld (2» 



ii dir oeth m ddoded r 



Ambawr, ) pi. omborion, »n». [pawr, pori] 
Ambor, I Bward, greetuwiud ; the grasaj 

surfaoe of laud ; turf ; a green ; graaa-ground ; 

grass, paatuie. 

C^yduant raunllAwr, UodAUwr an^irr. 

U^: ^n*. iil. 106. 

F^ mlir ef td iawn «1 frrd 

At hver fweU lu pheUAn' 






OirfcA amtawr, ) ^reenswatd circle or enclosuro 
Cvkh ambor, 
Qorsedd]. 



igreenswi 
(in then 



myKt«ries of tbe bardiii 



Jfom ambor, the stone on the green or sward ; 
a heavy stone intended in former times for 
farial of physical strength in the guirofgampau 
or manlj games ; and hence called also maea 
gonkat and maen camp.^S. W. 

Btot/d ambor, 1. food takeu by shepherds, or 
by workmen, out in the fields, about the 
middle of the afternoon (much the same as 
the andra, aajuiom, tiTidem, or omdora of 
the North of England). 2. a coUation or 
slight meal taken between dinner and snpper 

■jn the house, corresponding with the modem 
'tea,' called cy/noifwyd in some part of 
North Wales, and au^ier/acA in others. — S.W. 

Oorwrdd or yr ambor, to lie on the grass. — 

Ni KTtgwyi ambor ei one^ach, a more honest 
person neTer trod the earth. 

C^n Imed imcnh a^ a gerddvyB irTiieb umber erloed. 

Matt ceirth ar yr ambor, to sow oats on the 
grass or surface, and then plough the ground ; 
•aid to be an old process in WolBh husbandry. 
— Llanover Mi. 
Ambechrwydd, tm. sinful propensity, sinful- 

Aghfii Jt eneid »areid anrwyt 
A daw mm bodirav anttudtrvvt. 

SUic-L It OmUamai : U.A. 1. 8». 

Ambeuiaima, v. to protect, defend, or shield 
allaroimd; to protect at all points; todefend. 

Br tarn, mu'r Tirioo duwt 0*1 lul. 

A'l gKted ef nj diafjM, 
O'n CTloh yn aaabtirUuinu'n ^ 

Ambell, a. [pell] scarce ; few in number ; some 
Mid oedd hon ddim ond gwtl brtdd o Mr i tOr, M ladM 






Brvlua : BmCluiukt, 9 



AmbtU leaith, sometimes; at times; now and 
thon ; occasionally. 
Tr wyf fl yD lied uuuheu f byidai Hjirel -huMI maiik 

Feth ambell, a rare or uncommon thing. 

PrO, sHtcU. h«b y Owenwlyd. nyt heb ormot oollet * 
geUrnt umili uiBydloDyoD cbiri yniKyuHuat ar anwl Syd- 

Dynyon un jwelaut amprffa/ yn y byt yv adunt Ty od- 

I'n amhell ac yn anami, few and far between. 

HI bo ar ioed. « ni bfdd byth brcKethiryi da ood n 
ambrti ar j/n amami WTth nfedi'r bob] BjaA i'w dn^- 

Mor ambell, so few ; so scarce ; so rare. 

Ha« ^wir dduwioldvb a rbinwcddol fywyd ^rwedi myned 
nor awJidl.—Eil. lama: Ham. i. IS3 |cf. 37, Ti). 

Braidil nn o bymtbeg & tedr dduUain ac jagpteau L'ym- 
iHw; AC o't BchoA byn y mac, bod llyfrau Cymneg- jMcr 
aH&U. — Sion Trt/redyn. 

Ambellach, fewer; more rare or scarce; less 
}re limited. 

I fychanom neb am fod ei ddoaiau ef yn ambtiliK^ 



51 With the pL, ambell refers, in S" 
to quality, sort, or kind, as well as number. 
Ambell ddynion, some (sort of) men ; certain 

Ambelldodaeth, -au, ■/. oligarchy. 

Yr oedd mewn swirionodd . , . jn ambtlUodaOh yiprydol 
(n«aly*od>aathycliydlaw$T)^ canyaygallullywodneClioI 
oedd g<ir o ddeuddee o ddynion. 

AlhraKiaM;ir Sgli-t-. Tli. t [SOT). 

Ainbelldoctawl, a. oligarchical. 



AmbeUenig(i!),a.beingfewinnumbcr; scarce, 
sparing ; sparse ; one here and there. 
1» ambellenig, at times; sometimes (but not 
often); on rare oocadons; sparingly. 
As mawn hopynt ef a ellir, yn ambcanif, ydiydig 
anghyfartAldeb raini; baiun o nil nea ddiry. 

CK/riaocA y MrirOd, S8. 

Ambellt, in the ' Oododin,' 206, should pro- 
ably be read am betlt (=;on the ground), which 
is the lection of some Mss. Bee Pellt 
Aeaawr deUt anklli [oJ. am bellt] ■ adiwei. 
Ambellwaith, adi'. sometimes; now and then; 
at times. More usually written ambeil uiailh, 
q.v. 
Nid tor cymmerud. pui fo> bauan yn decbreu & llafar- 
iald, yw bod ban yn ea plitb ambfttwaM yn dechraa A 
obydBBiD.— Cji/WbocA y Btinid, «8. 
Amben, -au, ef. [pen] a hat. 

Tr hvn a wi^« ambtn ddu ym mk Gorphenaf, a ^slff 
ddengwaitb mwy o wybed ami, oa^ a ffa d gTfaill a Wi4^ 

0*1- Thai cyntaf y nneir amhenau boaaiLaq, oaplao, a 
pbethan ereiU,— SicfHiuffiJtl, iii. 71 |Dt. 84). 

Amblygu, i'. to involve ; to infold ; to inwiap. 



,>gle 



Ajibobbi 



Amcak 



Ambo«ri, t'. to epit about ; to bespawl around ; 

to bespawl. 
Amboeriad, -au, *ni. a ti»tting about ; a be- 

epawling. 
AmboerwT, wyr, «m. one who spite about ; a 

bcspawler 
Amboethi, r, to heat all about or arouad; to 

heat greatly. 
Amboethiad,-au,«ni.ahcatmgarDund or about. 
Ambor, tim.^Amb'iv^, 
Amboraic 

flwardy.- 
Amborthi, v. [porthi] to bear or cany about 



Amborthiad, -au, »m. a canymg or bearing 

about; circumduction. 
Ambr, im. [Br. ambr; E. amber, \ambre, um- 
bra, amhi/r ; Fr. ambre ; It. umbra; Sp. am- 
bar; L.L. ambar: from Ar, anior] amber. 
Unnaturalized, and scarcely necessary, as 
gwr/r HupplioB its place. 

QweUiiil«!fydm™y.mwaiiiW [•(rweft), f el )rweledi>d 
tin o'i fawn o unifficb.—Stc. i. 38 (cf. * ; riii. 2). 
FeipiUT yTATOfiliad dir1cddA4'rutig]fidd . . . novypfr- 
bnigyii B'jm.,- TBtyr. ii. B |lSa). 

Ambreu, a. delirious, ecstatic P In Br. ambmi 
signifies ' dflire, transport, rfiverie ' (Le Goni- 
dec, s.v.) The Welsh word should possibly be 
read amntftr^i, like amprvX ioiammhrudd. It 
seems to occur but in the following pcMsage : 



Ambylu, V. to blunt all around. 
Ambylua, a. blunt or duU all around. 

purpose ; iutentaon ; intent ; design. 

frgyd, scope and intention ; end 



Nytoe 

Nytoo . . 

EuTdwTTi oflt y iaufD yay loflan 



Vrfiddilu: H.A.i.3 



AmbcoB, Bm. [Or. 'a^povia] the name of a 
plant, apparently the same as ambrott of the 
old English herbalists, which with some is 
the wood sage (Teutrium icoroihnia); with 
others, a kind of goosefoot {Chmopodium 
botryt) ; while the tiwulator of ' Headygon 
Myddfai ' gives AMpltx olida as the botanical 
name of umbria. 

'r anryrllyi, tel y MtwKig, a'r 



Ambryniad, -an, tm. a purchasing or buying \ 
Ambrynu, v. to buy, to purchase. 

TrldynnfddylynnohoiiyiitiHrrll'newiibimi: . . . all 
yv. dyn ■ inftruiiD lednd i7Aiddelunwaitli,ii«ii<nddl- 
Hrddsr yn Ueirb u gyboedd lieddw<Ji. 

I^ionU C^raUh: H.A, iii.aS7. 

Ambvl, m. 1 a. blunt or dull all around ; very 
Ambol, /. j blunt or dull. 
Ambwyad, -au, $m. a beating about. — P. 
Ambwyllgar, a. circumspect; discreet. 

Oydwjbodg»r pob dwyfiLvl, 
DirytftirlpobantiDv'W.— iVrii. JrcH. ill. 111. 

Ambwyllo, v. to deliberate. See Hambieyllo. 

Ambyd, -iau, tm. surrounding danger or peril ; 

danger or peril on all aides \ great danger, 

Er bod d ium yn dyvyll lawn, 

A'i fTordd yn ll&wn ^elynloD ; 
LUw I>uw m'i dwg. drwy'r iint^ maitli, 

I ben ei diltb yn union. 

loh 3torgaitv3 ; Sainuu, ii. cktw. 3. 






r'std priodol y llyfr hvn yv ■nsog yr hwn 
D mewn enw, i Tod yn Grisbdn meim fwirioo- 
ouu.— IT. ,1. Davit: lijtt J B«. I. J. 1. 
Trwy ddAl eylw at omtnn ae rrftd yr awdwr. 

Amatw, eryyd, a Ihueddtuid, 1 scope, end, and 
Diben, frgyd, ac uinraii, j aim, 

Tr hwn ay'n nyfirwydd yn yi YHiytliyna u yn gyd- 
■ubydduiAff AfbTmwiartbffiu-iLffeniyadyn hawdd anvoui. 
troMd, a Uneddnod yr ErthygL hon. 

Joan ll'allur. Dwy BngeUi, M (et. M, U). 
Ergyd ac amcan chuKdl, the moral or point of a 

fable or apologue. 
AtTuxin yw geny/, it is my purpose or iiit«nta<Ri ; 

I intend. 

■ 0lv«a-l.v„ ,„„,«„, 

C^nlug : U.A. i. MS (cf. I 



rmnith oddi with A 
IT tu ffigysbKO, u 
-!>•■. J. bavit: U) 



£t weithiiui s'd dyfslha. ~ 

2. object, aim (i 
intention. 
Beth yv) ei amo 



iw] ; ultimate purpose o 



what is his object P what 
end Has no m new ? what ia his intention 't 
what does he aim at? — C.S. 
"i. a conjecture; a guess; a supposition or 

hypothesis; notion. 
Ar amcaii, at random; by conjecture; by 
guess ; oonjecturally. 

A rbyw WT n dynodd mrwu bwn ar ei amtan, nc * dafww- 
odd fremn IhiuvL — 1 Br*i*, uli. 84 ; 3 Cron. rriil. S^ 
Nid nugyi ar amcan, not as uncertainly [£. V.). 
—I CvT. ix. 26. 
BwTw amran, to give or make a guess ; to con- 
jecture, to gucHS. 



hawdddc 



nM(™llwEi 



ferud ; (cUy ni 
nl & goUodd hi 1 



^. 



Gwybod amcan, to have some notion, idea, o 
conception ; to know partly ; to guess. 

Mi m omvin betb y nuent hwy yn a ddyndyd. 

Mor^u Uisyrf : Trl Ad. 10. 

A'is gum amcan, I haye no notion, idea, or oon- 



ATitcan daiar. any idea or notion whatever; 
the least or remotest notion (mostly aft^ a 

negative). 

Nil ^wn i aiixuia daixr p» ddrwg elll honiu) wnentlniT. 

4. what may be deemed sufficient, adequate, or 
necessary for a purpose ; an undefined quan- 

Rhiwtier afuLiu nirion y ooedydd, a. cbymmerer y bywyn 
iin anaiiij ■ hiunn 'mean a 1^1 ; a rl^oddcc bwnw yn tmig 
ymborth i*r ptentyn ddiwamod a DOBwutfa. 

Mtddgsm Mrddfiii, 0. 11 (ct. S, Sit). 



Jm V_.(,K)t;iL" 



Axacma, prrp. about (not much above or below) ; 

Amain pnm cant, about five hundred; some 
five hundred. 

rr ydnnt hjnny : vrut ■ 



^jfodea Idinulot. — Si. Grta 

A tbfDIi'r ymflia fn Aeai 

omcan tnrch nablrn.— <r«rltr 



1, heb ulAel o drwch min 
. BrirM, IS. 

fljDjddau cjn gvDl Cri^ jng nghoAvd. — Jolo Mt*. IW- 
Amcand^h, -iau, s/-ni. a conjecture, ^ess, 
auppoBition, orhTpothesie; a tandom opinion. 

HI A ddyvedAlfl feUr : us o amtaadgbitjH ^njcbel j dod- 
bwT HDTgbou ydoedd.— £</niiiu Scf^ddiaaH, ixvi. 

Amcandybiol, a. hj'pothetical ; conjectural. 
AmcaaC&rn, -aa, */. a random judgment; « 

gness or enppodtion ; divination. 
AmcBnftyd, »m. the bent or disposition of the 

Byn ocdd el tAfuroa anean/rj/d <tf . — Jtrtati Oihh^ Oi. 

Amc&niad, -au, am. an intending; a con- 
jectuiing ; intention. 
^nwnnt'ddau, intentions; purposes; conjcotnreB. 

Amcaniaeth, -au, »f. a conjecture ; a supposi- 
tion OT hypothesis ; purpose. 
Yr hrn ■ ^rybvyUoifl 1, njd 7W ood ameaniafth ; k, y^ 
g>C^^. oi kDim ddrwedTd, usd ;v hi mKauixU ui- 
nlw*re**^ yD y byd.— /frrmf £>«»■, 46. 

Amcaool, a. intentional; conjectural; hy^- 
theticaL 

Gtu fl DA foirmifl, ffwlw fQi 
Buitta ngein-liJCli 1 gann, 

A ptiob ffur i Fbir yo favl. — ff^ Gor^ f 

Amcanaail, seiliau, a/, a hypothesis or supposi* 
tion ; a supposed or hj'po^etical basis. 

IJawflr 14 ddrw«dwjd &t y pwuo bwD fan ddyagedipon 

tiwg Ht ei'^luro.— fii.i'^uWi.' CcinioD Alun, gie. 

Buffon, yr anujiydd dodfawr, a ddychymDiyi|odd ryw 
asuouaU n-f«ddoJ mBwn perthynaa i aoddiad y ddakr. 

/,l<uod ,r Om, i. 149. 

AmcenaeiliogT) a. hypothetical, suppositionaL 

Amcaan (a), v. to intend, purpose, or design ; 

to aim ; to attempt ; to conjecture, to guess. 



Iitnerrih lib g Cyriog: U.A. I. tM. 
Tmlidivyd ef mor galed a Omtt, <aii orfu unair ancann 
dto&o drwy Lyn a ehrir Gnmlyn. 

BrutJAcjxrjfVH.' H.A.ii.G24. 
DyUl gwelnLdo^cm anuan h ^vaBntbur dyidcin jn ddoeth- 
lon. — lerrmi Own, M. 
Uairei ffwailli yr amMniiii yiRrifenu htodt. 

Orrnias Otcain, IK. 

Amc&nus, a. 1, inventive; contriving; design- 
ing. 

A rvsdr dedhnn y dadlen. a nelet o Hengyst yr avr 
ano da cantaT ac aneaitu get adwast yn dignwn uohel o 
hyt y M.—Bna Or. di ArMir (B) : U.A. EL au. 
Cteaii fiLwl, oiiciiiiKj rom.^TVdiir .Jlid. 



Nid frwaeth mewu artj 



tl Amdatlu 

2. moderate; fair. — Otoait. 

Ameanut tt/amr, moderately large. 

PrU amainut, a good or fair price. 

Cnwd amcaniu, a fair crop. 
Amcanvaith, weithiau, tm. guesswork. 
AmcanwT, wrr, t »m. one who intends orpur- 
Amcenydd, -ion, ) poses; an inventor, designer. 

or contriver; a oonjecturer. 
Amcwyn, »m.^Amgivyn. 

Amchiraen, ) pi. amchwoiniau, »/. Tchwaen] 
Amchwain, j circumstance; an incident, ca- 
sualty, or event; a hap or chance; a tum- 

mswii dsrbodscUi mwy 

.. ,„ . .. „ U pubKitb ddal 

Trag^iryddaffl ryfel trwy ai nerth ai twyll. 

Amchwareudy, dai, am. an amphitheatre. 

Chwarrudai at amckwareadai, theatres and 

amphitheatres. — Qwyddoniadar Cymreig, iii. 

168. 

Amchwarenfa, ) faoedd, faon, feydd, if. an 

Amch.warw7£&, ) amphitheatre. 

AmchTelfd, v. to return ; to restore ; to turn. 

A chaD ny perthyn ar y deiinyd f ml tnuilbu o wdtbred.- 

oed B'wyr Rafna. byay ui> bebi^edio y rel hyuny yd 

°™"^ Brui tfr.™Xu.p(Bl:M.A. U. 186. 

A mwLha ditbou viobeu or cfroeUi a ou amehvtiav at- 
t&d wiceb e olvoeth all. 

Bnl Or. ab ArOisr (A) : M.A. ii. 138. 

Y Uyo yr h™ amoSBrfa Madawc ab Selyf. 

A11ICI1W7I, -ion, trn-f. drouTO volution, drcum- 
rotation ; that which encircles. 

Uatiuald o anr giryrdd 
Ei vddv, Bytb a blith aaukuj/lion gytnan. yn 
UiMawseddainarygledd,— »'. O.Fuglu: C.a.ix.47a. 

Amchwythu, v. to blow round about. 
Ainda«n, a. spreading about, surrounding; 
spread, scattered. 

£icb mawl mewD aaditta wyll, oud eoleahau 

Y mae fal llue ervrynawl yii y b«dd^ 

W. O. Puilu: Pal. 10. 

Amdaeuol, a. spreading abroad, scattering^ 

around; difiusive; spreading. 
Amdaenn, v. to spread about or abroad; to 

spread, to diffuse; to scatter about; to cast 

(Jl abroad. 

^lodau Qvynfa] 
Qan Anlaii Ivya y] 



l^Ht: C.OT 
AT loi o DTOB ay viaa amdaena, 
£r biftw, ffrmv ffnwyU net oddi yna. 

aefoeddgi 



At led o diXH dy wlad ar 



O. PugSe: B.D. vl 

Amdaera'wd, odau, (m. [taer] importunity. 
Qwinwd amdamiai [undscnwd. p.] am daw ga 
AmrybuCboemnllair.—Ctniiltlrlw.' U.A.1.1M. 

Amda«ru, v. to contend; to dispute; ' 
wrangle. 

Owedy amdoerv boma bntdym. 



Jm V_.(,K)t;iL" 



Amdaitli, deithiau, «/. a circuit ; a Joume^r. 

Dafydd ab OwiljTn, jn diuu drwr*! htiat, i dduth jn 



Am dan (with the personal pronouna); see 

Am (2). 
AmcUuiii (il), [tanu^taen«]^Jm(Io«iu. 
Hanuini, KyUKyflawnderliedd, 

Yv ei drugaredOftCom ; 
AmditHodd, mcKy" gwHlh o'r Dst, 
Ei guiod ef ua dujom- 

loto Morguntfff: flalmau, n. xzxrf. 3- 
Amdaw, nn. silence all around. 
Titavell CjTddylm ft tjTryll heaio 
B<^b aim taeb aleuHd 
EUd unilaic un dansd. 

Llyicarcll Hen: H.A. i. IM [A.B. ij. Kl). 

Amdawd, dodau, tm. [dawd, dodi] a covering; 
dress, raiment. — P. 

Er rdoed Owsio bir brwy^ bedjrd 

iklmol: M.A. I. IM, 

Amdawdd, doddion, im. solution ; decoction. 

Cynmur dalr UwyaM o'r frwjrf^n^ a dyro in(?wn benr o 
daK4d yn y Uyn brwd. — iltddggon Stj/dd/ai^. 796. 
Amde, -on, tm. a covering; a garment or 



vesture. 



thjuiddwrn. 



; U.A. i. 38. 
FeBoaonaulwjrawidi.-Ttll'iiii: U.A. i. eS. 

Amdeithio, v. to go a circuit, to travel about, 
to itinerate. 

Amdeithiog, a. itinerant ; wandering; cir- 
cuitouB, 
' NiallsrwadB nod ^TffoiddiinS»l dyig a docthineb 
rn doitb-hir ac yu boemlyd ; j ddrin^a jn sertb an jn 
flltbravg . . . y gau ffordd amdrilhiaitff yn amrTfal. 

ffcnri rerri! Egl. Pfr. iliii. i. 



Amdir, -oedd, « 



mding land. 

Ban dlffon brodorkiTi t, atn-linl Hon. 

MyrdJin: A.B. ii. se (of. K.A. i. 1ST, SG9). 
Amdlawd, dlodion, a, poor on all sides; very 
poor or miserable ; poor. 

^Hdtoiirf fT nfaafawd ai ly nhewi. 

Jfrifir,' U.A. i. IM (ct. KH, SIS). 
yi« <aii]yD oi dda oi ddiffir ymdra 






■. r~id <,\ 



.- H.A. i. 



e,ue|. 



Ameu brivedic anbf ^w( ynrd Taiduu 

Jfalnnagiot, 11, 33 {or. 1. SBB] , 

Amdlodi, tm, poverty on all sides; great 

poverty or misery. 
Amdo, -au, «m-/. 1. a covering; a wrapper. 

TtBBaMcjBamdagnngniiax.—Cittiiodjin! U,A.I. «3S. 



Ei Ui(« ddinaaMdd lydd daa amda Uaitb. 

r. Lli^ Jona, i'r U 
Aimdn am hen harfhReo byll. 

Gonjliiidd heb benBlog erchyll.— Ciwiieii Owein, 109. 
!. a shroud, a winding-ahoet. 

DangBTB Iddi T AoDuJD rr hm r kleddit hi juddaw. 



Ni* oanljn dim o'i olnd bjdawl d, o< 



Yna TTudHef idav . . . zms o waet Yatypban VFTtJk jr a 

bur' Peder ebuitfll. aC amda Ichsd OtJEt. a* gyildl. •« 
ganffyl- — Campau Cfuirtjfmjfi, i 4, 
Ac amde'a dypwyddo yn dw iddi. 

£d, Biikard: Bogcdl^vrdd, 1. 17. 

Amdoad, -au, «m. a covering; an enveloping. 

Daiu ys d berth 
A tHdiiAd telaid ffvenal hi th hoff . 

W. O. Pufhr: C.G. m. KS. 
Amdooio, I', to trim, clip, or cut around. 
Amdoi, V. to cover on all sides; to envelop; 
to shroud, to enshroud; to enwrap; to plate 

drget ymi hyt j outeU pcTMrLue. 

A laaerib vedi cymmend j oorff, a'L kandOdd ft lliam 
glln.-tf'Ui. uYii. sa (cf. Uan it. 16). 

Byddoit yn arfar y pryd hyny, ac o'r blaen, pan r^dai 
cyrff y breninoedd in«mr i'w mA rn tin i'w llo^i, o'n 
kamdoi bwyut A'r Uiain a wnod o'r llin hwn. 

HluLacit: Dmallni, d. 

AmdoTch, -au, amdyrch, a/, an encdrcliug 
wreath or coil ; a clasper. 
Amd^ch, claapers or tendrils (in botany). 
Amdorchi, V. to twine, clasp, or wreathe about ; 
to clasp ; to encircle. 

Dechreuent y cym jlan tew 
DywyUu oil I btrn, a irorlwyd fwK 
JnniDn-Ai,— ft", 0. ArffAr; CO. n. 86. 

AmdOTcbiad, -au, 1. am. a twining or dacning 
around. 2. {pi. -iaid) a clottper or tendriL 

Amdorchog, a. wreattun;; or clasfong around ; 
encircling. 

Amdorchol, a. wreathing around,twiningabout. 

Amdorchydd, -ion, nn. a clasper; that which 

AmdorrAgddiaa y cucmner a ymlungaot l*r haul. 

Mu/tTdndiu £ftrw», 110. 

Amdori (<f), v. to cut about or around ; to om- 

Amdoriad, -au, am. amputation, — W. 
Amdowellt, »m. and d. [amdo+gwcllt] lyme- 
grass {Elymue). — H. Daviea : Welsh Bot. 134, 

154. 
Amdraethiad, -au, im. treatment; expatiatiou. 

Oh I ddllyniad y tf«tua yn d symlder yagrythymt ; osjoia- 
drviftAiad amo nm bod pub pwynt mor olou »g y g«Llir «i 
vneyd A ffeinau eglur . . - y dyljd rboddi y Radair faidd- 
ooawl piflwn eifltoldfod, yrnddpT^^yB t mi toa ybeimlaid 
mdl cydavna «u awydd yn vywir- 

W. Jimri: Bam a Deifelydd, 61. 

Ajndraethu, v. to describe circumstanti^y ; 

to treat of ; to expatiate. 
Ond yityrif^ fod gan yr avdwr, nld yn unlg el deqCnu 
i'w drin, ™d Bi Arwr i'w oBod aJUn^ yn aruly^ gor^vrjl- 
ioD anreinid] at yr adgyfodiad, geihr honni nad ydyw wodl 
anidraetAu yn ormodol. 

W.Jcma: BainaDarfelydd (Bhaglithl. 

Amdrai, a. that is lessened or diminished on 
every side ; greatly dinmuBhed. 

c/rSfafi,r.°Mj!!'i. BO (cf. aoe. 868). 
Amdraill, dreillioD, dreilliau, am. circuiuvoln- 

tion, circumrotation. 
Amdramwy, 1 v. to wallc or move about; to 
Amdromwyo, | walk up and down ; to ambu- 
late ; to walk ; to perambulate. 

Ac ymffylknull am droll amdramvyaH 
Fal i bu ym Manffot bja ungyT du, 

Oldau, Cff^vg : U.A. i. «». 



AvmUM WT^TI 1 

Amdnun'WTsd, -au, mn. ambulation ; a walk- 
ing or moTing about ; perambulation. 

Amdnunwyol, a. ambulant, moving about ; 
perambulator?. 

AmdnuntTTwr, yryr, im. an ambulator, a 

Amdraul, dreuUon, drenlian, «m, waste, w«ar, 

or oonnunption on all sides ; corrosion. 
Pb luni yr ebt«dd«h chwi yn unfg a Axa andnmJ 

pnddlDeb otemw !— Anurioj, ixzlx. 
Amdredi, •ion, »ni.^Fni(jrefA. 
Amdrechiad, -au, Km.-^YmdTechiad. 
Amdrecbu, v. to strive for viotorj ; to oontend ; 

to exert. Cf. Ymdrechu. 
Amdreig'l, -on, -ion, »m. drcamrotation, dr- 

cnmgyratioii ; n ramble. 
Amdreiglad, ) -au, »m. a rolling about ; dr- 
Amdrsigliad, ) cumrotation, oircumvolution, 

drcum gyration, 
Amdreiglo, v. to roll about; to ciicuuiTolve, 

to circumgyrate; to revolve. 



O itj l^Mwdydd, gAD aq 



vtjrth. 



•1 !At. 



-iau, »f. a glance, look, o 



Amdrelllio, v. to roll or turn round; to dr- 

comvolve ; to revolve. 
Amdrem, 

around. 
Amdremiad, -au, am. a looking around oi 

Amdromio, ) v. to look, glanoe, or gaze around; 
Amdremn, ) to look about ; to survey. 



Cwtieopiter 



«(<!r. vi 



1. I\gh^: E.D, 

Amdreuledd, »m. oorroaiveness : the state of 
being much wasted or corroded. 

Amdreuliad, -au, tm. a corroding; a con- 
suming, wasting, or wearing around. 

Amdreulio, «. to consume all round ; to cor- 

Amdriat, -ion, a. surrounded or encompassed 
witb grief or sadness ; very sad or sorrowful. 

A^rvt BTf ^rpbwyf ym iTorpfaea 
Ymdru can c/n oirwail dcrw«n- 



W. O. rtiflH: C.G. i.SB. 

AmdrOi -ion, on. a turn around or about; a 

circular movement ; ciroiuavolutioii, droum- 



AtoD/ild nuwrion, llyAilon ya en rhed . . . 
Ac Monig h M yn amdrovm Amr. 

Carr/Mwek : CemloD Aval, in. 
G«»d&l {j Mr] i olfuav dalar bc 
I iTwadnieUin nl amtiroiaii dydd K im. 

H-, O.PufJii: CO. riL*0«. 

Amdroad, -au, am. a turning roiud; droula- 
tion : droum volution. 
A hj-d eu heiUmfoedd y mite ei amdr«iij. 

M-. T. Britatt: lifttj Stlnma. it*., 1 . 

llBd^nrn.- El/-n« 



3 AUDRWSIAI) 

Amdrocb, a/.=:AnidruKh, q.v. 
AmdrOedigaeth, -au, if. circumvolution, dr- 

cumrotation, circumgyration. 
Amdi^i, V. to turn round ; to riroulate ; to at- 

cumvolve ; to revolve ; to meander. 

fi ft'th fftyvaf, ebe Eidvyll ; ac yna ti^wi, gMi nmHroi 
el fsddwl ■ WTwIai et dangoA 1 Bidiol a ddiobooEi ufer a 



chel yn ei 



Oedd ttraiif o fynor hwn a ewimi fry 
Hjd J liymyUii, by^rd oedd o bell, 
O DO etgjult hygyrch yn amdMi 
Oddaw.— If. O. /Vgit,' CO, iv. 601. 
A'l bymdn^ fydd^ beb atndnn, 
Cr piTd hwn er parotoi.— /. O. Oririmgdd : Oeir. lOi. 
Amdrom, n/. l.^Amdrwm, q.v. 2. pregnant, 
big with obild ; heavy with young; gravid. 

A lavjr Ddc at y girydbet neu yr adar yn yr awyr ny 
IhyWraoei o( ar yr nn o honunt eUbyr on awelei yn amdrom 
ual y ttbyg«i na alleid nn pedcetric, . . . Ac vn ubtmiuit 

Amdromi, r, to become heavy or pregnant. 
Amdroai, v. to drive, toss, or send about; to 



Amdrosiad, -an, im. a sending or tossing 

Amdruth, -ion, »m. a fawning all round ; 

general flattery. 
Amdruthiad, -au, tm. a fawning or flattering 

to all round. 
Amdrutliio, v. to fawn to all ; to flatter gene- 

rally. 
Amdrwcb, m. ) pi. drycfaion, i. breaking, cut- 
Amdrot^, /. I ting, or mangling on all aides ; 

lopped OH; amputated; broken. 
Amdrychion, amputat«d or mangled ones. 
Oed porTor^wugyadnrdfrdfMilr^cAyM. 



AmdrycliiDed am drychu ni« i 



Oe^ddtlw: H.A. i. S«e. 



U;». ai U^terl^ : H.A. L tW. 

bdbyw byd nend amdrvK/i, 

Cri»u. H-m; U.A.t.33S. 

Amdmch, drychion, tm. apocope, absdssion, 

Apooope, AtMcimtd, AntdrjpeJi, neu loflfrymdor, sydd pen 
dorer UytbyriD neu nlllaf o'r pen ol i air. 

Am LIgfr Cirddmriatlk, IIB. 

Amdrwm, m. ) drymion.it. heavy on eveiry aide; 

Amdrom, /. j very heavy ; heavy. 

At Deb a to ynddo y Tbann vwynf or ddacar. amdnem 
ddiawg rvftnddedte vydd fif n^vl ai irdthrvt obc^rwydd 
aiuyan uaaerawl, ag aovirwm ci veddwl aa weithred. 

Pe gwnaethai un o noddynt, fi fuawi 'r dadfaich yn ya- 
nfiwBh ac yn hylTarddaeb I'm hywiryddau ivitfrvoiwa i 
Ijan Leiiaint.-Zir. n. Wiiiunt irurfal, 6*1, 

AmdrwB, -ion, «7n. a garment that covers all 
round ; an upper garment. 

Amdrwagl, m. lu, very clumsy or awkward; 

Amdroagl, /. } inelegant, 

A pluui ytto«lynt uelly ar yr ymdldHn hwnJiw llymft 
vorwyn ieuanc nduwyndeo yn dyuut nttunt gan y"Oyii yr 
aToO- ar geTyn paltfrei a eherdetynt af/inrfgifl gaothav. 

Amdrwaiad, -au, nn, a wrapping in clothes, a 
drcumvesting. 



,)glc 



AmdrwBio, v. to dromavest ; to cover orer or 

sroimd. 
Amdiychiad, -an, *in. amputation ; a cutting 

or mangling around. 
Amdrychu, v. to cut or mangle on all mdea; 
to amputate. 
AmdT^tkid eitid ufofrion 1 Uvr 
Am eurvla-wr mwvnfHwt Moo. 

Cumddc!^: M.A.I, »9(ef.»Ml. 

Amd^chwiliad, -an, rm. investigation. 

Nidjrw 

AmdrydiwT, wyr, atn. au amputator. 
Amdrjnnder, -au, im. heavineas all round; 

groat heaviness ; heaviness. 

Am<lri/milrT henainl, the heavineM of old age. 
A ^velct or iuilcfl j iiirll yn lliChrmT jmrth te amiirifm- 

der Ar-n'iif, J dmnmi ae raka«luiw«w a Kvtjat ilt j n^ 

iyweAedic amhsmrdyr lenaois.— Ann a Haulm, 1 1. 

Amdrymu, v. to grow or become heavy; to 

A phui iTTbD Ltt ei fod vu amfrvnii. 

ar.atAnli'r. ID.) 
Amdrt/mu gan henaint, to grow heavy with old 
age. 
Amdryn, a. encompassed with strength. — P, 
Andryui (fi), wn. [tryn, tren] strength or force 
on all sides; great ardency, — P. 
AnniryHni [aV. uD dtTTmlJ drylAV drflenQ 
Oweiiudy«WT yi^irydBWr yn gwritbjea. 

Ai"ri.: Oudodm.40Slcf.3M). 

Amdryatio, i;. [trwst] to mabe a 



; to resound ( 



oUsJ 






Amdnog, a. inclined to all sides. 

Cswn Todd so sdrodi] den-fodd amdnnnig.—Rh^t .Van mar. 
Amdwll, a. full of holes ; perforated. 
Amdwrdd, dyrddau, «m. a noise from all sides ; 

a tumultuous noise. 
Amdwrdd, a. tumultuous all rotmd, 
Amdwyen, *f. [am — ktwy, twyo] Eurynome 
(of GIreek mythology). 
1^ bynnog rhyw 
HiuCffion bKPTfiC ym miw dyutoa aid 
Eu RiiHl. ■ phmdlid fal ilarffon ac 
Amdv:!jra, Efm fawyrach peU vi c-Juifl, 
Yr oold w Oljmp g yntaf rhwysg. ivm apnt 
BhBB ttedwrnlmmt, ao lift, crn faA Idd. 

W. O. P„ght.- CO. X. S77. 

Amdwyo, v. to trim or arrange all round. 

Amdwyol, a. trimming or arranging all round. 

Amdyfiad, -au, tm. a growing all round or on 
every side. 

Amdyfol, a. growing around; exogenous. 

Amdyfu, v. B> grow about or on all sides; to 
grow on the outside (as cxogcns). 

Amdylliad, -au, am. a boring around ; a pene- 
trating on all sides ; perforation. 

Amdyllu, v. to bore around ; to penetrate on 
all sides ; to perforate. 

Amdyrddol, a. noisy on all sides. 



Amdyrddu, v. to make a noise or tumult oa 

every side. 
Amdyriad, -au, tm. a heaping or accumulating 

Amdymi, v, to heap about; to aooumulate on 

all sides. 
Amdywallt, r. to pour round; to spread rooiid; 

to drcumfuse. 
AmdywaUtiad, -au, «m. a pouring all around ; 

dxcumfusion. 
Aiodywymad, -an, am. a nhining on all sides. 
Amdywynol, o. shining or glittering around. 
Amdywynu, v. to shine around. 
Amdywya, 1 u. to lead or conduct about ; to 
Amdywyao, ) lead around. 
Amdywyaiod, -au, «7n. a leading or conduduig 

aroimd; circumduction. 
Amdywyaol, a. leading or conducting about. 
Amddadl, -au, tf. [dadl] conversatian, oollcxjuy. 



Ajndd&dlo, V. to converse; to dispute. 
Ajndd&ngoa, v.-=.Ymddango*. 
A phan amdaa^aurt e Krai haoiu. 



s umdiiai>go4 seems to be used (in an 

active senso) where arnddangot woidd be more 
correct, and the reverse ; as, 
Uiyma Brat Hab Deo ma] ydh j/m4tiaHg*$ttt Deo j xuboii 



Qmithieusf aiHi4i^iifjr«>iig^ia _. 

Amdd&if, ddeifion, tm. a singeing around. 
Aniddaif, a. singed or scorched all around. 
Amddal, v. to concur with ; to coincide ; to 

have respect to. — (iinmt. 
Amddaamal, v. to grope; to feel about; to 

fumble. 
Amddawd, ddodau, ddodion, tm. circumstaiioe; 

Nid i bob aiwUanf tya^ti.- Diarrh. 
Amddei&O, v. to singe or scorch around. 
Amddiftid,aid,a. [am— |-di"t-mad; Br.nnzi'ra<f} 
1. destitute; bereaved of parents; fatherlesaor 
motherless ; orphan ; being without relativee ; 
left destitute. 
Plant amddi/aid, orphan children, orphans. 
Amddi/ad o dad, fatherless. 
Amddifad o /am, motherless. 
Amddi/ad o blant. bereaved or deprived of one's 
children; childless. 
Pa ham 7 byddwo amiidi/ad o honooli eich dan mewii on 
dyddt— <;ni. izvii. 4fi. 

Amddi/aid o ddynitm, deprived or bereayed of 
men.— //oe. ix. 12. 

Yr amddi/ad a'r weddm, the fatherless and the 
widow. 
2. destitute, deprived; comfortless, cheerless. 
Mia gadawaf chwi ya ajnildi/ai^.-^IiwTt tIt. IB. 
Skeiiirm amddi/ad, bare or naked reason. 

Owalth otet Yfr JfOflod rlnnem amddi/ad i dd&uwU yr 
■-- —■ — — -MHw-JficiU.-; Omitlh«.«». 



AlIDDISTSYCHr 



Brmidd 7 denllodd tt nviditi/aid, dnulo, Tatyr rr rm- 
adlwU.— r Aiyaisa (Ul, t. 

Amddi&drwydd, >m. bereaTement. destitu- 
tion : deprivement ; absenoe of a thing ; lack \ 
low of protection ; prit^tiou. 

Amddi£Mla, v. to render or make destitute ; to 
deprive ; to bore*ve, 
ATnddifndu un o ryui heth, to deprive one of 

Amddi&tty, taj, mi. a houae tor orphans, an 
orphanage. 

1(» dm sftith mil bcncoiau vedi CaDyHriJlo tt voddoll 
amdii/<Ulx > l^kl&tdy.— Cy/aUl Sgln^rif, a C. liil. 110. 

Amddifadi, nn. destitution, bereavement; de- 
privement ; loss of protection ; lack, want. 
Amddifeidi, atn.^Amddi/tdi, Amddifadruydd. 
Ta mwy T^m tymhcUir i wyl&w nu i bref^etha, rhng 
"" ' " Ta™. ^■mm.- D.P.O. i, 8|B31, 

Amddifhrys, o, [diffwys] steep or precipitous 

on all sides. —Owtodin, 739. 
Auddiffyn ) m, V. [diffyn] to defend on oU 
Amddifl^u | sides ; to defend ; to protect 1 to 
uphold i to fortify. 
Or daw as gatat anut nu enpytTWld. muue otlKl. Bini 
>Ui amdiffg^Hx/ oe gmUBt.-ifat.i.D^'t», I. US (ct. 31). 
Kyr*?ha k wnAtthAnt e termaa oed bep riwdftwdim' M 



Amddiffyn ei hun, to defend o: 



Bself. 



idifflin t 



Amddifiyn, -ion, *m. 1. defence; protection. 

Ac Vchtrjt K uiDoim kr? nidcu yr irUt 7 TOKKi TT kiw- 
tawtWTT pvT bymwJ: a^Tei mttav ef 7 kufei amdiffifit, . . 
Gwalltet uchvluacr Kur Lofw 7 ^wr AorchTUTDnuKi 7 
bnnhin idsir UTHOdlx^ M aaiiffun XJocger. 

^ni< if Tifvj/aoffion, 8S. 
Ail ^WTtheb 7T awUiff^H. Trl rhyv 4ini.Mi^^ii 7 ffTdd. 
TVionU Csfitilh .• H.A. ill. SGS. 
COiodd en iantddiffr' oddi wrthynt.— A'an. xIt. S. 
jlr yr amddiffyn, on the defensive ; on the de- 
fence; defensively. 
Arfau, atnddiffyn, defensive arms. 
2. a defence, apology, or vindication. 

OiTTBDdf wch tj a-mddsfftrn VTtti7ch jr BiWT hon. 

Amddifiynblaid, bleidiau, t/-m. the defending 
party or side ; defendant or defendants. 
lUr brxint vKhanredavl peDcencdl : braiDt carcboi; 

nub Aitlt A gafer ^ui ei ffcni^, iraj qbb 
eh7clw7bo<' 

Amddifiyiidod, -an, tm. a state of defence ; a 
defended condition ; defeuoe, protection. 

Omwod 7 pren oedd 70 utura anddiJFandavtd d dut- 
lWTddiad.-//™n Ptrri: Egl. Ffr, m. 
Amddi^^nfa, fooedd. feydd, ■/. a place of 
defence ; a stronghold ; a fortreea, a fort. 

A"! boU bobi A danuut bob un ei gmgm . . . lu a'o 

^oaodaaant wrtb tt avuiiiijfjfnfn, ac a lugAAADt A bwynt jt 

Ac efe A OAododd aaddiffffitfi^ild 70 Edom. 

1 Ci-oA. itUi. 18 (cf. B). 

Arnddifiynfavrr, a, strongly defending or pro- 
tecting; affording gree ' 

Ei dhgtod a-tddifgi/ii-ar ef 
lor niAWr 7 nef bT E7f7d. 



. 1. a defending; de- 

. _ BAin.A'nbA 

tmiuig amidiJ^y»iad.—Bnt!ttt: Ninpfeb, ]. 

2. an apology, defence, or vindication. 

Owelwch .l-AH/jmimfy Btbl jAn Eigob WittoOD 1«n- 
dAf.— (.-KMjlHr Mcdiaa : Eglur C&Tgiad, W. 

Amddifiymaeth., -au, ■/. defence; protection; 

defensative ; protectorate. 
Amddifiyniog, a. that defends or protects ; 
affording protection or security. 
Na'Ul Adwn Dd rwnn tnuuAd peimAdur 
O fewo CHUr fBlcbfui fj modnt mad 

MAd anddi^ffnniaKV OeidWAd uivdAWd. 

Omlfm Ddu Ar/on: H.A. i. tlO. 

Amddiffynol, ]a. defensive, defending; pro- 
AmddifiynuB, ) tective ; sheltering, 
Arfa» amddiffynol, defensive arms. 

DeTQTddir ef fel arfarnddiffgrmi. — CffU\ffravtn^ U. ISt. 

Amddifi^or, -ion, -laid, »m.^Amddiffynwr. 

Ac 711a ffwadet tt amdd^fynor 7T kmiT 70 U7m. 

Cl/rMiiau Crmn, It. m. 

Amddif^nn, v.-^Amddiffyn. 

Amddiiiynwr, wyr, ) atn. 1. a defender; a 

Amddifl^nydd, -ion, ) protector ; a guardian. 

T tlwydTn tac wrneb j bn usT* Tcbtrot smb Uan DaI 
gwr Diawr 7 ralyHut ac timdij^i/vaier 7r e^lTT**^*!' 

Bnl f TtfinjiiigiBn, US. 
Ham m jr yaealaed. amdiffffniuVT criBtoniwTon. 

l-«. <fa Oarolo JfajM. col. «0. 
Owrlbprrtx OwTthoiAQ ... A WAhoddn 7 3Ae«iD gyntaf 
IV ynyg honn 70 ait-UifftifUinn Iddaw. 

7Vio«M.-M.A. U.ei. 
AmdAiffynydd y F/ydd, Defender of the Faith. 
2. the defendant (in a lawsuit). 



CDW priodawl 

Amddiiiytf, a. destitute of strength on all 
sides ; weak all round ; very weak. 
O OBnori VTiiTdawq n7 diAngwjA 
NAmen vn ATTf antdijfgr/ [aC amdilTrTf ) amdiifVTi. 

Aaearin : Oododin, 738. 

Amddigouawd, odau, ) tm. sufficiency or abun- 
Amddigonedd, -au, j dauceouall sides; su- 
perabundance. 
Amddilladu, v. to clothe all over ; to drcum- 

Amddiried, v.^Tmddiried. 

Dnw, 7T hun wyl wfr narth paitb all 7 a; 711 amUirial 
ynot, 711 dnwarog erbTH eio groldSaa. 

LI. a. a^JTrrdii 1B67 18. laf iredlT Dilndod). 

Amddiriedua, | a, confident, confiding, truat- 
AmddireduB, ) ing. 

A phan velH 7 BrTtanreit j AAaUi7d7<iii mor l«r 70 
kyrcbu yr bont 70 axuthIiwttus y redaasant yn y erbyn gan 
ryaedv pAfaua mar and^mhu y beidynt kyTcha 7 b<mt. 

Brut jt Tgw^ioffion, 189. 

AmddUtrwcIi, a. m&n^^g on all sides. — P. 

k7for kyfotwoh 



Amddiatrjrchu, v. to mangle 1 



,)glc 



AUDDRTCHFA 1< 

Arnddiychfii, fooedd, f^jdd, tf. [drych] an 
amphitheatre. 

N« gwnfTd rt™ (uu-hwT aiwf'(i»fVa »wiidI. 

YmddivffTi r trlch fel frrU-ledfdd drndufol 
Ar ddull rhTw amddrsdifa o Mngllch s Anal. 

ro.AM: P»l«tiii», 81. 
Amddull, a. multiform: multifarious; multi- 

Tersant ; having many forms or fashions. 
AmddwU, n, dark or gloomy on all sides; sur- 
rounded with gloom. 
Heud amddwli ftTTT oeud hvyr hinon. 

Elidi^Saii: II.A.1.3fiO. 
Arnddivyn, v. 1. to bear or carry about. 

DiTOw«ier«l»nBdn.i.Jis-(.— J»orri«: Oododin, ase. 

2. to contain, to comprise, to comprehend, to 

embrace. 
Pan ddywrdir, bud pyiBod yn y mflr. . . Y pywod o 
duddmh J m^'^r wy dnarymnwdd ; a aduwi to nlir dy- 
w«dyd «u bnd hTynt yn nm bpivn j mAr, ■> mOr yn ea 
h^mddw^ bwjnt.—lfnA ftm.- Egl. Ffr. Ti. 

Amddychwel, -ion, «/. the figoie Folyptoton 

(in rhetoric). 

^q/f.fv^vv7 liHHWdl y aydd, pan n^wjdir yr nnrhyv HIT 
I amryw ddychwtlUdAU, nea rif, am froiedl-ryw, ncn 
ddynnwd. ctu nthivwtb. a 
goddefo yr iaiHi. -M.hrf i*m 

Amddychwelfad, -an, 

taming from all sides. 
Amddyfr, a. [dwfr] urinous ; wat«ry ; humid. 

—P. 



, EbI. Ffr. uii. 

»m. a reverting o 



Amddyfru, e. to water, to irrigate. 
Arnddyfimrys, a. 1. watery, wet, or moist o 
all aides ; swampy. 

KymTnen nuelffi s diffwyi wharJc nohel etUiyr ugan 

^_..j. * »...jl 5i[j^Hit T (tyfryw- Ac odyno e 

iry&eb ar tir nmdjt^riryt hwnnw ynyi 



..lilFuHli; Oododin, TS 

/^pnrro: M.A. i. SO 
O. /VffV: CO. IT.M 



Nfli flodmawg dddl aimUs/rKs', 

2. bounded by waters. — P. 

Uiu B^'dft Hywel h4vl 'jm^di/frti 
Lew Hew trylew tmul diffn-rK- 

Ainddygiawdi, iodron, im. 
carries ; a bearer, a carriei 



Amddylln, v. to loot hard or frowningly; to 

stare (at ottc).-~(Jwnt. 
Araddymodio, v. to deal blows on aU sides; 

to lay about one. 
Arnddymu, v. to thrash on all sides; to beat 

all around. 
Arnddystrwdi, a. Sec Amddiitrwch. 
Ajaog, -ion, a/.^Ajltmeg, q.T. 
Ameirio, v. to disput« or contend about. 
Ameiriog, a. circamlocutory, periphrastii 
Arfer j nkarJ£«Kid 



._ Id bod yn rii- 

irhithynhir weddto.— IVni^U.V 



Amelliin [P]. 

Budymbt bufrh fenh 
Blun llto bUen h< 



AiiMn,-an, oifv. andftn. [Hcb. ainCTi; Or. iftqi'i 
L. amen} 1. amen. A Hebrew word intro- 
duced through the medium of Greek or I^lin, 
and, like many other cooleaiastjcat terms, ap- 
parently of early adoption into the language- 
It is accented on the last syllable, the quan- 
tity of which is usually short. In M.W, and 
later, it is often followed by a translation; 
as, bofd /flly, felly y fxi, felly boed, hoed felly 
y bo, or some equivalent expression. 



Tiy ei BW*ii, amtw, T DL 



'""r?.'.ic.a,H.i.i.«i. 

I. ab OvUtm, Bxli. M |ef. sa|. 
BenditrediB fyddo Aislwydd Muh Inrn-^, o dngyvydd- 
oldeb » hyd dnigywydiioldeb. Anun, to Jukh. 

Hall iddewidion Daw TDddo ef Tdyut ta, ao yodda ef 
A«'n.--2 C-f. 1. 20. 
Crim tjgtto't ineddyB lun. 



2. em. amen^the faithful one. 

Y petluu hyn y ni»e Amn yn eu dywedyd.— Doil. liL H. 
Ameagud, a. active in all directions ; ready oi 
every ddo ; prompt ; quick, 

T lu y ledrad nid aiMtcud i gsw ei grwUd. 

Ameth, -ion, am. [meth] a failure ; a lapse. 

O bob tir tnlb Bth welck 
Ao a bci amtK tn\h treu. 

U^. ah tltmlem .- M. A. I. MO. 

Amewain [Y], v. [am- -(-euain or ewainP] t 
move about ? 

Goffwndaadrwe 

Cwdd« mdd amncmir mwc 

Amfach, -au, am. 

Amfocbiad, -au, » 

around. 
Amfachu, v. to hook 

clasp or twine about. 
Amfiiglu, V. to ensna) 

ructions. 

Rhur i bwniw 
NpfoUldd lun, tmw^ i Mb dwytl 
USeroiWl. eu ha-t/aglt.— If. 0. Mi^fe.- C.G. I 
Amfar, -oedd, am. Q^} 1. wrath on a 

2. ono Qucompasjed with wrath. — P, 
Amfeaur, -au, in. girth; circumference, a 

periphery, a porimetar. 
Amfeauro, 1 v. to girt ; to take the girt or dr- 
Amfecur, { oumfcrcnce of. 
Amfo, V. to enjoy or possess. — P. 
Amfod, -au, gni. [C. ambo»] a common medi- 
eval form for Ammod, q.v. Amuut {Mab. i. 
240)=Anfodd. 
Odyn* diBnaoeth y doethant o bob n«rUi mi T«dwl ym- 
1^ „ J -- 



a hooking or grappling 
grapple around; to 
ir entrap in all di- 






y dywedauyot uc 



=; A mmiidiirr. Cf. Lri/ei 



AjIPOttDWTAD li 

Amfordwyad, -au, tm. a sailing around, cir- 

Amfordwyaath, -an, if. circomnavigation. 
AiatOTdwyo, v. to oircumnavigato, to sail 

Nid yw 7n nrofl d bod yn gron hefrd oY (cogltdd i'r de- 
Ivo. o blFf^ m avf/imtirffrr-i/il hi «rJoed yn y cyTeiriad 
hwmr.— AoifiarM Snijov;, [. 16. 

Amfbrdwyol, a. circumiiaTi^ting. 

Amfbrdwywr, wyr, rm. a circumnaTigator. 

Amforio, t'. to sail around, to ctrcuiimaTigat«. 

Amft-wya, a. [hrwyB]=Aia/ni!yKil. 
T Am/rwjia. in the jiaBBage quoted bjr Pughe 
from ' Klucidarius, ' u a misreading : see ' Lu- 
ddar,' J '08 ; and of, Annyfrwyt. 



I. that which has gaps or 

Amfylcbiad, -au,*ni. a making gaps or breaches 
all round ; a notching on all sideB. 

Amfyldkog", a. having gaps or breaches all 
around; notched. 



I. strong or fortified on all aidee ; 
»ery strong. 

Amgttdanili&d, »n. a strengthening or fortify- 
ing on every side. 

Amgadamluol, a. atrengthening or fortifying 
on every aide ; invigorating all around. 

Amgadaroliau, v. to Btrengthen or fortify 
around ; to encompass with strength ; to 
make stxong on all Bides. 

Anigadr, ^idron, a, very strong; mighty ; 
potent; vigorous. 
Oado^r byd yn amgadr bon. — QvUgm ah 8tfn^n. 



Amifiaf AnAn mafcwyrol. 
An^lch offylch mae'r cylcfa can, 
lU^iiyTol irni/'f aiiiai.Siai-alir, 1 Ori»m. 

2. an incloBure, a field. 

T» Ue metujdd prydfepth, oubomu te» b gerddi gor- 

Iswn . . . TT oedd mawnijir aiwirai gmcdiUwyrdolyoyfsii 

oU.— Gir|rIi>dviU. ix. n, 

Amgaen, -au, i/. a surrounding coat or oovering. 

Ain^a«r, -au, (/. a Burrounding or inclosing 

iroll ; a fortification, fort, or fortified place ; 

' " ivaUation, 



i. ms (ci. i 



Amgaeriad, -au, ant. a fortifying on all sides ; 
a drcumvallating ; drcumvallittion. 

AmgaeTOg. r. Burrounded with w»I1h or ram- 
parts ; walled around, circummured. 
Dinruofdd amgnfritg, dticB surrounded with 
walls, fortified dties. 

Amgaaru, v. to wall or immure on every side; 
to surround with walls; to wall, immure, or 
circumvallate ; to fortify. 

Pu lyddo'T ddinu wedi ci tanrom I mnriaii. 

Mf/frdodnu l/rrvcg, 88. 

Wsdi calfael o Oasvallawn hyspyrdud am bji^y, i>fp a am' 

(oCTinWoi adinaaoHdd.— CnrBt'-nrMKi:.- Han™ Ci-inni, 61. 

Amgall, a. circumspect, discreet, wary. 
Oorwyn blam af^ amoall pob dedwyd. 
Avdyl urden ajngm amgiri dlgavD. 

Amgau, (/, [cftn] minstrelsy. 

Yn dri yd rannad yn anwqii pvyUad. 

TalL-ni,: M.A.i, 
Amgant, -au. am. [cant] 

or surrounds; the bound of a district or 
region ; a precinct ; a circuit ; a border or 
margin; environs, confines; environment; 
oircumfcronce. 

QorfyunJg fj mhwyll ymhell inumnf . 

OtcalcMmai: H.A. i. IM [cf. KS). 
Am tTocbDant kein omyanf eoedawf . 

jLIiw. it /J^Hliia : U.A. i. 806 (cf . Ml, 288j . 
YnainffaniSobtutlarmojitoTtu. 

Oi>f^fiintd Brgdiriiiai: H.A. i. ITS lot. S7T, MZ). 
A frlywoiflt ti chwedl Bndifant 
Fardd. lie bu hsnld d d«i^ni t—IolB Ua. W. 
Chwi a aylvch tod y cylchaa cyfnnlDl, eitbr y cybrdpdd, 
yn c«e] en rhana yn ddvy ran anghyfartal, ag iddynt nn 
fwj HBii lai d'u hnitfinlaa yn yc arddryEh olou nag yn yr 
on dywell.— JSi/mm. SrryddiaeOi, I, 

2. a ring, a ferrule. — Mt. 
An^ont, prep, around, round, about. 
Ac aiunal UiauC gm enwf aber. 

Lli/~tlf^ Fardd: If.A. I. SSS (cf. Va). 

Amgam, -au, >m. [cam] a ferrule ; a metal 
ring around a thing. 
A ffon ag amtant a phig.— /). ah Ovilgm, ocix. B8. 
^iH^ntaa ioo am gym nod. — T^dur Alrd. 
Hae iddi ttmaam a rAug gadam- 

/ruin Lltgn : Caniadau, U. 
Amgaxnu, v. to put on a ferrule. 
Amgaru, r. to love much; to fondle; to dote 

Nyd yr cbwetyl ajogea yt amfTyrwyf 
Namynoia^ninygerytwyf.— IjmWriiiP.' If .A. i. SIT. 

Amgau, V. to shut or close around ; to compass 
about with a fence or hedge ; to hem in on 
every side; to inclose, to enwrap. 
Amgau llythyr, to inclose a letter. 

Ainga'uad,-au,*ni.acloBing or shutting around; 
a covering on all sides ; an inclosing or en- 
veloping. 

Amganad, a. inclosing or enveloping on all 

Amgauedig, a. indosed on all sides; inclosed, 

enwrapped. 
Amged, -ion, af. a general boon or benefit. 
Dyrrwledic eilic y wyled omyti— Commfys ; M.A. L 4a8. 

Amgeiniad, iaid, mi. [atngan] a minstrel. 

Dygwiao amg«nwiao anaffeingad. — Cgnddilv: V.A. L HI. 



„Ct>(.ii^lc 



Am^upWi «. ambitiouB; aspiring. 

ffa ertoii im o n]on falch arng'-iigar, 

W. 0. Pi^kt: CO. ^i. SO. 
Am^isg&rwcli, (m. ambitiougness. 
Amgeiaio, i'. to seek in all directiona; to seek 
diligGntl J ; to require. 

riftriin .' If .A, L S3 (of. A.B, iJ. an). 

Drn - . . ■ fimgeiaiii gBiiad g^v 
affrHUra. so uhttIhI diiioDhid. 

IK. O. I^)\r: CO. Till. ISfi. 

An^el, a. concealed or biddeo on all sides; 

secret. — 0. V. 



Amgeledd, -au. em. [ooloddP] 1. 
citude, anxiety. 
Heb y Menw tnab TeitKw^ed. lunit att 
inynrt )Tio. mi «ymf Irtritli ar y ki h jt ni 

Crnddyloii c&e tli y rhiw 
■^— ■■—■-' nyddiwlLlo., 






elugywed 



Tny daw \M. a yil.^wl lJo.«yTwr.beiMlw 
Av^tttiiiik am yowd h&loi.— Ainrei. (U.A. iii. 147.) 

2. fostering care and attention; a cherishing 






ti^atmeat ; solace, oomfort ; 
protection; patronage. 

Safed hi o flAen y brfltlD. > bydded yn RimeathuT nm- 

Ni a DTchymmynwn ith dadol amyitMd y rhai oU a gyt- 

DywedaflOQt - . - mai j newyn a'i gyrodd alLan o^u inrlad, 
ar OS byddai wiw gan y tvpoin i*w cymmeryd dan ei irn- 
fffifdd, nid oedd ^nddynt hiry ond (fadod OeodJUl I>duw 
wn dano.— I-iWo. Amn.. B.l-.O. i. 1 (17). 

Bu /arw y plmtyn o eiiieii amgeledd, the child 

died from want of fostering. 
Bod Hun amgeledd tin, to be under a person's 
care or patronage. 
Amgeleddgar, a, disposed to cherishing, suc- 
couring, or protecting ; fostering, choriahing, 
protecting; patronizing; favourable. 
Credwch ^ ddifiir. y^cy 

Amgeleddiad, -au, im. a cberiahing or foster- 
ing; a taking care of ; protection; patronage. 
Amgeleddol, )a. cherishing, fostering; pro- 
Amgeleddua, jtocting; looking after; care- 
ful, anxious ; patronizing ; favourable. 
Ao eno et nnhy* et kanluiu Ctata ac Offa ac ea ^war- 
cbadH ea gittt amgtliddia. 

BnU Or. at Arthur: M.A. ii. «8S. 
y leaaoKbet. aa 
MafToi, ool. 889. 

Amgeleddu, v. to cherish, to foster ; to nourish ; 
to succour, to help ; to protect ; to patronize ; 
tot&kecareof; tolookafter; toattondto; to 
favour. 

A^rllanccaoedd deg lawn, ac oedd yn aiHf F^Aiff u J br?niii. 



Amgeleddin', wyr, ) iin. a chorisher or fa 
Amgeleddydd, -ion, ) terer; a protector; 
patron; a guardian ; an overlooker. 
T mae fte dtm amgtifddvi/r a UyvodiaetLwyr. 



Hyd jn hjn bu T Bhtjfflibiaid rn ama^irdJwf/r tlrion 1 ni. 
r*M. £...i...- D.P.O. L t (961. 
Bod yn amprlifdd^d ac yn addymrydd ttvirionedd. 

lot. Harrii: OTratll. SS8. 

An^elfy-ddodi, t>. [colfyddawd] to make or 
render according to art ; to reduce to art 



theg a^u kaiHif-tJgddodi *n fryflawn.— ^rW^fm, i. 6i. 

Amg«li^, a. solicitous ; dreumspect, discreet. 

Afallsn bcrm brm nydd lad 

Nid byohan dy Jwylh sydd tfnvytb aniad 

A mlunau wyl olnaorg „m,-t^wt lu- ' ■• 



Amgelwch, on. solicitude, 



■J,.r (B) : M.A. U. 301. 

ixe ; protection. 



Alaf lyv llooet amgrl<cdi.—C)ndiUlic: U.A. L 1X1. 

Amgell, a. baring many cells or cavities. 
Aiiig«Uiaid {ig. iad), t.pl. [am--|-cell] Circom- 
cellians. 



Amgan, adr. [C. ten, ken ; Br. itm] otherwise; 
on the contraiy; to tbe contrary; on the 
other hand ; different!}' ; alias ; better. 

A jlyweiati a gan Uiji 



ofyned >ti' 

Nid amgen, not otherwise; tbat is, that is to 

say ; namely ; to wit. 

A (predy y lad ef y kynhalawd y Trodyr J nwD *J a 
Powys eitnyr yr hynn a duRanei Ovein kyn no bynny gan 
Muvdud lub Bl»yn nrft amfffn Kefcinawn yr hwnn o«d 
eidav Madawc uab Ridit kyo no bynny- Ac enirei]#y 
vn»d jt yr y rei bynn n^t (rM^r.a Madawc ab Cadw^avn . . . 
BU Euum uab KadnBaim.— fl™i t Tjncgiofia*, 188. 

^7.^^7m.A. ILM. 
A ladho ef a vydh marw. jt^t aatgrn o anghau traffyvydli. 

Of amgen, if otherwise ; otherwise ; on tbe 
contrary ; in the other case ; else ; if not. 

A<] OS raa. nid o voithredoedd mvrach : » vb*^, nid 
ywBT^B ™ rns mwyacb. Ac oa o veltbndoBdd, nid yrs 
V. .... ,.,._. litl^ 



Ptd amgen, ) if (it ■were) otherwise ; if (it were) 
Pe ani^en, J not so ; hut if not ; otherwise. 

r o drigfauan : ap*<~.v", 

Nid anhavdd diniad pa on vymbwnal ei faoffl o tan s 
blaid, a pA^ orfljm, pa nil a hacodai tanydn hofflormvyn 
el ha^loni. — Ormoj/ Ovan, 190. 

Bim amgen, notbing else ; no better ; no otiier. 
ddeyr kymryd da i 
abo arybelu dgm an 
Nid ywcr boll lyfr ddim amfet, a^oo, na aothadiogfll- 
wyddan baerlinv yn abyn y Cymry. 

Vtw. AVi.».; D.P.O. L 1 (g, S]. 
Amgen na Oiag), 1 otherwise than ; other than; 
Amgen no (nag), j better than. 

Nid aiKf «■ na/ ugain miynsdd.— 1 Bam, Tii. 3. 



jM.v^.(,K»t;ie 






Idfrwrdd- 

druioiiicli.— rtm. Kuuiu.- D.F.O.ii. 1(304). 

tffd wKA FhTfedd yv df ^Ij-red 

OnU wyd nMin «n'th wdod 

Ki ddiCd di Oai u dy nuif«d. 

YmMiMan ArA,.r a OwfJueufar: U.A. 1. tTt. 

Nkidul ysdrrot ymTwn sHatr T den grfjndfxw. nyt aw- 
p^ lu BvTtK Lionel. — SI. Grral, |3. 



Kid ue* amatn no "t ddnll hoo u Ddonnrtli CHrfyrddln. 

I'ltamjrti, otherwise; differently. 
Ac ddjiu ykTmovmnt Itjt KTICfior 7 jrmdidui ara eu 

£/> a Ayr t/n amgtn, '1 he knows better ; he 
E/e a &yr amgea, j knows to tha oon- 

f Amgen, haviTig the force of the comparative, 
though positive in form, generally govems 
the isdical sound, and is often followed by 
no or ivig (no or nog) both aa adv. and adj. 
Amgen, -ion, a. better; different; other; va- 



t«n Tcdvl rn^ yndn* tfi 



A pb«r bronu a 

M TO giroeuthBi ja meUi no gwerthu'i 



Uvjrdyn 

k_ief(d 
Own ni adwaeiuT aingtn dynioD' 

/. a, Oririmftld : Oeir. W. 
Pethau antgcH, better things ; different things. 

M dlodhefilnt CbrM 

'r Ar)flwj3ii, 

&fr«jrt ytaaait coedrd a Uwynen kyflmwn d antgca ^anei^- 
vti aiuaeQeit a bwygtnDait. 

BrHt y firnliwdd.' M.A. li. 82. 



^wrdion ja a ^mighfd 4'r cnrafDheoan (t^yvarchenfl 
ATHill ; iMj o'r nwyfre yn d ardouniaat yn apghynffhyd li 

Oui^friaiaohonoyTairThaik^mdamhaUBideytiiaadnry 
ddlrheuion ereOl ac nmgm na^ a aiferaaoi efe erioed hyd 
hiddy*.— JCnriu Culla.' Diffynlad, i. 1. 

Titlisu waetlmeth yr astbiKt. 

Karw yw dy fatli. raavr yv dy f(wt; 

Hid an^M *yd. Bad jmgaiB, 

Dimad rwm, d&m wyd o 8aia- — Gnnwg Ouutn, 18Ct. 



■n/ar. 






Ditgwytiad afogert, a contrary ezpectatioti. 
1[ The conHtmction amgen ond or amgen onid 
(^»>ther but) is rare. 

Kynl a wyddom ddaifod i ral . . . ddyredyd . . . D»d 
jdoedd bh boll grefydd bwy ddim angen mid enbyll ddir- 
DkTK a diystyrwch ar bob dnviolaftb. 

Jforw Cufin: DWmiad, 1. i. 
Amffanoch, a. [cp. of am^en] better; different; 

Ond mufi eyflwr yn llawer amomadi yn y nef . 

Oraftdd »■»»-.- Tityr.i.9(M). 

Bbyfeddao h o law«T . . . ped fai tad y cdwyddan a gelyu 
pub ffwirioDedd, y cythraul. rr am boD yQ y divadd u yn 
ddiaymmwUi «e£ Dewidio o ben ^yfrwyidi^ ran obeicliia 
mllu a bono mewn modd at^tviiA na thnry dm'wedyd oel- 
irydd, onhry^'r gwJi.~Mor*i Cuffia : Dlffyotad, i. 1. 



locI, nig BalllT en onddio. 

Atngenach a fyddai genyf, I would prefer. 

Tybio wnawn i. fal hiulTn, mai ani-i-^arh n fgiUai i/n^cA 
ei gaol yn ar^raS^ig.—Gronaj/ Oiciiin^ l&H. 

Yn amgetuKh, otherwise ; better. 

Hwy a fwytasant y paac, y» amfntuk nag jr oedd yn 
yagrtfeilBdig-.— « Cron. III. IS. 

Amgeoach, adt: better; rather; otherwise. 

Anilwyd heb bithra te ny wdort di anamieh do hynnj : 
SI. Grill. \«' 

f Amgenach t (=amgenachna)is sometimes met 

A't neb a wnelo'n awtamach i hyn, aydd euog fjsregi- 
ledrad.— Jforu CsJIk ■• Diayniad, ii. H. 
Am^naath (f), -au, »/. difference; variety, di- 
versity. 

Ac D^T pethan hyn y tyf neilldaot anaavdd y UBflor, a'i 
an^oiarU o banfod a rbyw ar bob muur aiall. 

Amg«nair, eiriau, »in. a paraphrase, 
Ame^enalr, a, paraphrasticaL 

Denngliad anllair (nswld^ii, aiasmair).— Walun. 

Amgendrsig'l, o. heteroclitio; anomalous. — tC 
Eiiui amgtHdreigt, a heteroclitic noun, a betero- 
clite.— ir. 
Amgendreigliad, iaid, ant. a heterodite. 

Amgendreigtiaid, heteroclites. 
Amg^udyb, -iau, am-/, a parodox. — W. 
Amgendybus, a. parodoxical; heterodox. 
Amg«nedigaeth, -an, «/. variation; declension 
(in grammar) ; alteration. 



DnlJ aimll ar ailvywair j ay, poa osodir nir t^lfredij 
o'r blaen, a vwedi byny dielumv rhan arul o bono, n 
[yw anffenedigartM. — Henri ftrri: Egl. Ffr. ixxiii. 3. 

J- HAj/*; Orujn. 111*. 

Amganeiriad, -au, am. a paraphrasiug ; i\ 

paraphrase. 
Amgeneiriadol, a. paraphrastic. — (F. 
Ajngeneirio, V, to paraphrase. 

Bboi T^tyr traethavd neu'r cylTelyb mevn amgen einau 

Amgeneiriol, a. paraphrostical. 
Amgeneiri'wr, wyr, «nt. a paraphrast, 
Amgenh&d, hadau, ant. variation ; difference. 
Can y gvna hritbadli amyratiajt ansawdd^ ue o't nmii^.,~ 
Md hyny r cyfyd annwdd neilldnol a gnhaiirDdol ur 
goidddafod; ya ef traetbodyn. — Cu/riitath ji BeiMd^lo. 

Amgeniad, -au, «m. 1. variation; difference; 
distinction. 
A hyn, gyda dull anhebgor (d avdl, a w&n'r uuavdd 
Itngheu omo, bU ai-illduaidcb a*i Iwyr amyeniltd l-hag pob 
memrarall.— l7j«/W>iiicA n BHnId, 10&. 

2. pantUax (in astroncmy). 

Hawg (ydd i ohwi ddalt diben y chai hyn, yn pyatnl a'r 
Kolofn Dowydd ar nmg^itiad y lleuad, pan ddelom i ym- 
ddlcldan jng nghylch y Uenad a'r plasnlHu. 



,)glc 



A 110 EMU 

ir : to vary o 



alter; to 



Am^nu (c), 

diversify; to contrast ; lo cnange. 

Tm mbob mtwir iiitoa u 7 KThr'l«dd Ivfn. dylid gjm- 

Amgfnu ar, 1. to vary or differ from. 

Ni mawr voetb p« liw m f ytho. cjd ydd am^ia "d daer 
ai- liw pivn ; Uythynuu.-L's ifi>. aoe. 
^. to surpass, to excel ; to exceed. 

Bmilb da, oyflaim. a thnigarng,afwra1,a<^tJ-ddoe(hj 
■ TDTyn, a hyruwH ydoedd [MoT^an Hvynfawr] : tc mm pi 
fvyndcrr a'i hai^MoiiL, yn iv^'ftu nt bavb q^E gyfuedion, eTo 
a wnaelb gyfreithum a dedJf au I'jilawD a daioniu. 



II«!f.79). 

Amganwiag', -oedd, if. a variegated robe or 
dress ; a robe of distinction. 

^yy^wiuE amgt^wUc va^euij^.—'.^l/nddtiv ; H.A. i. 321, 

Amgerdded, a. to walk, to move about, to am- 
bulate. 
Amg^rddediOid, -au, rm. progressiou. 

TripbeUi a «ryi ar ol pob djn da rhinweddfawr : i^alr ac 
«nwiiaiddo ei hun; adaTH^r dclai'retifnldiana^rlleybii; 
^ >b |>o(b a drafodefl cf ar ymdawyn 



A HOOK 

AmglTmydd, -ion, am. a ctaaper or tendril (in 

botany). 

Edlyiuidd hi d *Dn7'riHirrf<li>> bTd )- mAr an hfd at TT^OD 
fl bytv^'vryll. — Ifr. T. Pritfot : tJ)-fr J Salman, Ixxx. U. 
AmglTwed, i>. to perceive; to apprehend; to 
become informed. 

ir lir- A frwir Uicblla uiA ac viat. a gwii Dnunarc A 
fub ritr jrf'ncdil qr a allceiat csM eu dobvndeb. Af ar 
hint fcuri?M-in uonMctuit cirbil or wlad hid « miir a*tiab#t 
t^c^'vr- Ar tnfifiii-'-t Dbatmt diinwl mrir RoTan flmdnth 
utimik phaTiiaeh [a wfT ■ irurpncijuuaDt «-«■»■ boo iare bftoo- 
luUeM'diKaluii. -Jirm (,>. <•» .4n,tvr(A|: U.A. ii. 2». 

II The reading may possibly be am glywed. 

The other texts have ' gwedy gwybot. 
Am^aif, gneiAan, am. a clipping or shearing 

around. 
Amgnaif, a. shorn or clipped all around. — 

a biting' on every side ; a 

Amgneiflad, -au, am. a shearing or clipping 

Amgueiflo, i'. to shear or clip aroond. 
Am^oad, -au.fni.abitangor gnawing around; 



■ IfTOllired.— Jfji. Arcl 
Amgerth, em. intensity, vehemence, violence. 
Amglawdd, gloddiau, 



irdit'.^h; drounivollation : entrenchment. 

Khuthtodd y Cadfridawg- Suchm ar nr^gloddi'iH > ^yn- 
longerUawJUnbeim.— irr-n Kumrr [18H), i. W. 

Mac [7 m6r^^ yn DeiUduol ^vnunvyiu^'igHT, nld yd uuiv 
bvy druwlwf [Ido I'D ponhladduedd (^ikhauaf pob ardal 
. . . oqd a«fyd tnry cm diog^lu rhag ' " " 



o corrode. 
n every side ; red-stained. 



gnawing; 
a surrounding trench Amgnoi, v. to bit« around; to gnaw <m every 
aide ; to gnaw ; " ' ' 

Amgoch, u. red o 

AmdrrdiioD berion bnant 
Atnfioih bTTi] a phntrrn a phant. 

('j,»,*rf-/B.- TSJ^ L SOT (of, KKl. 
Amgoed, a. surrounded with trees or woods; 
woody on all sidofl. Hence Henllan Amgoed, 
the name of a parish in Carmarthenshire. 



r railing pficed | *"8*?'*' -'^^^' 



/Vyrf^dd SyMoh, M.A. L » 






td angbliryfadwy. 

Aiaglawdd,a. circumvallatcd; eurrouuded with 
a trench. 

CinTumTHJlatoB . . . petb amfflmedd.-^Daivs, 8.T. 

Amgledr (ac;. -en, /.], -au. l.rl. onclosLng 

surrounding paling; palf" " """ ' 

around anything. 

. , , . , ,. Tn goeltt JT ammjMydd c^a 

Amgledrad, j -au, im. an empahng; a sur- Aaeda'rMm«7ttid>«iigairlaain.— 7vir™vui>.ta. 

Amgledriad, (rounding with paling; a railing, imgoediog, ) a. woody 
Angledrog, a. surrounded with pales or rails ; j Am^OAdog, ' ' 

empaled. 
Amgledm, t: to enclose with pales, rails, 



stakes ; to rail, to empale, to [nl< 
Amgloddiad, -au, im. a circmuvallating, an 

entrenching; entrenchment, circumvallation. 
Amgloddio, v. to aurronnd with a trench or 

ditch ; to entrench, to circumvallate. 
Amglud, u. carried about. 

Amgludiad, -au, em. a carrying or bearing 

about; druumvection. 
Amgludo, I', to carry about or around. 
Amglwm, glymau, em. a clasper. 

a clasping or twining 
2. (p/. -iaid)ach--- 
Amgl7mol, a. clasping or twining about 
Amglymu, v. to clasp about, to twine around. 



sides ; sor- 
-i -. , rounded with trees; abound- 

ing with woods ; silvan. 
Amg«fl«idio, V. to embrace; to cherish. 

Buei^t mor chwrnnyfih^^ar i^D hiailh ui, tg ydym ^^^Tmt^ 
*g awydd i nnrd/Inifiii ac i aoiByirred «o biMtli hwrntam. 
Dr. t. D. Mir; Oram. (Bhag. S.) 
Anigoleddu, v. [coledd]=iImjrrf<rfdu. 

Ond y brenln ynfyd. Gvithoyni dan pi onw, a'n ^mpo^ 
vModd. . . Amgolfdd'rdAynmjflnviitoaimttxiitst.nAA 
debygogsdeifnUiD.— rA». S»iai.- D.P.U. i.4 |1CM|. 
An^olo&iog, a. surrounded with colomns or 

pillars ; peript«ral. 
Amgolo&ea, -au, -i, */. a peristyle. 
Amgor, -an, em. [e6r] a surrounding or en- 
circling border; a border, bound, boundary, 
or limit ; precincts ; environs ; an ambit. 

KaUiFl Bine nmhalor kylch Prydein amfrr. 

Tali'^i.; A.B. iLaWfer. U-A. i.TS). 
OugDidd dor amoor amnimlff. 

SritsU Br^ffarA: M.A. ' •" 

a country or region. 



jM.V^.(,K)t;iL" 



Tiu nn Mkel totyuu Tyms n Kdon. ale > ddjdnral- 
odd kt FOr Ui1l1«. drwy nngonm Denpolis. 

J. IfUfioiu: Ond. Br*. (Man vll. 31). 
Am^orelwi, b. to dance about or around. 
A «D UB ryv fnnddwydlon liivfedd, Kea 
Dylwjtliwi tog o ^loJi f twrnnth ^Ima 
Yn tvmffnrtivn ^wiai muhludluu].— CaA/a/lvvA. 

Amgom, gym, *m. 1. a circling bom, 

Ac UD^teh J dilAwt 7 chlka ffofri 
As i»v)>n> o drn ■dam msll. 

Llnvietr* FarJd: H.A. i. MI, 

2. the oater or aarrounding part of a bom. 
Amgvrni, v. [oomi] to enwrap or envdop ; to 
snrTound, encirclo, or enoompass. 

Pe drmdva, Y tjiryllw?. nul hwrmoi, n'lii hawt- 
yormmt ; jnk bfddnl y dda jn oleoni yn fy uoffyloh. 

/fturi Pmi : Bgl. Ffc. IXXvUL 

AmgT&ff, a. ciTcamBpect ; deliberate ; acute. 
Amgrain, grdniau, «m. a wallowing on the 
ground ; a being proetrate ; a rolling about ; 
a ttuubling. Sometimes written amcmin and 
ajurain at angcraia. — Madog Dmygruig : M.A. 
i487. 
Amgre, a. forming on erery ride. 
Oni prydfiot yn Frydolii uugant 
.l>Vr«— biydobirdBTudbat.— <?r»M<IU; M.A. i. KM. 

i[ The text of this passage seems corrupt. 

Pagbe translates it : 'A. mind oppressed with 

the heaviness of grief;' but in the first ed. 

he reads 'ptrdedd' for 'pryder,' and in the 

2nd, 'pyd^ad.' 
Aingi«iiuad,-au,«Tn.awallowing; prostration. 
Amgroiaio, v. to wallow; to roll about; to 

toll backwards and forwards on the back (as 

horses do) ; to sprawL 

Cjwiaa bzuu yn angrfiniam, 
Caw«d yo ymglywed gwUw. 

Dafnid at amt^m, dEdX. SB. 

Amgrwin, m. | pi. amgr3'mion, a. outwardly 
AmgTOm, /. ) round ; rising in a dxciUar 
form ou Uic surface ; oonvex ; rounded. 

Bydd weitfalau yn eeuol. weithiaa yn amgrtcm ; welthlAD 
mdi ei Vtjga yng DBbyd, te wslUuiiD yn eatynedlr. 

Gurglitdydd, L 171. 



Luatynt; » bodyToohriin^rviw ycJiydiayn ddiavleit- 
le eglUAuhnA'riKhrgeilD!.— /Tijjjwj-ft Healaas.a.^, 

AmgTwn, m. \pl. amgrynion. a. globous, glo- 
Amgron, /. jbose; globular; spherical. 
Amgrymedd, -an, »m. convexity. 
Amgrymiad, -au, nn. a making convex; a be 



Amgryma^ i 






Amgryniad, -au, tm. [amgrwn] a makii 
globular; a becoming round or spherical. 



Ni fyddant yn 4«l&lig wrtli begynau y 
wydd fod apigryiwdd pAem Sadvni yn myi 
it'r duvyUydd.—l'iuTHiriA lltuiaKa. a. SB. 



o cause to tremble uround. 



Amgut, ] a ringlet, a curl o. 

Bhimg y rwnllt antaatiaH chwym, 

A dwy-aelinpRh i dry™. — />. it- fltr'''ji". J 



Amgudyn, -au, i 
curly lock. 



1. a ringlet or curl of hair, i 



Amgudd, -ion, tm. 1, general obscuration or 

oooultation ; envelopment. 

N id yw'r budd, pwy bynung ydoedd, nl Aneurln k1 snll, 
yn cniiaeryd amo i brDpbwydAW un ddiin yn y byd (md 
IL 9«mr yn amlvv yn yr Yagrylbyiau ; BSf, er mamt y 
durygOr I'r ii<v>w' ■ ddelu ar Qnat'ni«tietli, yr idgyfodu 

2. a hidden treasure ; a treasure ; a hoard. 

Aatgudd, tryior mddledig. — O.V, 
Am^dd, a. hidden or concealed on all rides; 

shrouded, enveloped. 
Ameuddio, v. to hide, conceal, or enwrap on 

tUl sides; to envelop, to enshroud; to board. 



secrets.— -P. 

' Sic TDcamiu anuu nob 
tilia; abam 4 rrr, charufl. — 



wcuiolcdd; 
f , diryfedd j9 bynj 



yaffofynuneieyir«dd.— Z. 
Hvynt A gawiAnt At BwUt, dy Arysnt, a'tb amguedd, put 
fnoit ttrw.—lelt Ood (Bcytlion, ii. 316). 

Amguaddfa, faoedd, fSydd, «/. a depository or 
repository of rarities ; a museiun. 

T mugweddillioD difywyd y Uyaaa byohiiiD byn irwedi 

Onid yr betb bynnag lydd bar; beth bynosg lydd 
hawddgv ; beth bynnoB sjiA vlodviw. yn »ynnimuig 
ynyr timgittdii/a arddenhofcT— JVj/^nfcHidii ffervfg, 31. 

I'r Amgaedd/a BTydeinig, the British Museum. 

Nid DBdd ymddlriedolwyT yr .^n^KRfiMi ifrylrf nflldd vedl 
meddw] un oymmad U?w na tbarv odnniw. 

Bnlw,: NIneldi, sn. 
Amgueddgell, -au, -oedd, >/. a cabinet of 
cariosities ; a museum. 

Caatell Aberhonddu a ddywedir ei ralurio a'i dynu 1 lawr 
gui Olirer- Cnuairel ; tdthr fe yuddenffyn oddl wrth y»- 
urifcnlav yn yr Amgu^ifdi/eU Frrtanaidd . . . i diwoLioo 
Aberbtmddia, yn ddi^un synvynol. ddinyiilTlo y pa«td1. 

Ijtuad yr On, I, BIS. 

Amgutio, V. [cut] to cover with a hut.— P. 
Amg^WTdd, -au, on. [cwydd] a tumble; a fall. 

Qnaird ami d nnu-njytfrf Duchwytn.— ifyu. ^«*. iii. UK. 
Amgwyn, em. tarragon {Artemitia liirragon, 

Artemieia dracuiirulu*). — H. Davies : Welsh 

Bot. 1&4. 
Amgyflead, -au. im. a sotting or placing 

around; circumpoaitioa. 
Amgyfrawd, «m. an attack or onset on every side. 

Gynl rybu amyyvrnuf guynt pian t™ mramir. 

Amgyff, -ion, «m. [cyfF] support on all rides. 
Amgyfitau, im. a pouring or flowing around, 

I>r«io OMtfit/rx. o dadi 11»d Uoitren Uat. 

T-lletli: A.B. ii. SH {KJ^. i, 73|. 

Amgyfflrfiw, | urn. agiCation or excitement on 
Amg^ffro, ) all rides; general agitation. 
Amgyffrawd, odau, tin. comprehenrion ; ap- 
prebenmon. 

'^Ihaynm y sydd mimi y r^vedydd 

Pwy amis/miud gwydd »ch« unmod dydd. 

.._,.._._ . « . . w (A.B. ii. IM). 

II (A.n. ii. IT41. 
Omml yuebynetiT eiasor Mediawd 
Mai UrienVid&n ai anig/ffratal.—afnlir.- M.A. 1. ISB. 
Mot msurdir nuii'rdoryf nmjjujTmKrf. 



,,glc 



Amgy&sd, -ion, em. [cyttreA] comprehenBioii ; 

apprehension; conception, notion ; a concept. 
Ir bis bkhui. i. anwiArri innaut bUieit ir e^uin biUoi ir 
hiiuic iait ppt^nufld panl gnoifruit nun. 

Ox/. Oioti. IT. tS IZnm, O.C. loeO). 
8Kf jiotA yttyltwl Duwr yn Uawr j t^uaA amgtffred 

A dyf mab (Voui mau 

Tri amfs/ffrtd deall : in 

AmgT&ed, v. 1. to : 



' diBjirjrnti. — Mtttir: H.A.i. 191- 
>9affr'l.—C)>uUl'lv,: Ujl. LM8. 
Kr; lle^ adidmiii. 

■uu, go, or roll round ; to 



ryafrhyt j'pwlft^h giBW. hyt ftivigyl beul.hrt; 

2. to contain ; to comprise or embrace ; to hold ; 
to include ; to take in. 

Ef tiveM J dioaa hwnnir yn tuwi u jn vhalutb. ac Ja 

Ti ■ uneddaint yo dy arffed 7 neb oi alUi'r netosdd d 
'•m.jsS'rd.-~ll.:fs-IJ D,l. llinM^Dt {11.) 

Tybiedyddwyf luigaUal'raU tydaatgf/ffrrd t^gynnwyi, 
dderbyn) y UyftHU a ysgriftnid. 

H'. .S^nlriiwr; IwD xxi. W. 

Vele, y nrtoedd, ft nftoeM J nefoedd, ul alluit dy an- 
ygffr*d. — 2 Cran. Tl. 18 (cf. 1 ^Ot/Q. Tlii. 27). 

A'r trydydd ti't diweddAf t,*t cyffredioolAf o'r rtiai hyoy 
[megyfl ya amju/ffred j ddau PT^} yw carud w y byd. 

Dr.JaiuDari't: Uyh y R(«. II, iii. 1. 

Hobiethrwydd ei deymgadAir M ly'n tmff^ffrfd oefoedd 
adaior.— r'^'r^' ^.^/u^riiYb.- JIao^h y FTydd, 110. 

Yn fn^nmauit 4 hod yr ymadrodd a K7[ui^'<>r 7°^ pi r 
tfatun yn ttix'jfffffM Hden&li^fLh, MAntuiddind, a pharbitd 
mewn mntcidOrwydd.— /'u^n hrth^ »''■■ FnK- 1- 13&- 

3. tocomprohend; toapprohend; tounderstand; 
to oouceive,— /oan i. fl; ii/jA. iii. 18. 

Oiiyntc, ypeaasU plmtynpi 11 



^ »1 (ri. 1K.I. 

Amgyfitediad, -au, «in. comprehension; ap- 

GWHJirmiiwtha bam oddi wrth niB^v/^Hi^if, o ble^jd yr 
ydym yn am^'vffrod llawer o f«li1y1nthiiia bi'b ffnriio bam 
a fFvleh en nijdweiMiun. DibrniL urn ar pmir^r^-tind nea 
dd'BlU-riielb o belli.— IT. Ju.,.j: Bun ■ UufBlyad. II. 
Ajngyfilrediff , if. comprehended ; apja^hendcd ; 
undoretood; specific. 

CyFoTildTjn rliyw nydd arfprrNlip idfwd ynudnivdd pan 
ddyr^fir y rbyw cenedlnw^. ^^ y K^^ eytfredinKwL. rynmil- 
iiidwy, yu lie y rhilb. oeu y i^iur dudwI iimpgjfef*ti<j. 

Amgyf&edol, a. ri^iiiting to comprehciisioti ; 
comprehending; comprehensive; apprehen- 
sive ; ideal ; perceptive, 

Amg7fCred}>'dd,-ion,fm, one who comprehends. 

Kania ffcnqgiim MuRT [•il. muBf 1 a lataot Me^hit 
nrudu»sui3^>»..|ijr-,v,;iil"/, nisuin>iitt« dill 

cm nc ''^J„,1^^y!^.u,A,,3i [p,.^B.ji_50). 
IXii-niArtli 'at. Domi^h] Jrwynrhydd banyllydd 

i^y ifTwidir ar Witior Tynydd. 

<iwidd««.- M.A. i. las IcT. A.B, ii. M). 

Amgyffroad, -au, >m. agitation all round; 

great agitation or disturl^ce. 
AmgyAoavl, ) a. agitating all around or on 
AmsTffrOua, ) every side; verf agitating. 
Amgyfflrwn, sm. agitation on all Hides; great 
agitotion or trombliog. 
Ny Ufanfl Aeith relth ryxisfini. 
Ny dyly keleoic ny wyppi hwn. 
YKTinen Biydein \>TjAti btjffira 
Tn yl uraa tonoeu ra lij-n^nffmrn {al. haBWyllryn]. 
Pereit byt pell y gell atroidwn. 

Tali,«n: A,B. U. 1« (cf, U.A. i. 68). 
^ The rhpne shows that amgyffrwn, not am' 
ifi/ffTua, which Pughe adopts, is the coTreot 



AVOTLCHAIIID 

Amgyfltyuiad, -au, «ni. agitaticm on all sides; 

a trembling around. 
AjcagyfStyuol, a, agitating on all aidea. 
Amg yffl r y nu, v. to agitata on all sidea; to be- 
come agitated around. — F, 
Amgylch, -ocdd, -au, -ion, »m. [cylch : Ir. 
tmcAiVn 1 . a circuit, a oompass ; enTironment ; 
that which surrounds or encompasses ; a bor- 
der; circumference. 

Kid oedd hull amg^UA j idnUt, ynf ngolwg SenecK, and 
inymryii.-t;'. MV"-' Y«yi, i, S iil). 
Amgyhhoedil, "i environs; oonflnes, borders; 
AmgyUkau, ! surroundings; external or at- 
AmyijlchUm, ) tending circumstanoea. 

Efe a ddiBWyddudd yr offeiiioid a cwodaaai breniiuedd 
Tndah i ame Edarlbu yn yr ncliclfrydd. yn nlnABOedd ludah, 
ac yD amgffktivfdd lenunlffD,— X Brea. xxui, fi. 

Arwydd o pref ydd gadara, ac aid pall ayuwyr dnvailb, I 
WT wecii Iddu iMud a aicrbau H^'lwcdd ei ddylolnryddau, yw 
bod yn ddibriaiacli o^r pyFinodion t,'t<img^diioii. 



iw amgea ac antgiilrlu 



■"■ ■■ -■ ILA.LMS. 

JmgjffrA^mi,! monwdd mawnon, a'n cymmlawdd. 



Amgylckion gtiriau, periphrastic expressions, 
circumlocution. 

Ac ar heuny GwrLein a dyrawt val bya. ny reit eb Ff 

2. a cireumstance, case, or incident. 

A Ihithaa a allEt eu harfem all yn ddlragnr, yn ddlnu- 
f edig, ac yn ddiberygl ii'a bod yn fagL i ti. na tiiriry ormod 
rhwp^, na gormad manyldra, na ehwaith trwy annod 
petTUF*der ac ofn arforu dim bonynt ond yn y latb nvt- 
gbirjiu,^ na bo pofiibl foJ dim amryluaedd, 

flii HV"".- Bb. B. 8, U, S (Ml. 

Amgylcli, prep, about, around ; all round ; 
about or near (circidr), 
AmagtrX Kyminawc kymynei Sanaa. 

t>JJ-/a..- M.A.l.S»(K.!ffl1. 
UarrhagfU.1h awnacUi eT yn vedylgar }-ny daeth y lynn 
ynyalnmjjW pryt gosperordyd.— M, lirral, |iis, 
Ymchvelawd y bnnbin 7 Loe^yr angsUfi y Snl^wyn. 

Brut B Tiwyw*'™. »«8. 
A gvedy colli trngyhh teir mil oe rwyr yn diut aflaven 
yd ymcboelsaflant y givlat.— J^rur j/ Tyvstnoyion, 100. 

A mgylrh ogyhh, round about ; all around ; on 

all sides ; m every direction. 

O niBir.v'f ( ofi/lrh eiginn 

YmbrtaaUtywmDnaiibon.— Z>eK> HV,* Blod. Aif.M. 
a. with the prep. 0. 
amgylch, around, about, round about; on all 

Chwi a amgylcbircli y ddinas . . . gan fyned awt^i/kk y 

Aatgylchitch Bloo, so vwcib f'i kam-i,:.-!! hi, 

Aiha. ilrili. It. 

(. with the piep. oddi, 
Oddi amgylch, around, about, round about ; on 

every side. 
Oddi amgyich y ddinat, around the dty, about 

the city. 

(a, b). Also used adverbially. 

AmlhA fy nuwredd, ac a*Di oynrl /y^i an&vteA. 

Ai'M. lazl. «0. 
Myned o amgylch, to go about or around. 
^'Amgylch being a noun governs the radical 

AmgylclLaidd, a. tending to encompass or dc- 
cumscribe; circuitous; circnmamlnent. 



jM.V^.(,K)t;iL" 



Am^ylchAu, v.^zAmgylchu, Antfft/lchgnu. 
Bf deshfeuoit atigfUUm gun newiwr riuwioD. 

W. O. Ptglu: C.O. iT. lOM. 

Amgylcbdoriad, -au, *m. drcumdsioii. 

OlUliuws Ddnv, yr bm a vniieUiast ill -wjntfieiig 
Phbdderbyu coiwaaiiAd [* aingfUJi4wi^\ a bod ynufudd 
fr ddeddf er mvyn dyn^ 

tl. e. Cufrrfi- 1687 (Dydd r " " 

Amgylched, -au, »iit.=^Amgykhedd. 



Ton amgyhhtdig, a circuiiiflex accent. 
Amirylchedigaeth, -au, </. the act of enoom- 

possmg or suiToiuidhig ; encompassment ; 

circuiQScriptioQ. 
Amgylchedd, 1 -an, am. circumference ; a cir- 
Amgylched, ) cle ; a circuit ; girt. 

Mermriua TrisnegiatuA. dyvedodd mu peth ujftvi'wu 
Dad ellid ei omgyffnid oedd Du4, cenolbwynr jr hwu aedd 
ym mhob Tniin , a'i avt^gUhrdd jti uq lie, . . Gmi byoy 
crlch TV Duw, JTD ol y riiAi gyiit; eiUiTpylota faebamf^A:^ 

Owelid unbell ddarwen gangeiuirL ft chyigodawl yn 
Uedu (d tudenydd H'u dail nryiddleidaD Ima oin^srieviu 
mavT. — Cawdaf: Headwy Cymrei^, IfiS. 

Amgylchiiid, -au, sn>. 1. a smTounding or eu- 
compasaiiig ; circumBcription ; a circuit. 
O eithif T nrfpBdd t mae ei (ynediad of allan, a'i im. 
fgirhiaii byd eu beithnfoedd hwynt, — Haint. xix. fl. 

CKiolbwynt tt bim sydd bob flordd, a*i amgiftehiad yn 
bcb rhyw ]b. — Elis Levit : DTckeliui, :fO. 
2. a circumstance ; event ; incident ; a case ; a 
condition ; a positiou. 
Amgylchiadau, circumBtaiices. 

amffslfhiodau h nlluit d ducddu 1 ntivid ai 



hddwl 



Mtwn amgylrhiailau da, in good circi 
^iJrjrrdm^/cAtfKf, on the occasion; ii 
Id pawb wedi rt 



the CI 



^ rbyfedd, rhyfedd, 

ddyhuB i wnthredn m , „ 

Ctiwrda/: Headvy Cymrdp. 100. 

AmgjrlcliiEKlol,a. 1. circumferential; surround- 
ing : circumambient ; round-about. 

Kid 0«» BnAddynt ud hjtryAvtit mewn hwammuetb, m 
brudd bytb yr yniireltuit b'u tin>odd amggtchi'idol. 

'1, circumfituitial. 

Tu»tiolaeth amgt/lchiadol, circumstantial evi- 

Amgj/lchiadolum, ) dnsumstantiab ; incidentals; 
Amgylchidion, j non-essentials. 
'A. occasional ; happening according to circum- 

Trteont befyd fo amgflrlnadijt jn y Uyt yn Aber, ger 
ll««TnetbLatui.— UtgaUurlfrrXain.- oinith, 1. S. 

Amtrylchiadn, v, to surround, to enoompasB; 

to circumscribe. 
Amg^lchiaith, ieithoedd, tf. drcumlocution, 

a periphrasis. 
AanMiailli a fydd. psa unlygir nn gair k llawer, a 

hyny a haiddu, noztiAU, neu ««tyn yr yioadrodd. 

ScUrl Diwiit: leith. Cymr. 108. 
Amgylchol, a. lurrounding ; encompassing, 

environing ; circumambieut ; circumstantiaJ. 
Amgylcholdeb, lam. drcumambiencj; cdr- 
Amgjrlcbolrwjrdd, ) cumatantiality ; environ- 



jugflchredu, v. to droumsoiibe ; to snr- 

r ttawdgylch «nr (Tiiiiiwni yn ei law, 

ged Ini«iryddavl Dow a buoldid 

1 •itnguUhri'du y bydyHBwd hwn. 

»-. o. Pagiu : C.O. Til. an. 
Amgylchu, v. 1. to surronnd, to enoompau, 
to environ; to go about or around; to cir- 
cumscribe. 

Hwy a aeUunt o fynydd Hor,^ ar byd ffordd y tS&t Oooh, 
i ams^Iihu tir Edom. — Wnm, m. 4. 

2. to beset, to besiege ; to block up. 

Bus twU r ^lofawy pan atngs^htr brwydyr 
Nyd braoawc uglwyt yn yd vneler. 

AmgTlchwedl, -au, tf. [amgylch-^-chwedl] a 
periphrasis, circumlocutioii. 



Amgylchyn, -au, tm. a circmoferentor. — P. 

AmgylchyiLiad, -au, «tn. a surrounding, en- 
vironing, or compassing; environment. 

Amgrlchyniadol, a. surrounding; circum- 
stantial. 

Amgylcbynol [y), a. surrounding, environing, 
encircling, oDOompassing; beset^g. 

Amg7lchytioldeb, ) nn. encompassment ; cir- 

Amyylchynolder, j cumambiauce ; the state 
of being surrounded. 

Aiogjrlchynu (jr], v. to environ, surround, or 
encompass ; to circumscribe ; to besiege ; to 
go around. 

Harallt HariTHfiTT tAr^net a ^erda«ci C7n no bynny a dir- 
fawT lu gaalbaw u ydd amasMaitifa faoU Iwerddon, 

B-cSdd Ur. ab Cl/ian: U.A. U. MS. 



e circumlocQ- 



Amgylchyaa ymadroddioi 

Nyt reit m am^^fc^^u f/uwtroayon Da t^whoroQ gi>rwiie. 

Amgylclijiwr, wyr. 1 im. one who surrounds 
AmgylcliTiiydd, -ion, j or encompasses ; ho 

who cirvumscribes. 
Amgynnig, a. inviting ? 

Qfngordd dor amgor tnKnanis [am jynnie], 

Sriiflt Brj/^icn/l: M.A.i.S38. 

Amgjriuured, v. to frequent about; to resort 
habituallj. 

Amgynniirair, v. to flock around ; to hover or 
flutter about ; to haunt ; to resort ; to fre- 
quent. 

ArngTiuiiweiriad, -au, «rn. a hovering about; 
a resorting; a frequenting. 

ArngTnniweiriwr, wyr, nii. one who hovers 
about ; a frequenter. 

AmgyimuU, c . to collect together ; to gather 
on all sides. 



Amgynnull, -ion, «m. a collection or gathering. 

Amryw aflachna bmydiivl glofydoodd a fagmt aia^im- 
nttll amffylch calon dyn yn wawfa a mogiant. 

MrMjsa, M,d4fai, U, JIB. 



oU sidos 



AUOYNHULLIAD 1 

lOlliAd, -B.U, tm. a collection from all 
a gwenl ooUection. 
lyrddau, am. a makiiie a tumult on 
sidos: a BUTTounding tumult. — F. 



ilawll rynddjilali t'ra erwim 






% The word has variants, and tho passagR ii 
which it occurs is probably corrupt. C( 
A.B.± 29H. 



AmgTrch, -au, -ocdd, mn. i 
a ring; a round. 
Y prophirjd breaiDol, yn » 



E^*.' 



■ m dj|bL 



dechj«u r ma 
Lfl ^ ymbyfrrd 
■ch o ddi/yrwdi. 



.dsft 



n T dry^Diu. aydd yu 

Q wledd'i'wl^i ddi- 
i ddry^oni. Djaa eu 



yinlaiteojfclro jm urdded 
«ieUiia, 1B7, 1S8 (ct. IBih). 
Amgyred, a. running about together. — P. 
H Pughe calls it \ prep. ; but hie definition 
is that of an adjective or participle. Robert 
Vaughan (Lhwyd, Arch. Brit, 'iVi), to whom 
Pughe soems to be indebted for it, renders it 
' with.' 1 know of no example of its occur- 

Amgyred, v. to run about F or perhapa^^im- 
garu (q.v.) in the subjoined extract. 

Nyd TT chwetyl imgraytnMyyirj)/ 

Amgyrfod, o. curveting; prancing. — F. 

Athcurnitddiitdlorthod yth lys 

Alli br?ii)Wr 7D djTawT dniod. 

hfwarck nh Ll-netIgH : U.K. I. IM. 

Amgyrliaedd, -au, mi. extent; range; com- 
pass; extension; compruhensioiu 

Drwy'r hyn y in&« ef o umfaprfynodig arngsrhuitd rn 
Umwi y nefirodd a'r dduor, mc vd cynnwyB pob ll^H>dd 
heb>-8p«ld. ---■ ■■- ■ -- - - . .^■ 



AmgTTlLaedd, 



'r dduBr, mc ya cynnwyB pob lit 



o ext«Dd on all sides o 



AmgTrhaeddu, |in eveiy direction, ^ .=,- 

Amgyrhaeddyd, ) tend, to expand, to reach. 

Amgyrhaeddiad, -au, em. eitonsion on all 
sides ; extension ; expansion. 

Amgyrhoeddol, a. extending on all sides ; ex- 
pansive ; extensive. " ^ 



li^ Marst-ug; Salmau. i. Ixxni. 1. 

Amgywain, a. to bear or carry about or around. 
Amgyweiniad, -au, $m. a carrying about. 
Amgywreinio, v. to elaborate ; to improve. 

Y nuiD hefyd yn ullnedig iawn i unb^U brydydd ddiwya- 
tkv, ^wclliu, iwu dmjuKrrWxuik ^wmith prydydd anil a fa 
o'l Bixcii, Deu UD cyfoed o^ et. 

loh Ifire-iKf (LLuiorer M«. *0). 
Amlifid (m. -hadon. /., -hedyn, m.), -au, s.rf. 
[hod ; cf. anuul^ 1 . various soods mixed to- 
gether; mixed seeds. 



Cysteirlii ain pob amitad Ul. uut) 

Pan vryniftiit OMwyr 1 Jfad 

Mi aid Bv aoav ni'm isd. /.'jk^itJI II 



Ahherawiivr 



IJwytyd y ffvaryd ae hyd h had 

Llwytjfd giirtr i ihir jn y Uinrlad 

1 Jwytfd girlel > med n meuet [oJ. mcDet] mid 

Llwyttd pob unhyd % f^kob sKud yibdl 

Llwytid ym uoli uUwyr nBirthyKd. 

Lt§wtlyt Fanid: M.A-i. Ml. 

I. a numerous or various offspring; seed, off- 
spring, progeny, 

Vg kyvryased • Llowr lluyd dvAdf. 

Uorckaa ila-idinc: A.B. U. IW («.A. i. BS}. 
HmTit vrdm. &ut;^ Kyrridyen. Ogyrrwi aajiad. 



Kyd uolyiuit (rwr rh 



"'"e;^ 



.w Cadnllmn 



Dt fronndHymd 



iJ,». n» Ul^lrn : UJi. L KB. 



every side, — D. 
Amhafklf □■ parallel; similar; like; just ai 

DienhTl y bob lUwr lL.o<ret 

Yd an'Trfa ^yTryJunwy 

Ac >-d AA Twrcb ym MArcbowy [4J. BCuduvyl 

Vd ut Trydonwy ya Trea 
Ac yd Aft Upirv yn Alwoi. 

ZfjicarcA An- A.B. 11. welM.A. I. IJ 



:£:; 






Amberawdr, odron, odrau, 1 

(from in and jtaro=;W. peri) ; 
aiipaiaer, itiipiiluzrl an emperor. 

Ac ympenied U«wr yr jmBnoll ydwd yt amimird^r 
Arthur ya clited. . . A vhyKU aoruc yr am/i^mit^^. 



Uwyv ydoed yr anthfravdrr Arthur 
M^^ryB pum eyrcha amitfuiu^i/r or dhj 
KamAt vyf y Gani awiMrntKd^. 



yUyi* 



ac yn ymdRjiffi* yn ffuryf 



y bwynt gwrthiadcdyc y Aiim 'ivj 



el iTlMTv.hanr. Jij 

ifraipdl/r yr . 
Gureakyn Buvcyri ei 

Hwy a wsBflthuit a 
■ llytn: 

ly-jTiuK „ , , 

cyroUeilbkm.— Jfflruj Vijiffin: Diffyniad, i. 

Ac 71U y tyngtuwd^l yr amhirawdtir u leddit y nuilj y 
dydd uwiuiw.-7>»"Aio<. J!hnf.iin, ts. 
^mAtrmMin mnTii. ) imperial stones; the must 
AmhfTwlnm J'uii, . j vafuableofprcciousstonus; 
the most preciouj of jewels. 

ynhymul euirvnllt. uueiD nuwr- 
. Tndunt. mdi^in a gaa pob eiJweiq 



^■^IT. 



It lyfn., 



vPTthiawD Uyrycbe., 



Ar sdhvynyab a oedh yn cyTelBtcdh cadflir «dhwynd?c u 
aagwm BliphiLiil diagleirlnUir mnheilrwydh yii rliwyiu.ilic 
o bob muD o wlwion Ufneu njudf^uctlmur yn ^-flcwuioa 
o bob amJtcrolrion vam ^erthOAWruKBon. 

Amherawdwr, wyr, tm. an emperor: the same 
aa amherawiir ; now the commoner but a much 
later form, all forms in -awdwr being late oa 
compared with those in -awdr (=-awdyr). 
Tr- ytlyd yn cmel yn y dyddiau hyn, yo llAw^r u fanuu, 
fnniinuvad ac ^nA'^im/u-^rr yn ciatfdd nr rn btiiirfddlfliedd 



jM.V^.(,K)t;iL" 



AuHBbODBAETn 



AmLerodrfietli, -au, «/. 1. an empire; the do- 
miuiouB of an emperor. 

H»irprd«hrb rt cwlrl iigBi»i<i om i»i*#™rfni«*. u-llu 
hvunuiic ivdaf J chirytheu janflgyn y ryueir ymyiiDoch. 

Amhemdrnttk Ehufain, the Koman empire. 

Ae vab ifwedy ynl^u gwed; rul UawirT o canded ac ds- 
UdiuL amiur'tdratiA /tu/tin awnaethpiryt yn unbetKwdwp'. 

A djmrswt dyvot o kent-lyl e Brydefuyait < tryflyd brPJin 
Anl Ur. ai ArlJur: lf.A. U. 33ft (cf. 8S8). 

2. empire, dominion, power. 



3. the reign or goremment of an eimperor. 

Yn 7 b^inlli^eil Bwyddyn ynAcmdrcicM Tiberina 

Amlierodniidd, a. like an emperor ; imperial ; 

imperioQs. — W. 
Amlierodrawl, a. imperial. 

T Semiid AmhfTodrawl, Imperial Parliament. 
Amherodreiddrwydd, mt. imperiousneM. — IF. 
Amherodr«B, -au, »/. [from wrnhfrawdr : L. 

inijtrratrix ; Br. imjKdafrei] an empress. 



Amhfndrra Rua«ip Innpych ?weU. . . Dewia awlwydt 
gytmyl jm 



■grffy y sennym ni. ae 4. _. . „ . __ 

anArrcHfn'« yn fiuueln. ae dyuot yr tunbCTwdyr 
gytmyl jnwreie idaw,— JfofrijioiriDii, iii. 870. 

T viwydyn rae wyneb y doetb yr omVrodrM j loe^ji, 
BnU jr TjffyMogion, 103. 

Ooryn a oruc yr amhendret, a ddaroedd dihenyddyaw y 
mab.— J>o'UlK<i ftA./oin. 1 14. 

f ^mAmiwiir' and dariTatiTeB are also apelt 
ymh; and Bomettmes emh- ; but oirA- is the 
usual form in the 14th and Ififh centuries. 
I'mildi/beTawdT, mentioned by Pushe (bnt 
not inserted in its alphabetical order), b.t. 
'Ymherawdr', if it occura, seems to be formed 
from the arohaic L. induperalor, or in imita- 
tion of it. 
Amliilio, V. to bringfortb abundantly; t«teem. 

T ddalsr oraddhU, 
A buan yn Mori ffrnthlawn srolii 
At dymp awiiiiiai hi fyviolion lb. 



post or frame. 
*'"*■''■ I -ion, a. long on everj' side ; stretching 
around. 

E* oul 7 bed » yi hlT 
Im lluro tlniu amhir 
BetHdnn ap Run rwyv iwir. 



H.A. I.aO(A.B. ll.SOI. 

all around ; to envelop. 



Amhnddo, v. 
to ahroua. 

YstyHa y serofydd hoiui4ld favn fprff yr haul fel wedi «i 
oaAiuUDnD mvyaf odd! WTtbym m, aachoH yTaWTT^Ich 
golen ddu^lAer bvn. — Llfvad gr Ots, ii. 40. 

Amtawedd (i2), v. [cf . ymkietdd, the more usual 
form] t« entreat, solicit, beseeoh, beg, or 

Ambwedd (tc), »m. entreaty ; supplioation. 

Amlrwylio, v. to saU around, to ciroumnaTigate. 

Amiin, -au, ■/. [iaa] a sensation of an impulse 
pervading from all sides. — P. Known to me 
only as a modification of Amitni, the French 
town of that name (£. 0. Cothi, tv. zix. 25). 



Amig', im, greediness. Inserted and thus ex- 
pMned by Lhwyd in the list of 'Welsh Words 
omitted in Dr. Davies's I>ictionary' {Arc/i. 
Brit. 213), whence it was transferrea to later 
dictionones ; but it is probably a proper 
name, being that of one of the youthful 
heroes of the romance of Aml^ and Amig 
(' Cydymdoithiaa Amlyn ac Anug'), to which 
alluaionB occur in the poets ; t.g. : 

Amli/t ibag dig, 

i. a. UnAi, II. Til. 4S (cf. IT. ij. e|. 

Hylym art yngiyd hi hwyl Anig. 






Lmia, -iau, if. [E. amice, amii, amyae, amea. 
amys, amiiu, amid, amit : from L. amictiiel 
an amice, thJe clerical vestment bo called. 
Lkini Ilwi Sion yw'D dawn Bain' Denis I'thddysc, 

A.-Qiiriigo laewjt amU.—Tmliir Alrd. i'T Aimi fiu'a. 
Xi chodai ndd umih dnry rent 
N« »el amit Bu* Clanent.— Lno^ Hon. 
Dagwrymiwydeignianu.— Tsdai- Jkd.' O.B.C.S48. 
Lml, a. [tomyl, oinhyl: L. amplai] 1. many; 



Ae afii|rl iawn oed y polyon yny oae a Oirwydair. 

jr«w»oiri™, u. »4. 

Afl ygyt sbyny amiaf kcnneiiioed or gvenyD opUUi 
yhlodeoood yn kynnullaw md. Ac y^ ahyny ginir- 
gloden itm)il fdaa ■•ryrolyon Tynyded. 

Pobl fswr, u ml, ac ucbel, fel yi Anadaid,— i)m. il. 10. 
Amla/ ei pwyi, amla/ it jtgab.—Iharti. IK.A. iU. IJft). 

Cynamlfd, as many; as numerous; as plentiful. 
AtoI ni/er, a great number, 
Qmilob ynym awjrl y niusr. 

lygigild B/dUTi: H.A. L SSI. 
Tn ami, numerously, in great numbers. 
Ami tm, many a one, — Qnmtoy Owain, 47, 

2. frequent ; often occurring. 

Yn ami, frequently, often ; numeroualy. 
^n am/a/, most frequenUy; for the most part ; 
mostly. 

3. ample; large, great; plentiful, abundant, 
copious. 

Hwyrtrydlg i ddl^, ac suit o djugaf^d a gwirionedd. 

Dy wniv A v«ffl nuil ami winllan 
Tn yitlyHU dy dt fal pnn perllau. 

Dn/idd Ddt HiroM-e: Jt.A.i. Bin. 

Ami- (in composition), many-, moni-, multi-, 

mult-, poly-. 
Amlad, a. [Uad ?] benevolent ? 

Owyi am Ibwt gwfl avilad 
Af yn dytrebytrotyad.— t.>>ifd^u.- U.A. L 314. 

Amladd, -au, im.^Ymiadd. 

Amlaea, -ion, a. [am--(-llaes] trailing or loos(> 



all around ; long on every Bide. 
j4ii^u|r'.dimuHj.— O'/.OliHJ. 11.88 lEeoH.O.C.iaM). 
AmStw eu pdaKa pwy oi befelia 
A iA«iUh djfvynet obep etiam.—Taliain .- H-A. i. 76. 

Amlaetb, -au, «m. [am-'t-Uaeth] mixed milk. 
—P. 

Ainla«thai, tm. milkwort (Pott/gaia) : also 
called tladhlyi, llytiau y llaeth, and llytiiiu 
Criet.—H. Daviet: Welsh Bot. 68, 1S4. 

Amlafti, -au, tm. the scutcheon of a look. 

Amlair, n. verbose, wordy. 

Amlalluog, a. multipotent. — W. 



nanzedbvGoOt^IC 



Ahlan 



Amlau, a. 1. of aundr? 

cymiy K So^wioD pyff rtrddyn 

Y dntia [al. CumUu] yindrculAir u rmwrtliTTii- 

Hols^dar.: Ji.A.l.lN. 

'2. clean, bcautitui, or pure &U around. 

0« BwinK nm;n« »m diiai. 

Ni fu hwD ■ fyiui bi.-Simtcnl fsthan. 

Amlaw, -iaa, «/. a glove. 

Amiaw ddur, a gauntlet. 

Amlaw, Ijw^. bcsid**; over and above; in 
Am law, j addition to ; distinct from. 

Pi'llr 7 cr["V(hu(riun auDTaUaw^. a'r swrddo^aa drwg, 
a dreEj4^iuii y rfa&l mnl jfwirion, np ddwyu pu bj^chun, ac 
eu da brdaT], dm^air liynr aroddaL Duv iddrati ymbortli 

Scl ucd meint y nifcr Kir mil h«b amkiii- dynynn. 

Uc^ys y gaJlo^r ffwr boiWddiff prinfdcdi^, an myilf wbI^ 
pafaiut a pha liiih'-'.'^rwydd d avdahaid arddercboif, yi- 
prifm.'diB u hen ft iiirwn, y sydd Rvnych chwi heb wybod 
iddo ef, hi'b lav ak timiaic J TUi eydd mewn aml^d mawr 
yn dd%un humuid ym mbab nuJi yti^ N)f hyuun. 

!)r. 1, l>. «*)(., Cyngboi i Foirtd Cymnt. 
Ajnlawdd, a. Burroundod with praise.— -P. 
AjniavKld Whdig, the name of a Britieh Prince : 
aee MaUnagion, ii. lOT ; Bnt Or, ab Arthur 
(B): M.A. ii. 289. 
Amlblaid, (1. many-aided. 

Dmd ddumawd mael ddignaod nuwl ddogmdd 
Drafn *int~btaid mav^^naid m ara n iiodd. 

Da/tidf Coed: M.A. i. 407. 

Amlbletdisetli, -au, «/. multiplicity of parties, 
faotiona, or aecta. 
Dubjnlais ddlokbgarwch nn o*r gv^ 



Amlbriod, a. polygamous ; polyandrio. 
Amlbriod, »e. a polygamist. 
Amlbriodas, -au, a/, polygamy. 
Amlbriodol, a. polygamous; polyandrio; poly- 
gamian. 

}> amlbriodol, Polygamia (in botany). 
AmlbriodWT, wyr, »m. a polygsmist. 

T Dae y Tynsiaid a'r Aaiaid ya anUtrml^i^. 

Cmleaf r B)/i, 1. SR. 

Amlder, -au, i tm. plenty, plenitude, plen- 
Amldra, > t«ouBnesB, abundance, store ; 

Amledd, -au. J richness ; numerousness ; mul- 
titude ; multiplicity ; frequency. 



e pa^anyelt a < 



>dh,— L*frvifr, \Qi 



Mat^KOsim, ii. 63. 

Ynddynt y ceir nnldfr ystyr, ac amidrr mi^dwl a cJuv- 

bwyU, ao amlder dyrhymmy^ a bam, ac amidir vylwedd a 

oulvedd, au omtder aeldronk ar fod a banfud, a phvylL a 

d«il i A byo a bflir amUrr ar y Qjiainetf- 

Cs/Hiac/i I Brir^d, 13. 
A thi a ^ amldra o artan.— /ot dU. ». 
Tri anbobnr iaitii : pmdeb \ amledd ; ao hyweddiant. 

" 'Huuit y Bnrdd, tt. 



Amj/iedd yHjdd yD yn tir 

Rbad difrad dwyfioD, amltid hedd 1 hon. 

Oroniof f/waifi, w. 
Mae tyrtlon amlwg yn dn plitb. 
Yd unbwb nag amiaUrn'r ^whUi. 

tole Mirrgiuueg: Salman, i. mT]. e, 
NlddxUfrondKT.— /»an». 

.4 mi'i&r gnnau, multiplicitr of words; oopions- 



«ofi 






6 Ahleolwyb 

Amldroed, j o. having many feet; poly- 
Amldroadiog, j pons; multiped. 

Amldroed, I -ion, tm. a polypode; a ^Ij' 
Amldroadiog, j pus or polype. 

Yiiiddeivya fod ^an y Uyaieuyn teimUdol, a ayimnud 
wrth ei gySWidd, nyinBiaint o ainirylTndiad a(( sTdd nan 
amldrorS J dWfr crtww.- Y Ddiixr ti'r Crtadtru-id. i. 187. 

Amlddrych, -au, tm. variety of appearance: 
difierence of sspecta. 
Ei amlddrucX oedd yn hami ei onmiant. 

//'•n Ptrri: ^L Ffr. It. S. 

AmldduU, a. of various fomu or fashions ; 

mullifornt; multifarious. 
Amlddulliog, a. having many forms; mnlti- 

fonn, polymorphous. 
Amldduw, a. polytlieistic. 

PolythriBt . . . nn ctmUd-K. apt un a ddeil tod ami dduw- 
iaa ; a ebwith yir a ddaliad !— WaUen, a.T. 

Amldduw, -iaid, »m. a polythrast. 
Amlddnwiad, iaid, mi. a polythmst. 
Amldduwiaeth, -au, >/. polytheism. 

^nJ^KindffA, daliad ami dduviau. — Walttn, 



mawr. a derTynodd yn ninyBlr oai'itd^vimih ac ^nnaddol- 
iaeth.-/. Wiuiit«ui OncI, Dywial. Bhi^L SI. 

Amldduwiaetliol, a. polytheistioal. 

Amled, -au, tm. [lied] extent; compass. 
Ar amled y wlad, all over the oountrv ; through 
the length and breadth of the land. — Owent. 

Amledttaniad, -au, im. extension; expajisicm. 

Amledaanu, v. to extend ; to expand. 

Amlediad, -au, »m. [UoduJ expanmon; ex- 
tension ; dilatation ; diffusion ; a spivading. 

Yr aTuJediad a warthefr swydd H€iiirordd ar hyd cjmaa 
mynyddig y Dehendir, a llwyddiant pdb rbyw o warthcg 
""'"""" , . ^ynt yn Mswf y Rellir cynmrya y rhy* byn- 






faa-wTx y rliyi 
■thyddiaeth, 1 



H'. O. Ftiglu: CO. Til. soe. 

!,>/. amplification; dilatatioi 



Amledigaeth, 
enlargement. 

Yd al J dduU bun y dygrydd i'r ymadroddwr ddvyn ar 
ddcall, ei tttA yn ammheu, o ran amUdiyanh, ym mba la y 

Amledu, v. [lledu] to expand or extend in all 
directions ; to dilate, to expand, to extend ; 
to spread abroad; to spread; to diAise. 

Oauya aiu^ nuLTWDlaeth ei «ffy11 amlrdai, 
Ac VTtb Lodeg, jag ngwyneh y getyn a n adiai. 

r. Llogd Jona: Ceinlon Amn, 186. 
A cban amledu dy adenydd ^vidd, 
Ma] y ffolomen, ar y dytnder mawr 
Etat<M».— »■. O. hglir: CO. i n (rf. Sl»). 
Amladd, -au, im.^Amlder, Amldra. 
Amledd yn gryno, multum in parvo. 
Amledd^wr, a. very copious. 

Rhaid el bod yn BMlaIi(/iiii>r, ntfeng, a Uaon^iit el 

geiriaD.^C^tlHnoal y Bdrdd, 13. 

Amleglwyi, \ a. holding more than one eo- 
Amleglwyaog, J clcstasticai living at a time, 
t'n amleglwye, a pluralist. 



Jm V^.tltH^IL" 



AULBOLWTSAETH 1 

AmIeglwyMMth, -an, «/. plnralitj, pluralism. 
Amleglwysog, -ion, tm. a pluralist. 
Tr aTnitgiwyiog (pf. amieglwyaogion), the plu- 

AtKbthci/teg . . . gwi rghirjata yo diJ mwr mg nu (grw- 

uhjiffTif yn yr e^wya Oristiukogol ar y cyutaf . 

Crriaau » ^d, i, M. 

AmleglwyBOgrwydd, «7n.=J7n/n7/u^>ae(A. 

mi* 7 iryfnndrisfii vedi eyia^o hai (n-fraith, »ydd erbyn 
hyn yn Uythyrea farw^ yr hoa a oddefoi i offdrud UAird. 



Amleiriaetli, -an, «/. use of many words ; 
verbosity; multdloquence ; loquadty. 



Dyweda awdwT y ffylndAU, yr 



% redyddlm ni, a 



^ywineliu 



b, yn Sylwcdydd. 

Amlairio, o. to be verbase or curcumlocutory ; 

to use redundance of words or expressiona. 
Amlsiriog, a. verbose, wordy; loquadous, 

talkatiTe ; prolix. 

Amtlririoa ■ fydd bsnddyn.— £f»it Jfsmt. 

Anueroni fy iwhyfidU a Gaovybi yo 
a J PhBC luMc fMdo y Mwrqg 1111.6%™.^. 
aiMaW JTiulaw ; OmiUk, ii. S70. 
Ainl«iriogrwydd, am. TOrbosity; loquadous- 

liess; prolixity. 
Ainlen, -i, -au, »/. [lien] an envelope, wrapper, 
or covering ; a case, a cover. 

Amltn fftwr UD l*n forwyn-— /*iifln Sadd, i'r OvrthTun. 
y Onsl tun y mil bm.— .^m Uonm-, iv. 307. 
^mJm ilythyr, the envelope of a letter. 
.i>nj«n "jt/r, the wrapper or cover of a book. 
Amlanu (f), v. to envelop, oover, or enwisp. 
Badvm ft ddafith, ■ thrwy rydol y dydd yr oedd ya 
ffirlairlo yn ddirye, fe chyniyL&D dudev yn <imt#Hii'r ddalmr. 
J. W, ThBvu (Beren Oomer, n. \n). 
Amleuw, 1 a. [enw] polyonomous, pol3'no- 
Amlenirogj j mi^, multinomijiaL 
Ajnlen-wBd, -an, *m. a filling in all directions. 
Amlenwi, v. [Uenwi] to fill on all sides ; to re- 
plenish all around. 
Crl«t ft ddo«h yr byd nc bod Ada( 
\e bobyl ^ vffBTn rcthern gaethaf 
r ^..1*.-.. n^ 'i^Lffylcb naf t"*"* 



T avt^fuvi nef omffylcb naf 
A gnlleft ftiigid ftngheluytftf. 






loto JforydHH^ .' Sftlmui, TT. czxtI. S. 

AmlMildeb, tm. multiform space; space in all 
directJons; Borrounding space ; ubiquity. 



n ynddd, mal ft 



ididyn,fte 
»Ty b^ 



Amlew, a. devouring, consuming, 
all sides. 

Oct tew snlfH ^nr rwlet Tslch. 

Pr^fid ByOan: H.A. i. S8B. 

Amlewin, am. brightness in every direction 
Burrounding light. 
A glvyi imlciDift bin bst.— Am Cm. 
23 



Amlewyoliiad, ) -au, *»i. a shining on every 

Amlewyrchiad, j aide. 

AmlflwyclLU, 1 1^, to shine around ; t« gleam 

Amlewyrchu, ) about. 

AmUenyw, a. polygynian, polygynous. 
Y Uwytk amlfenyv!, the Order Polygynia (iu 
the Linnaean system). — Htiigh Daviu : Welsh 
Bot.49. 

Amlgell, I a. having many cells or cavities ; 

Amlgellog, ] multicapsnlar. 

Amlgonglog, n. multangular. 

Ajnlgysawllt, sylltau, em. 1. polysyndeton (in 
rhetoric) ; also called UuotgyuwUl and ttuaint- 
gyttwllt. 

2. Uie Class Folyadelphia fin the botanical sys- 
tem of Linnaeus). — Hitgk Daoiu : Welsh Bot. 
72. 

Amlh&d, sm. an increasing, multiplying, or 
augmenting ; augmeniatiOD ; ampufioation. 
A pbob ^wr vrth ^ouuLd heddwcb ft bravd, s phob ^wr 
a ddaoffOH vellid ac nrntlfid ar nebryw Kelfyddyd a 5^- 
budftclh a To er Uw byd a bj-wyd. nawdd bardd giftddiedig 
JVg TIgOTKiA yw iddo. — lofo Mn. fi8, 

Ajnlhaol, a. increasing, multiplying, augment- 
ing, enlarging, 
Amlhsu, V. to multiply; to increase; to aug- 
ment ; to make more [dentiful or copious ; to 
amplify ; to extend. 
Uedylysv ftgwBftflthftiit ryrelu on erbyn B btoihln. ac 
dniMau «a tenynen cfaoiwyii. 

iml Or, ah Arllair: U.A. U. 288. 
DO o wrwnaaa "YI^Air.HW. 

OanamlAau yrxnUJ/dy boSDaudJ.— I?cn. lil. IS. 
Amlhau geiriau, to multiply words. 
Amlhaa ei gamrau, to multiply one's steps ; to 
hasten one's steps. 
Amlhdwr, wyr, em. an amplifier or multiplier. 
l^,-°^n I "drcuaifluous, flowing round. 

Un /atb adeilai ete y byd oddi ar 
AnOim ddyftiiedd tewel y meirn lied 
Criaiaiuwirl algion.— tV. O. Av*' ; CO. Til. SIS. 
Amliaiu, lieiniau, tm. a linen swathe or wrapper. 

yr amlieinioH yn gorw«dd. 

Mu- Oraol. Byff. (loan 3tx. T ^ cf . zx. 4}, 

Amliaith, ) <t. polyglot; having or contaiu- 
Amlieithog, ) ing many languages. 

3eibl aTiUieilhcg Llundaitt, the London polyglot 

Bible. 
Amlifeiriad, -an, »m. a flowing around. 

mlifeiriant, ioint, iannau, *7n. drcumfluence. 

mlifbirlo, v. to flow aronnd; to flow on all 

Amlifsiriol, a. flowing around, drciunfluent. 
Amlifiad, ) -au, *ni. a flowing round ; droula- 
Amli&d, i tion; droumfusion. 

Amlifiad y gwatd, the circulation of the blood. 

Amlifo, V. to flow around ; to circulate ; to cir- 

cnmfuse. 



A bod ftfonydd »nr yfftdwy , _ 
Amiifaic, pan o nn gwyrtb nthiad 
" TeryUt haol mor bell oddi wrtl 
■ ' a pUlh daiHol 



CvaSarW 
Ttwddayi 



wrtbomnl. 



,>gle 



AXUHKLI' 1' 

AmllneU, -an, if. a ciuTOundmg line; an out- 
line; contour. 

Amlinellol, a. having an outline or oontour; 
being in outline. 

Amlinellu, v. to outline ; to sketch. 

Amliw, -iau, «m. a stain ; a spot ; a blot ; a 
colour differing from the ground on which 

y bnthTD rtarvlant ■ rrmmo' amliv> gyntnf . 

B. UtcyS: Uwjht Sjir. *a loT. »», US). 
Ot bydd and andhn nwwil goiiK, brycli mewn iryDeb, 
ttcyn a amlhc mews op. th ddioed ufermi rn> Aida i'w 
gul oddi ino. . . Fui ddiwriuT ni un uuer no oiiltw 
pecbod, nl ■ ddrlem ja ddioed Isfnrio i'w nel « Tnulth. 
£i>i £«r,i .■ DnxeUw, tW4. 
Amliw, -ion, a. consiBting of many or divers 
colours; many-coloured, yersiooloaT, partj- 
Coloured; vanegated. 
OwT rwlw och ei dm^ic Kiroh 
Arodddfeinhleln^hUld.— lUienn.' H^. L W. 
A Ikwer twbrllm amliu awslei ef rno. 

O-i olat oniInD blw brsDfa. 

Cgnddtlw: M.A. 1. ns (of. «», Sl§|. 
Eljiit yn eu blaaa plttb amJwwii flodAD. 

W. 0. h't'u: l[aiiion,M. 
A*f baul a ddoda amocb flo^ur fflwys, 
AroglBIl oa, BC anJiH wivoedd cain. 

T>i.aotAJ<n-a: Caimon Awcn, 17B. 
. Ou iu mweuwU odd y blodau tedd 
JmlnnD* a sfdw«nynt tx bob tu. 

n. £(°^ JoiHi, Hd. Ifor Caii. 
Amliwiad, -an. tm. a diT««fyin|f in colour ; 

discoloration. 
Amlivio, v. I . to diversify with coIouib ; to va- 
riegate ; to colour ; to tint. 

Tr ail. i an'rwiavriudnwdd TS lectliDS, i unirwlalJ 
MMth yn lyfygT.— Hniti Petri ; E^l. Ffr. Ann. 4. 

OocoT zaAr nrydlBU ffimw. — W- O. PughK: H.O.U. 

2. to paint ; t« represent. 

Fe ddufD iddyDt aiiiiwio Inff y w yddoldeb yn y modd 
ynu.— £Ki Lewit: I>niieUu^ 14. 

Amliwiog, a. consisting of variety of colours ; 

motley. 

A phrif gAar y 
•wdei AT yr gaar. 
Tmmnn bib dnid amlinKiit rydd yr hull. 

Garidodaa MyrMa: M.A. 1. S«l. 

Amluertliog, a. multipotent. 

Amloohr, ) a. having many sides ; many- 

Amlochrog, J sided ; multilateraL 



Amlonglog, a. havingmany angles; polygonal. 

Amloag, a. burnt aronnd. 

Amloagi, v. to bum all about. 

Amlran, t a. consisting of many parts or 

Amlranog, j aharea ; multipartito. 

Amlranu, v. to divide into many parts or shares ; 

to subdivide. 
AmlxTW, a. miscellaneous; multifarious. 
Amlrjrv, -iau, tm. a miscellany. 
Amlaillog, ) a. polysvllabio 
Amlsillafbg, | many syUablee. 
Oair amleilta/og, a polysyllable; a word of 
more than one syllable. 



dinu. iphrff dyned ihitI smUiMiKr 



8 AiawBnoABTB 

Amlu, t>. [anil]=^in^Aau. 

FU OMia ADiu sC thwf bi7«-— )^- (>. 'V*' - CO. T. S4a. 
Amluavra, ) a. very numerous; multitudinous; 
AmllawB, } diffusive. 

Oyfi^wedd yw ttnrt yto»dr»wdd, 

amnavm, nm yn dunedda y ' 

azwyddof^D ujiryfftl bethui, ^ . 

Hf»ri ftm: 1^1. Ftt. 

Amluchio, V. to cast, throw, 



LrAvdd, puk fa yr 

i,?T nnjhyw uiii 
-- — ' Ifel. 

fling about. 



A mliiTi , a. conform, similar, r 



A or diven fonna ; mnl- 



in Anglesey, but the word does not appear to 

occur as an appellative. 
Amlwedd, a. 

tiform. 

Amlweddog, a. many-yoked; polygamous. 
Amlwaddog, -ion, k. a polygamist. 
Amlweddogaeth, -an, if. polygamy. 
Amlwg, (p. Ivoed, -ach, -af, a. \}lwg=Xi. luce] 

plain; manifest; evident; apparent; obvious; 

clear; easily seen (b;^ the eyej or conceived 

(by the mind) ; oonspicnotis ; visible. 

Btthyr M mwo yn nmlwc os imloiwi. 

Oturit/ilnii Brydlmtiot: ILA. L STS. 

Aa w jr paUdyr Jtbanliari anlw.— JToMKvlim, U. SB. 

Pob (wlht CTidMedte • Yydli aaJwe ydbaw. 

Amitag ffw&ed ar fmntb ^wslw. — Diartb. [MA. Ul. 147.) 

Tri ^utb uibebgw y lydd u ddelod CBdoir i, gonsdd : 
•ef m bod u- fan (u malwg yng Qgolw; ■ dilyw gjirind ac 
■Hwydd.— Baniin, ti. BO. 

Ac efe al dnj sT i fug amltrf, f b(o brya. 

Yn yramlteg, manifestly; openly. — Matt. vi. 4, 
Owded yn aadwg, to see clesrly or plainly. 
Amlwg, lygon, im. what is plain or manifest; 

apparentness. — P. 
Amlwin, m. \ lymion, a. bare on all ddes ; ex- 
Amlom,/. j posed in every direotfon; very 
bare or exposed. 

AiMttBa ar dy afrddwl ffyot 

Yt a tyn ol a aatliyiK.— JfynUn ; M.A. 1. 148. 

AmlwT, 1 a. [aml+gwr] polyandrio, relating 
Amlwriog, ] to polyandry. 

Owndg amiwr nm awiltoriaf.— Walltn. 
AmlWT&ig, 1 a. [aml-J-gwTtug] poly- 

Amlwrageddog, ) gamons, 

Amlwrelcaeth, ) -an, a/, [aml-fgwraig] poly- 
Amlwreiciaeth, | gamy. 

bnuai ef wedi peti I lawer mwy o wrasadd nag a wfr 
'nib sea. yna bnaaai lie I Mdwl ted amU 
'igynUuntf.— i>wii£Uwardi: ^p.IB3. 



gadengeni yi 
torm&utA yn rh 



AuLTTBEiaioa 

Aiiil'WT«igios, a. polygunoua. 
Aml'WTtoetli, -ku, »f. polysudiy. 
AmlwTTw, a. polyandrian, polyandrona ; hAving 
many stEuaozUi 
Tttwyth amiv/ryiB, the Order FolTHidria. 



Asal-wybr, -aa, no. a meaiidermg path. 
Amlwys, a. fair, fine, or pleasant on all mdes: 
very graceful or elegant. 

Owedi f Foewn ddiuigM dvtod n dytnTot it KTnlnn. 
foddl rr Aipbtiaid. t ma« fa tntj nlehwrl jn mKhoyr, ae jn 
dBdTznehwujd ei jnudrAwdd Kt Ddnw, 

ffmn flnri.' EgL Ffr, xxxyL 1. 

Amlycftn, v. to render plain, evident, or mani- 
Umt; to sbowj t« explain, to eluddate; to 
point out ; to set forth ; to exhibit. 

Ckdunham me amigeJtu oof a ohrimeddfAD a wnint. 

l«lt Mm. W. 
A. ebro RW«I(i et ry mat i ra vmeb u fO 
n&jiiAwa ef AMlirecdH jml t anoaed trwr ffT^es. 



I^ffefc 



^.t3. 



g«lreu »«lllw , — „ , _, . 

T MjuDhwjnw oo 7 amij/uait yr erengrl- 

Efatgfi /nun n«<i>l, ( 1. 

I>]nBBHiiiiVcJln8VTbi>liHir*lBdoll(ni.— ifarddoi.lLlM. 

En diwjrdrwjiU * ■hJmMt yn on gonbwyllao. 

Jjunpn Ovat: Ajnuthyd 

Amlydanol (a), a. ^treading 



Ya (iMlile mwyn Inddewte had. 

W. 0. Pughc (Cjlohgniim, 1. Ko). 
AmlyAi, i>. to lick about ; to Uck into form. 
Asolygdvr, J em. obviousness; apparentnees; 
Amlyg«dd, > plainness; clearness; ootupicu- 
AmlygTwydd, ) oububbb ; evidenoe ; visibility. 
Tmroddi i dro^lwyddo golauki i^ nwddjllaa, ^ ol 
rtucwm ao amlf/ffrtsgdd pvthau. tt hyn jw j ITordd briodol 
ar aigjhoeddi.— /frfni Owen, 107. 

Amlygfo, Au>edd, feydd, s/. a show or exhibi- 
tion ; a scene. 

Dfleinrir fieh snald i rhyfeddodan jr amiyiyii. 

5er«i lypmn-, lyii. 16. 

Amlysiad, -au, jm. explanation; exposition; 
elucidation ; illuBtration ; manif eatation ; in- 
dication ; a shoving or exhibiting ; a making 
plain or obvious. 

Hi gavn arlwl ai 

Amljgol, 'i a. explanatory, expository ; ex- 
Amlygiadol, >liibitary; indicative; demon- 
Amlygna, ) strative ; expreedve ; obvious. 



9mfyff<tvlf b. Sr mwyn mvy o ^»Tch • - • I ffyffro*r bobi 
i dd^oaJou, B« o^ dja^ drvy'r pethau oni'baawf byny. 

Marnt OlfKog ; Athr. Qriit. 4T. 



Hth iiMli>dur.— /tu. BarrU : Oweith. W 

Ajnlyg^.ti. to explain; to make manifest, plain, 
or obvious ; to show, to manifest ; to express, 



to indicate ; to disdose ; to reveal ; to make 
known ; to cause to appear. 

Nid OMlvfoyd eto beth a fyddvn.— 1 /c« ill. I. 
Uyll a ndaial nn/vyn'r oediad. 

Cjf/'riaiicA V SsJnJd (Bha^dl' .,. 

AnUygu et fam, to expreas or show one's 
opinion. 
Axnlygwel, a. plainly evident ; seeing clearly 
or plainly ; clear-sifted. 

Oan fad y llFgad ainiygvifl a udUdoodd y tmethawd 
byaorfawT o bUth yigrifao ban lyfigellosdd ■ . ■ yn y ty 
ihaedarfyiwdiK i bob dyn byw. 

Oti/riiiul- f BtirM (Bhagdd. a). 

Amlyg'WT, wyr, i »m. one who explains; an 
Amlygydd, -ion, ) explainer or expounder. 
Amlygyn, -au, tnt. a goal; a mark to run or 

aim at; a conspicuous mark or object; an 

illustrator, 
Amlym, m, j a. [Uym] 1 
Amlem, /. f edged. 
Amlyniad, -an, sm. adhesion. 



1. [Uym] having two edges, two- 



o adhere; 



.eto adhere; 



a all sides; 



^. hyt pan weLych 
lo'mhl ida-w ai»Jp" y bed bop blwydjn hyt oaliiyuai dim 






Amlynyaog, a. containing many islands. 
Amlya, a, [Uys, llj^l forbidden or prohibited 
>n aJl sides ; forbidaen altogether. 

Amifit tm', dan ymlfv aer, 

Yduus yn Uacgi ud amaer.— t, OIgn CoM, -riii. t. «. 

AtiUysgnflB«th, -au, »/. polygiaphy. 
Amlloddi, v. to please or delight greatly ; to 

dierish, to fondle. 

Ckin oynnvyn— Ifn? yng ngbawdd, 

Onavd ^wirn y tw a*l sniUavild ; 

Chwedl a dyf yn ai badrawdd.— Vjiu. AreJi. til. 14S. 

au, <m. [maeth : moeth ?] a dainty, 
delicacy. 
_inuilch, a. [=:aiifalch] tree from pride; not 
proud or haughty ; humble. 

Tti pbeUi y uiff dyn ammaM {dUalchl : Hmwytlidfr 
meddwl ; oaiiad oymmydogian ^ aa awenbwyU ddwyfol. 

Anunalchineb, ) *ni. freedom from pride ; hu- 
Ichder, j mility. 

od |wnJdeb : treiglTddlaetlk mynych gaitrofgynjh ; 



Tuir piif Bpineddf y "ydd. . . Ufudd-dod o amwafc*- 
ine^, a'farvydd ytr, drabya eluaonau a nawdd a chyagboT. 

T mH rhal teatunau, fa] ac y bn'r Salman Cymraeg yn 
llaw Edmwnd Prys, yn nlw am oleuder ymadivdd, a 
dwy^ryf yatyr. ao oi«M»4-X.nt* iaith a dychymmyg. 

D^sd4Kicoli„{rTaheaia.l.sa;i!t.M). 

Lnunall, a. [am--|-mall or -fball] evil in every 
direction ; thoroughly bad. 



Kila 






I byth yi 



Beth mmuJI inelltigaid.— Siofi Ceu: IoIoUb. 3S1. 

Amman, -au, tm. an enclosed place ; tm en- 
closure. 

Amfnan, ftw^adlan a dir ar fynydd ; eaeadlo wrth Af. 

Ammonog (d), non'-prominent, not conspicuous. 

pheth a ddylid eu d All yn gyBasa v bob osltyddyd : 
Trv-^UD^bKb: M.A.i-'.Sll. 



banc^ioD : adduiaglan ; ao nnniiM. 



«glc 



it, vm. 'thftt isin place all aronnd.' 

Dim yiT^r rawraf A'r siifeidrol mr bob diJut, 
]>u« rw'r nvwni m*r BAfeidnil ur bob crrmiuiit, 
{Ai. mdfut— aoKUM-clfuit— elf rddiwtl. 

OinMif, i. ne. 
Ammarchteeo, fain, feioi, «n. a horaeblock. 
Atnrn didlyt ewig ac Elsiu 
Aimll ftddwyn ewrimawg aniAdrTVii™' 

Talirti-..- H^i.lS(A3. lis). 

Ammarddoniaath, »/. vhat, is not poetiy (but 

intended as auch). 

Tri phErlJi & kra wrth fBiu dan o9U^ ■ riiibndd ffwsadd 
Dvch adneD : difrod &c anrhuth ; AmmrunC ftc uincfod 
ff&n wlAd AD ATlwydd, o aim«ill oea utymgus; Ac ani- 
mardditnuittK, ttef a fo'n Ami^eii nu * ddyiid herwydd 
brelolau h defoduu beitdd Tujs Fi7dun.~airdijiu. U. 60. 
I, em, [am- -|- barth] an enclosure. 
'Olaetb, -an, $/. immortality. 

rmdduigoafid ein Tadi- 

Icodd Bugeu, u A ddus 
v. Kiiu»iirii.' 3 Ti^ i. lo (of. 1 Cor. kt. BS, M). 

iPT, (Dorau, *m. See Jmnwr. 

, a/, a poisble ; an allegory. — P. 
Ammendi^oid, a. [=anfendigBid] cursed, ac- 



cursed; execrable, detestable. 



TH pheth s ddie][r ai 



A gd beDdoIl 



a ohrenlondab.— rrioofd DKlAini^.- H.A. (U. SO*. 

Anuner, a. [mer] moist, wet, watery, damp. 

.liiiMB-, dyfrilyd, ffwlyb.— GrirlKfrjH W. Cgniral. 

Ammerth, a. [am- -f- berth] aboimding in 
wealth ; rich, opulent. 
OnlBd antntrlh inim jw uii Oaerloew.— UnooKr Mt. 
Ammesuredigaeth, -an, a/, unmcaenrableneaa, 
immensurability. 

m boblleadb, drwy'r hyq j 
liA«dd yn llenwi j mWdd a' 
t, yaughan : Yrairfer Duwlc 

Ammesufoldeb, am. [=aiifesuroIdeb] unmea- 
surablenees. 

A*l addoli «f rtm ei amivnrotiUb^ AnffhyfaewfdEoldfib, a'i 
drsgywjddnldeb.— ffmrf. raouftnn : Tmarter Duwioldali, K. 

Anuneuthiad, -au, »m. a making delicioiis or 

dainty. 
Anuneuthol, a. dainty, delicious. 
Ammeuthun, -ion, sm. I. a dainty; a debcaoy) 

a junket; acNinserre; a treat. 

Nld onnMilAun llATer. .JnncuMioi pob dfeitbr-furd. 

AuTn». (U.A. iii. MT.) 
Nid anwutAu sn i w$t TnwrfTDydd. 

Biarfft. (M.A.iH.lW.) 
Ni iidfl*HAlnt yr un o bonjnt yn fyw oni fnHw ar cymuU 
y fa|EirriH«th rr ca«I ^wa^adAid Aninieii(Ai>i>on ■ Higinm 
l^odaestiu. — /c^ .V:<.i. 174. 

Psn (o'r ieehyd yo gofyn ammeuWuB, ni»e'n taim el 
bdtthL— «1m ir|,n»: Rh, B. 8. U. 2 180|. 

Nld oodd AT hyn o bryd ddini kvcU anm..ai*Bi. nn y 
Than fwyiif o'r Brytanlaid. 71iB>. emM/ D.P.0.l.lS(B8). 
2. a new dish ; a change of diet. 

Has oywrdd yn Awr, o eteleo ttpyn q itw amnHulkun, 
wedj PLyaed mor ddiHaa a photes wcdl «i ail dTymna. 



A]iinMUt]llUl,a. dainty; delicate; debcioiiB; rare. 
At ol iddyut gasl ptwiiylh ddiogel yn en oBurydd a'q 
ce^li. K hefrd enllenwj a bob t&oteiUiion. ammuuikmir 
fwydydd, ac all aei^u, hvy a aethaut yn hyfach. 



Yr (TKHUtaiAun newyddioD byny ttu o*t fe(h tfaith ym 
mhUthyrluddewon.— W. Zoom: D»y Daith, 184. 
Mat hum ^n /wyd ammeuthttn i mi, this ia 
dainty fo<>d for me. 
Ammeuthunaidd, a. somewhat d^nty or de- 
licious; delicate; rare; craving tor somethirLg- 
rare or new. 
Ac felly yr »dd y bobi grylVtedin yn d ddiag-inl bmnydd 
roar ddiainyii«dd, yr hyn oedd addaa iV CuewUryd d^^ 
m,^atMaaidd.—W. Lrva: Dwy Daith, 13i. 

Ammeuthungar (n-g), a. fond of dainties or 

good eating. 

Tri pheth a barant i wralg gael tybled yn ddrw^ am 

dani ; bod yn diwaiUHv i ^ydnm ft ffir^ a gireuian ; yn 

ammtatMuniittr ; a dyvedyd yn ddnra am ei diymmydogioD. 

rnoeM: U.A. iii. 341 [cf. Ha). 

Ammeutliuno, v. to preserve (as fruits, &c. ) ; 

to Gonfect ; to make dainty. — O. V. 
Ammeuthunwr, wyr, «m. a confectioner. 
Ammhai, a. [pai] undoubt«d; without heaita- 



1. not open ; not la full Tiew,— ./*. 
. [am- (^=an-)^-paU1 tit> fouling. 



galon.-^mW ftrri.- Egl. Ftl. Aim.4 

Ammbwlliad, -an, ) «m. a being free from fail- 
Ammhftlliant, ) ure ; indefectiveness. — P. 
Ammh&Un, v. not to fail; to desist from fail- 



l.outof repair; decaying; decayed; 

disordered, in disorder. 
Tn Arglnyd uffem mm wanu 
BygyrcJiant unpeir teir trydar 
Kyimadledd keiiedloed ampar. 

Csfdd^H! KA. i. »« (ef. tor). 
2. unequal ; irreguLu^. 



the state of being out of repair ; 
disrepair. 
Mi/fifd meum ammhar, to become oat of repair. 
, a. not lasting or enduring. 
Ivyol, a. ine£Bcient. 
Lmiultarch,<Tn.disreqtect; disgraoe; reproach; 
disparagement; insult.— 2 Cor. zii. 10. 
Trwy lit a boi a ^tfaiwyndra ac anghynaKli ac amardt 
Iraislwyd.— CK/rnlAiau Cjumi, 11. 4tia. 

A dyr^dnt mtliDnt avnwtlipvyt. nat yr siure) anniU 
y dodit ialaw y tenia, uamyn kynntdyf y llyi aoed y TClly. 



•urcA yrarglw^ 



Yr ammkarchedicaf o ddyaion, the most unre- 
spected of men ; the least respected of men. 



Ahuhasohedd 



tm. disparageineut, reproach. 

-ir ,-wlilml, -au, am. a diBparaging. 

Ammluirchl&wn, a. disrespectful; nnciTil. 

AmmhATcIiu, v. to disrespect; to diBbonouri 
to disparage ; to insult. 

Ammharcliua, a. devoid of respect; disre- 
spected; disrespectful. 



■J fir arler dfn Bdwyidog.— Sal. xx. M. 
Ammh&rchturwTdd, 1 tm. diagraoefulness, ig- 
AnunliarclLnsderf j nominT. 
Ammhaxchwr, wyr, im. one who disrespeote ; 



r«digol, a. discontinuing, discon- 
tinuous. 
AnmUiarh&d, tm. discontinuatdou. 
AmmharhAol, )a, not continuing or laatiiig; 

A tn-nn'h ft.r'h If Ln m ^ 4 discontinuing. 

ATnm>iarhii. ii«rii»r, -mx, am. disoontinuaucc, dis- 
continuity. 
Anunhariad, -au, tm. a putting out of repair ; 

a making inefficient. 
Ammh&rod, a. unready, unprepared. 

T wnatthut kynh deuarnrt az 7 Brytaurelt y an kdi- 
nrav th amharaat uhmir. 

Hru Or. oi .IrfAur (B) : M.A, II. 710. 
DinjllBW jt BWr )T ^fiHx or enawd 
Kb irdd anUdrawd nn unmherTch. 

M'alos'b OaoOttrt U.A. I. W. 
jHlAaivd pob B1BllD.-f>»iTt. (U.A. m. 14T.) 

Ufudd ac ammharod, willing and suready ; 
always willing, never ready. — Diareb. (H.A. 
iiL 185.) 

Ammliarodiad, -au, »m. a rendering unpre- 
pared or unready. 

Ammharodol, a. not preparing ; unr«ady ; un- 
prepared. 

T mu'n ddays i'r Bbateiaisid wDHithur ^iluiaadn aid 
Th^o.EmH.: i).P.O. i. (243). 

Ammh&rDdrwydd, ) tm. unreadiness, unpre- 
Ammh arode dd, | paredneaa. 
AjnmlisTOl, a. inefficient, ineffective ; decaying. 
Anunharotoad, -au, tm. non-preparation ; a 

rendering unready. 
Ammharotoawl, ) a. not preparatory ; being 
AnunharotOua, ) unready. 
Ammharotoi, v. not to prepare; to be un 

pared or unready. 
AinmharotOwr, towyr, tm. one who does not 

prepare ; one who is unready. 
Ammliarthedig, a. undivided, unseparated. 
Anunhaxthedd, mi. indivisibility. 
Ammliarthiad, -au, tm. a ceasing to separate 

non- division. 
Anunbarthol, a. not dividing or separating. 
Ammhartbretlol, a. unsystematical. 
A ftifn K fr*^^ r ftilii ^ V. to render nnsystematical. 
AmmhartlLUS, a. not dividing or separating. 



Dflchnmodd «4 1«ohyd a- 



Ammharu, v. to put out of order or repair ; to 
disorder ; to decay ; to be or become out of 

Nh fydd uoluJiiwd pwi dimnAerjvA. 

■■ ■ ■ -hcaUUr: H.A. 1. 400. 

Gutm: ILA, 1. 339. 
,n tt-m, » DlTIMd • 

mueth yn waeUcfa. — Gio)ititdgdd^ It. 306. 

Ammkaru y tdii, to stir the fire. 
Lnunharus, a. out of repair; decaying; de- 
cayed ; impaired ; unequal ; not matching. 
Ad«i]sd a fydd rfir OAodiad ammAantt ac an^bymnuaar 

Ammharoaedd, am. disparity. 

not silent, loud. 

e who causes diapa- 

liBoroors. 

Ammharyddol, a. not procuratorial. 
Ammhech, em. sinlessness. 
Ammhoch&dw, -iaid, tm. one who is not a 

Ammh«chaduru«, a. not sinful, sinless. 
Anunhech&duriurwTdd, tm. sinlessness. 
AnimheclLadwy, a. impeccable. 
Ammheohod, -au, am. what is not sin ; sin- 
lessness. 
Ammhechodog, a. having no sin ; sinless. 
Animhechodol, a. unsinning; sinless. 
Ammhechrwydd, tm, sinlessness. 
Ammhecliu, v. not to sin ; to become sinless. 
Ammhecho*, a. not sinful, sinless; notlusting. 
Ammhechu»rwydd, «nt. sinlessness. 



jeudodog.— 

Ammkedogion, apoda, animals without feet. 
Ammliedrogl, a. not square or quadrate. 
Ammhadror, a. not having four sides; not 

quadrate. 
Ammhedrori, u. to divest of a square or quad- 
rate form. 
Animhedryael, | a. not quadrilateral ; not 
Ammhediyal, j square; not quadruple. 
Anunhedryfao, a. not having four places, 

points, or quarters. 
Anuohedryfanog (1), a. not quadrate; not 

having foiu^ places ; not four-sided. 
Amnihedrylaw, a. not thoroughly dexterous 

or skilful. 
Ammhedrylef, a. not perfect in voice. 
Ammbedryliw, a. imperfect in colour. 
Ammhedryoled, ma. imperfection of inetFoc- 

tivenesB of parts. 
AmmliedrTTaii, a. not quadripartite, not di- 

divided into four parts. 
AmmhedwaTOCbT, a. not quadrilateral, not 

four-nded. 



Digitized by Google 



Ammhxdwaxoohbbud I 

AiiunlLad«nurocbr«dd, ma. the atate or quality 

of not bong qnadrilAtcisl. 
AmmlLefr, a. not beantiful, unliandsome ; nik' 

comely. 
Ammhefiroidd, a. somewhat unhajidaoiiie. 
Axmnll^fredd, ttn. anhAndAomeiieHH. 
Ammheiriaouedig, a. unorg&niBod ; disorgtui- 

Anunliebi&niAd, -an, tm. a rendering inoT- 

ganical. 
Ammheiriannedd, tm. the state of being inor- 

ganical. 
Amniheiriannol, a. inorganic. 
AnuQ^eiriaiuiolaotiiT -au, if. disorganisation. 
Ammheiriannu, v. to disorganise. 
Anuuheiriant, »m. what is ratorganised ; a 

being inorganic or shapeless. 

DriDgBT 1 out oedd tj cbwaot 

Bhu erjT rhu ofti av^ieirami [_ai. unbekuttl. 

Ammhaitliig, 1 a. not visible ; not open or ez- 

AinmlieiUiin, ) posed to view ; unexposed ; 
having no prosftect. 

Ammheithiog, a. devoid of pro^)ect; not pros- 
pective ; not convenient to look after ; incon- 
venient for htm ting ; not desert. — P. 

Anunheithiol, a. being without prospect ; not 
open or fit for hunting.- — P. 

Ammhelra, a. without oonflict, strife, or tur- 

AmnihelTdraidd, a. without radiation. 
Ammhelydriad, -an, tm. irradiation. 
AnunhalTdxog, a. devoid of radiation, irradi- 

Ammhell, a. not Ux, distant, or remote ; con- 
tiguous, near. 

Ammhallder, tm. neamess, contiguity. 

Ammhelleiug (Ai), a. not remote or distant; 
not foreign. 

Ammhellaa, a. incompact, incomplete. 

Ammhenawd, wm. a being without a head or 
heading. 

Ammbandant, n. indefinite; unpredse; un- 
punctual. 

AmmhenderQrniad, -au, >m. indedmon. 

icluaive; unsettled. 



Anunhander^noldeb, i 



. IndecisiveneBg ; 



Am m hftndod, snt. want of conclusion ; inde- 
Am m handodol, a. inconclusive, indecisive. 



trMUmdyn, u td nil hrny o («ur yn gjtaB-mrlt ^rfun- 
pwlm ammlimnlUiOf.~Gii/Tiiiacli y Btirdd, IMS (of. 106, 107), 

Ammlieimodfldd, n». indefiniteneas. 



«i 



AUUBKBPFAITH 



Ammhannodoli a. indefinite, not definitave; 
doubtful, unoertain ; undefined. 

Bitlir y brenljn a mjn va bod j dmcdd yn ai 
su tarfriuu, modd t cttffai a^uira bui fu da kbuh 
AchiryD u ft wneUi BuJIydd. 

Bnil Abrrptrtvm: ILA. U. OH. 
Er bod y prophwrd Dank] . . . yn vcaod rtilfBdl 1*^"*^^*^ 
yn Us rtuledl aiiJlcfniiiM. 

Dr. J. Damn: Uytr y B«. I. ■. «. 
Phu-ii pfnnmM am im iumtrrmifnt 

lot. BarrU: OmiUl. SflB. 

Y bantiod mttmhrnnodol, the indefinite article. 
Shagtnwau ammhennodol, indefinite pronouns. 
tttjBol ydynt rtit^t oaodukt allui ea 



Imu 



ffwrthddiychaa m 

AnunlLeniLodoldabt 
AmmlLennodolrwfdd, 
Ammltennodoledd, )»m. indeflniteness; an- 
AnunbaniLodrwydd, ) settledness. 
Ammhenydiol, a. free from pain; not doing 



Aminheraidd, f not delicious. 



Ammhercben, a. being without a possessor o 
owner ; unowned ; unappropriated. 

Nld nil lumiu awydd at unj ~ 



Ammhercben, ) -ion, tm. 
Ammbarchanog, j possessor 
proprietor. 




Anunbercbenog, a. having n 

seasor ; unowned, unappropriated. 
Ammharobenogi, v, to make un^propriat^ ; 

to oeaae being on owner. 
AnimbarcbenDgiad, -au, tm. inappropriation. 
Ammbercbenogol, a. unpossesaing; to oeaae 

from possessing ; unappropriated. 
Ammbercbi, v. to disrespect ; to dishonour, to 

disparage; to insult.— AAu/. L 24. 
Yt wyf yn perdu ty Nhad. aa yr ydrcb chiritJiau yn fy 

sainVrati'iiuiau.— .HWu Cjifi,: DiS. i. 7. 
Tri pbeth a geddant nnldawi ac a'u OriiUnt : el am- 

nOrrtii; gogann eC gBrdd ; I'i DMiu.~ll^. Arc^. Hi. ISS. 

Ammbereiddiad, -au, im. a rendering unde- 

licious ; to deprive of sweetness. 
Ammbereiddio, i: to render destitute of sweet- 

Ammberaiddiol, a. not sweetening ; unde- 
Ijcious. 

Ammberaiddrwydd, tm. lack of sweetness. 

AnunberiButb, a. [perffaith] imperfect; in- 
complete. 

CytboetcixpaT'.^MMiut ygantunt,— £■ ~ 



• : Dryoh. Stvr. IS. 



fad yn dragywjddol.^ 

O bridd y Uam y mae pob coaird. 
Yn sn^m tUwd aM.i4«'/aiU. 

Annfr ammhtrffaith, imperfect tense. 

Pum hamT a ddaw o fyna^edig fodd ; ujd "■"c™ cyn- 
nyrchid, ammlifrffaWi. pepE^th, mvT no pherffaiUl, a 
n^.—Piam Llgfr Cenidvriaftky W, 



Auf U ER VlfliimUSB 



h jataitL yng ughw&l. 

Xdnirrm: I>(Mputh,99. 

jlmmAer^n'tAion, imperfectionH. 

Tr wyl, er hTSf, yn anlod Uawer o ii»m*erjfrilWon 
men pnhaual laosa o hooo, 

Lli/Tit<ldiitrat s Cirmrt, Bbtg. 18. 

Of er rn Miin f^dai onuire anrfayw ntnovd dmt^t, 

nn chnfn tynerwch J bebniad toog at eu ^tiaim^erJFfi'ainn, 

BlaOai, Imabir. [Hrnegibl) 

Aminherflbithdar , ) -au, tm. imporfeotioD ; 

Ammhatflbithdod , ) imperfectoess. 

AtmrnktrftiOdrr k bchianrydd Dodweddiad j QjmzY fd 
cenedl -jijiA dn Uooaog. 

W. Jona: Nodwcdditd y Cymuj. 

Ammherffeithderau, imperfectioni. 

Ammliarff'eitlirwydd, tm. imperf eotion ; im- 

perfectneas. 

Qmn we1«d o hnwf ya drylwyr dptniUrJUlAnrjNtf yr h|% 

i»i^ I>a/Vdi< .• Cyfr. r Bdidd, 1. 



Ammheroriaeth, im. lack of muaio ; mharmo- 

Am mh ar»onol , a. impenonal. 
Ber/aa cunmAcraonv/, impersonal yerbs. 

Y bATfaii cyiumHliwyiil ndd D ddfHi Tjw, Hf pencpnol mc 
ammJifraimoi : rtuu o*r bcrnu ocdym penono] ■ droJr yn 
■<n— IsrfcHioJ trwy «u cniyUtu i A^lrlAU «mill. 

Baien Daiia : laith. Cymi. U.BLS. 

AmmlLersonoldeb, tm. imperBonality. 

ATtimhartliyTi, a. wifbout relation or afSnitr. 

AmmlLerthyiiaa, -au, i/. want of affinity, re- 
lation, or pertinenoe; iirelevanoy, non-per- 
tinence. 

Anshrefn ft cbftmyrnddwrn u getdd yw ammiirAfiict 
nir u ftdua, hBrwydd vmitiired %e ufui. 

CjiAriMcA y Bnrrfd, M. 
BkI hefyd yv ammArrtkf/nat Tnewn oerdd guUDoledlg; 
Kf jw hyny, peth nl chynireddo i*r dyn y pryUr bau r 
cuet iddaT,— i>uio U;iA rinUvrJiKU, ie. 
A m mherthyniw, a. lacking relatjon or affinity ; 
irrelevant, not pertinent. 
AimhrefD il rhuDyrnddwrn bofyd mzgerdd yw moU'ti am- 
m/ltrlAfnat.—Ci/friitcKli y Airdd, H. 
Tn pheUi ft luinrddant ff?TJd ; Bidfl d g ftD nyDM] 



relevant. 

Aininlwrtliyiuwol, a. not pertinent, irrdeTant, 
irrelatiTe; tmrelated. 
ymofynlod □■rnVrfAjmoH' l&im ft ddyH^WTd 1 ni dyn- 

btU fttllTTBt VOAQthnr. 

Lfl«a a Prtet! Uaddsuftnt d Edifeiridl, SSI. 
Pelhau atnmherthynatol, irrelevant matters. 
AmmhartliTiuwoldeb, 1 am. irrelevancy; 
Ammb erthynaTwy dd , j want of pertinenoe. 
AtwTtih nrth yn «jn , v. to render irrelevant. 
Anmliartliyniad, -au, am. a ntaking irrelevant; 

a beooming irr^vant. 
A wimTi aH-.tiynnl , 1 [^), a, irrelevant; wanting 
A iMiwTi »Tt.>iyTi iiM, j pertinence, affinity. 



Ahmhbdbdioaxth 



A m Tnh erthyaoldeb , am. irrelevance. 



irrevelant ; not to belong. 
Ammherwyl, a. without occasion; not to the 

purpose. 
Anuuhetnia, ) a. doubtless, indubitable, un- 
Anunhetruaol, ] doubtful ; undoubted ; un- 
hesitating; unquestionable. 

5.. 

AmmhetruBdOT , \am. indubitableneas, 
Ammhetrusedd, \ doubUessnees, undoubt- 
AmmlietnurwTdd, ) fulness ; freedom from 

doubt. 
Ammhetmsgar, a. not sceptic; not disiwsed to 

doubt or hedtate ; iudubitaUe, unheeitating. 
Am mhetmigarwch. »n. freedom from doubt 

or hesitation ; indubitableneas. 
Ammlxen, v. [amau, uneu, ammau, ammeu, 

ambeu, anunbau : am- •\-peao : L. ambigo ; Ir. 

and Ga. amharae] 1. to doubt, to hesitate; to 

suspect. — 2 Eld. iv. 76. 

YmiaiiiBp.vr.SKei»k<iijamtteii. 

A.B. U. IS (cf. U.A. i. B7S). 
Hftwyrda hab y ncrwrii anBAev yr hynu ftdyredwch diwi 
DyiffWnftfl. — Mabtm>ffi<m. [IL 970. 
HkltlwidynaiiH»llT(naU<a.— SUArAiii.' 1LA.L8W. 
Kyoefllt RTym yioym aya amAetir, 

lAtKHgn Br^ltM Bedmuu: M.A. L 411. 

Ammheu ead hyw, to despair of life. — 2 Cor. 
i. 8. 
2. to contradict, to speak against. 
Ammlwa, -an,n».doubt; hesitation; suspense. 
T mae yn ammhxu genyf, I have a doubt; I 
donbt. 

Tu kwnt i amrnheu, beyond doubt. 
Nid hvyimoh yr oftuftAfli nrn'r dlan. 

^Hant. (ICX iU. ISt.) 
TtI nxUev braird t ftydd. 

IWhU CtfrmiA: u* liL US. 



ject) ; not applicable. 

Nid nr ymdiaflratha mewD petlm amiOiTi'lviidt I ti dy 
ban, ddim md trpnllo'r amier yn anfoddkil i ti dy him. , . 
Eto nld oea 1 ti eyfrlt aoghenriieJdian dy Rymmydog yn 
betb ammktrihgnct, amyi y mae yd nnhyn 1 U. 

SUt Wftni: Bta. a 8. i. 1 (U|. 



^, -au, «/, doubt, hedtatioQ ; scep- 

UCJBIU. 

Hfte ya diald 1 bwnw belluh ymsynsliori I'r Uyfisa y 
dyir«daaomo*r blftflD tod ftthiftviuUkan'r gnfydd Oiiatiaai- 
0^1 yn gnmwyaedig ynddynt, tM ohwtomych ^yfarwyddyd 
ynff iwhyicb amnJieMfKOjiu ftu ymDryAfon hjt^yrf^ neu enir- 
edigor.— £if, SawMTl: OraUai^ t. IS. 

T okfte yn vmAm oMptAfictflA, lie y dlebon, a Us y driftl 
fod yn ddlnffos.— /«. Bonit: Ovettb. 88 (of. 106). 
Mab ammheaa^h (pi. meibion ammheuoeth), a 
sceptic ; a PyirhoniHt. — W. 
Tu Kwnt I ammhewKth, beyond doubt. 
Ammb euaethol, a. sceptical ; doubting, dnbi- 



AnunlieaedlgaftUi, -au, >/. I. hesitation, dubi- 
tation. 2. suspension or diaporesis (in rhe- 



— . -,aetki DBD befaiuad, yw ffiwr a 

■ofyn eyngfaoT ar aiasth bttntOft vb ; nid i 



,,Ct>ot^[c 



AUHnOBTHSDD 



Ammlieuedi^ol, a. doubting, hesitating : acep- 

AmmlieueaT, a. addicted or disposed to doubt ; 
hesitating; scrupnlous; eceptu;. 
I'n ammlteiigar, a donbt«r; a sceptic. 
Ammlieugarwch, tm. addicteduess to donbt- 

ing; scrupulosity; Bcepticism. 
Ammheuo, p.-^Ammhru, v. 

Nld riiAid i neb tjtvjnAfvaip im ddy^ir j ^vuth rm mlaoi 
yn drernnfl. Oipflird^dd^ Til, IfiS, 

Ammheuol, a. doubting, hesitating ; doubtful ; 

Ai BpnniAfru^ jdyviud vifltM^uu^hrifit Tn yrAdAD hyoT 
Korui Cjlfin: Dillju. it. M. 

Ammlieua, ) a. doubtful; uncertain; doubt- 
AmmheuuB, j ing, sceptic&l. 
AmmhsuBTwydd, ) on. doubtfulness; nnoer- 
AmmhSuBTWydd, ) tainty ; scepdualness. 
Ammh«uwr, wjt, «m. a doubter ; a sceptic. 
Ammhlaid, a. of no party; neutral; indifferent. 

O'm blun o brddl im' blald. 

Lev Bmlirii, atae'B Isi ammlilaiil.—Bkta LtlBfd, 

Dyn ammMaid, a person that belongs to no 
party ; a neuter. 
AnunUaid, eidiau, tf. neutrality, impartiality. 
Ammhlftnt, a. being without children ; child- 

Ammhlantadwy, a. that cannot bear children; 

Yr bwD a woi i'r ansLUaoiaiftgir ndw tt , ■ bod Tn Ilaven 
fun pliuit,-:$il». eiiii. 9. 

Ammhleidgar, o. not attached to party ; 
impartial; neutral. 

AmmUeidgaTwcli, »m. impaitiBlitj' ; neutral- 
ity. 



eidiog, a. impartial; neutral; not be- 
longing to a party or faction- 
al mm AlCT({(>^'on, Adiaphoriats. 



A mmh 1 aidlogrwy dd, nn. impartiality; neu- 
trality, 
Ammhicidiol, a. impartial; not partial (to); 



Butral. 
Ammhleidioldeb, 
AmmMeidiolrw^dd, 
AmmhlaidiwT, -wjt, 
Ammlileidydd, -ion, 
AmmMei dwriaeth., 
Ammhleidyddiaeth , 
[lartisan; neutrality 



luplcasaut a 



am. impartiality ; neu- 
trality. 

«m. one that is not a 
partisan ; a neuter, 
-au, tf. the action or 
conduct of one not a 
adiaphorism, 

au, «m. non-pleasure ; what is 

disagreeable; dislike. 



nefticdd, D 



.ifwjo. 






(nJonau tr^ptioi 



: Boob. Qtlrt. 88. 

Ammhlatli, a. not interwoTcn; not oomplei 
or compound ; simple. 
Qodldavion ndlawfaid wlofiimii j getwir j Thai endll a*t 
adLawifUd, (un fodemynt odidogryw «r — -'" "-■■ 



biirth ban, c^d bo es 






fetiM.it 



AjmnUethn, v. to undo what has been plaited 

or woven; to render uncompUcatcd or simple. 
AmmhL'th, a. uncompounded, unmixed. 
Amwhlitbo, v. to make simple ; to decompose. 
Aminhludd, a. not soft ; untender ; indelicate : 

rigid, harsh. 
Anunhladdedd, am. want of softness. 
Ammbluddo, v. to divest of softness ; to render 

harsh or rigid. 
Ammhluog, a. unfledged; featherlees; callow. 
AnuohlwTf, -au, im. an extraparochial place; 

a place or district which belongs tc no pariah. 
AmmUwyf, a. extraparochial. 
Ammhlwyfbl, a. extiaparochial. 
Amiithtwyfoliim, non-parishioners' 
Ammhlye, a. not double, folded, or bent: 

angle; simple. 

AdlAirUd ukMKdd ■ dknlotn ai^iMn y gcilw itui j 
pomiUkin hrjn-—Ci/friitatX jr Bfirdd. 7S. 

Ammhlygadwy, a. that cannot be bent, 

doubled, or folded. 
Anunhlygol, a. unbending ; not doubled. 
AiHTnlllygu, V. to unbend ; to unfold. 
Ammhoblog, a. not populous, thinly peopled ; 
non -populous. 
Tref ammhoblog, a town that is not populous. 
Animlioblogaidd, a. unpopular. 

Qnd a* mor ddibuvb ac amm^bloffaidJ yw y ddylluiui 
uiiTodiUTin mhlith perahau^oii sden.— FrUn Stoned, si. 
Dgn ammhoblogaidd, an unpopular person. 
Ammboblogeiddrwydd, *m. unpopularity. 
AmmhoblogrwTdd, *m. non-populi 

.. witiiout pain, painless 



Ammhoenadwy, a. impassible ; that cannot 

be pained. 
Anunhoenydiol, a. not inflicting pain; not 

having done penance ; impenitent. 
Aminbol, a/.-^Annnhwl, q.v. 
Anunliorth,*m. I. non-asaistanoe, non-support: 

opposition ; that which is opponent. 

wyr « dccbiin ffo. kuiy wydynt pwy ■ wy iwtb. pwy ■ 
Tey amponi.—Br,a. Or. at ArUiur.- 1I.A. ii. Wl (cf. SU). 

Tri aimOnrl* •fTcbog ; yroeflwynt hydwf ; bnwd pre- 
gelbwr [ % chL— *^. Arc*. QL iw. 

2. misfortune, ill luck, ill fortune ; disaster, oa- 
lamity. 



Tydi.. 



lyyna™ 



•* yt--Br 



fr§rUTXr""irA"«.'« 



•t a>cii(>pi, nd. M. 



oeddynt a'r bynt boo. 

" -' Oipilym, 1ml. i 

■Guufr aif. 
Oihiivddyi 
~ " 0»iiii,S8lof, UO). 

A m m h nrthftii wy , a. unaupportable, unsustain- 
able ; that cannot be feil 

AmmhortlLedd, tm. want of support; lack of 
nourishment. 



Ueddva 

Ula drwg a fa*m UiovyA drair, 
AUnwiQioadd; annLtorM idda' 



AlOIBDBTHIAinfOL 1 

ATnTnhnrthiM.TiTinl, ) a. not yielding support, 
A»nYi>i m- t:>iin.wn ii»^ | HUBteuamoe, or maiuteii- 

Knce ; doroid of eliine&t. 
Amin horthiant, am. what is not support or 

Bostenance; non-assistaiice. 
ATnTTihorthol, a. not eupportdng ot asaiBting. 
AmwihorthorddTfy,a.notaccea8ory toviolenoe 

or oppresaiou. 
Ammhorth'wy, a. without support, help, 



Ajoihbiodobiaeth 



jmnliaubl, a. [podbl: L. tmpOMtUJti] ini' 
possible; onfeamble. 



HBbfffddai 



DBdd L un dyu ddvyn petli mar ^ed hc ut- 
QDW&itll.— 2^. Sidiordt: Gfirlyfr, BhAg, W- 

Ammhoaiblrwydd, «7n. impossibility. 

At ji Bithaf gnt&l b fymmerwyd bob inuor i"w hall ™- 
grifenn ; mc at yr at^mAotibirvydd ^ ^ ^ i avgbfwreindeb o 

OwalUir XaJain : BclOT Oljgild. 13S. 

Tr ocdd 7T ammlKiiMrKrdil o aohabiaeth j powmaa ■ 

grrbwylHr yo i ohweehed o'r Hsbnald, yn gTmnrrndlg 

fn yr mttmlumiinaidd o^D badufiwydda dracheni i edifd^ 

nth. — lowrph Harris : Qvaitb,4M. 



AmmlireiJUOg, a. [preimog] dimierleBs; not 
having food, sustenance, or support. 

Ammhreitliig, a. not practical ; theoretical. 

Ammhren, a. See Amhren. 

AmmliTes, ) a. not fleet ; not hast;, not has- 

Ammluttsol, ) teuing. 

AmnihrAMnnol, a. not present ; absent. 

AiainliTeseimold«b,>ni. non-presence, absence ; 
non- appearance. 

OalaidOB, aohoa nmmiirtKTaaUrb j OiryUedydd am Sa 
ChmtniTdiinddal.— Cu^ludrdd.iv. is7. 

AiDTTihreywyl, a. without habitation; unin- 
habited; omnhabitable. 

AmmhxeBwyliad, »m, i want of inhabiting 1 

AmmhreBwyli&eth, ef. ) a ceosiiig to inhabit ; 
absenteeian), 

AmmhrAawylio, v. to desist from inhabiting, 

Anaabxemwyiiog, a. uninhabited. 

Anunluid, a, not dear or preoiouB ; without 
pledge. 

Anunhridiaut, im. non-expiation. 

Ammhridog, a. unpledged ; unmortgaged. 

Amniluidwertli, $m. non-equivalence ; that 
which is no ransom. 

Ammhriflant, am. wont of growth. 

Anunhrin, a. not scanty or scarce ; not vant- 



1, am, non-scarcity ; plenty, 
., a keeping from becoming 



abundance. 



Anunhriod, a. I 

Un ammhriod, an 
Oioraig ammhriod, 
Baiuiv ammhriod, 

spmster. 
Oivr ammhriod, ai 

a bachelor. 



led ; not married ; 

igle person. 
3d or single 
woman; femme-sole, a 



unmarried or single man ; 

a Folir am d lan-tuohadd a*i lan- 
Bftmp«n.— fjyViMi* jr Btinid, at. 

2. out of wedlock ; illegitimate. 

Tua cyfudl a vnai BiUd. a ga1« ataw Nlwdoniu a'r 
dPudd«Dmrr a ddywcdaiat oad yo ammAfiott j adud elD 
Harglwydd leni.— ^n/. F^chan: Bfftngyl NicDOemuA, t. 

3. improper, inappropriate. 

Am fod yaddo fwy o Hynwyr. a Uai eirian ■PB'ur, ac 
ym&dKMlldion anghyilAitb gvagiaw, ammAriod, a ginll 
Cymtaeg.— CroBiujr Ouijn, SJO. 

Ammhriod, sc. 1 . an unmarried or single person. 
'2. sm. impropriety (in rhetoric]. 



Acynni, Impropricraa, Antmhriavd, a fyd 
trtetft gaii yn erbTQ ei arwyddoeAd priawi 



Amm hriodadwy , a. unmarriageable. 
Ammhriodaa, -au. tf. the unmarried state ; the 
state out of wedlock. 

Xyoi a wyddom o'r vomi mai yoK ogodinAb nr 
y'th gaflad, ac a'r gndliub bwnw y'tb aiied. 

Dafgdd F^fAan : Efeag. Nl 

Anunludodedd 

Ammhriodol, a. 1. unappropriated. 2. unmar- 
ried; single. 
V^ ua bynna^ fytbom ai ben aj leuanc. a{ priodol aj 
amnAriodoi, ai gwr ai gwiHig, gwmndawn. 

I. improper, inappropriate, unfit ; unsuited. 
Detueiniaid ammhriodol, improper diphthongs. 
~Dai:iee : Eudimenta, 36. 
Anunhriodoldab, ) >m. 1. impropriety; in- 

Lmmhriodolder, -au, | appropriat^meas. 'l.thn 
state of being unmarried, celibacy, celibate. 
Yr ben gymmanf a-gyn^hur Gan^Tfinae er'n peri na wneiu 

ol. a bod iddo dybied fod y aaill o ran ammKrijittoldtb yn 
iancteiddialach na'r llalL — Marug Cfffia .- Diffyn. t. &. 

'iodoli, V, not to appropriate ; to cease 

appropriate. 

Anunhriodoliad, -au, int. non-appropriation. 

iodolrwydd, 1 am. inappropriatoness ; 

Aininhriodol«dd, | impropriety. 

Anunhiriodor, -ion, tm. [priodor] one not a 

proprietor, owner, or possessor; a non-pro- 

O darfydd i ammhrialawr tod oddvad gaolhair ar d fod 
yn gwarebadw Ur a daiai, yn eil^anr neii yn drydydd, a bod 
priodawr yn ei boll, a cheidiraid iddav ar ei briodolaer, yr 
ammAriedata- a nciLiryn riuffddav. 

l^SH B^itnt. n. I. 34 let. C.C. L IMl. 
Ny dichauD at^priaiawr gwrtblad afnpnodauir anil. . . 
Brefnl oet ybrawt hynaf amia y brodyr icubaf oU yn am- 
firiodawr ao a«gwuna ynt«u ra ra priodawr or dadanud. 

CjlfrrWiiau fymni, f. MO (cf. 601). 

A phawb yn briodorion ae anoAriiiilurioif.— /»/» JTii. ti3, 

Ammhriodorion arglwyddi, usurping lords ; usur- 

Ef oedd en harglvydd priodawr, a vwrthladd y gyt ug- ef 

yn wycbyTeuftd™;irtorfpriOT,flrj;icj(WfwedidyfodoIoa^I. 

BrnJlrdd Or. ab Cynai: M.A. il. »«. 

Anunhriodoriaeth, -au, (/. the state of a non- 
proprietor; non-proprietorship. 



,>glc 



Ajiuhbioskwydd 



AjoaabrioirwydA, tm. want of being sppro- 

priatod; inappropriatenoss. 
Ammhriaiful'wy, a. invalnable, prioeleu. 

ThUi dmenl, i'r nnedl irdd Tn mdl. iroUJ f donlsn 
mliTiitadKt bjB'.—Mt/trdod'n Atrvt,. Iw. 

Ammhrefodwy, a. I. not to be tastod,' not 

taatable. 2. unproTable; that caonot be 

proved ; improbable. 
AminhrofadwyAeth, -au, (/. the sbite of beiiig 

unprovable; improbability. — W. 
Ammhrofedig, a. 1. unproved, untried, oiibb- 

Bayed. 2. untasted ; inexperienced. 

Tnrr t* gTonilet uDirwiutti o fodMi omrin/eiU; o'r 

bUao . . . V HkKid i nf friiM ^ 

Oiia^nncn Cfmralf (1T98), IM. 

Ammlirofiadol, a. inexperienced; not experi- 
mental ; not probationary. 
Am m broph wy dol, a. luprophetic. 

Uiw uuiyw ffttiuQ a zv^dTwedladAU *mmkrtipttiesdtil^ 
Sieaitiltr.- DwjtOt OimUh, iii. 
Ammhrudd, a. I. imprudent. 



et un betluD ■ dhelont 



AnuDliruddedd , 
Anunhruddlneb 
Ammlirudd- der , 

AmpTudKdfr jw 
Umw or a. alher 71 
AwiTnh rwyati, nn. freedom from care or anxiety. 
Ammhiwyatledd, sm, non-convnlsiTenesB. 
Amwihryd, -ian, »m. unseasonahle time; a fast. 

EraHh irwj bo«ni ohonont eu hnn eu ajijih dnry wiiiKw 
$c anpryiiiiin, ft Ih&uuriKU ajt flu cytpb oe ZxhUi. 

K.cti=r,l98. 
Ammhryd, a. unseasonable, untimely ; not at 
the proper or right time. — M.A. iii. 126. 

Pump rinvBdd offeno ml rot 7 rd hTim. . . BU r* 
DUdden ij vwrt amrgi or lul 7 BJlTOd. 

SkimceidaM Oyrnuuto OJfrm, WS. 

BV it d7 mrt iHrvi 7 dTdd 7 

Ammhrydar, fm. freedom from anxiety, care, 

or Bolioitude. 
Ammb ryderu* , a. not anxious ; free from care 

or golidtnde. 
Aminhrydferth, a. inelegant, anbandsome, 

ungraceful; onbecoming, indeoent ; ngly. 

A ITaslswl taetbawl tontliaiii amfir^rrlk. 

T Mat Omi ■ U.A. 1. ISfi. 
Ibe gwniddiwi 7 blodan mwjtt dewixil, pu mdi «a 
goaod yn 7 lUwr, yn mal u ammliriid/rriA. 

Ammluydferthedd, am. inelegance, nuhand- 

somenera, uncomelinew. 
Anuubrydferthiad, -au, 

elegant or uncomely. 
Ammhrydferthrwydd, 1 
Ammb ry dferthweh, ) haitdsommieBB, 

comeliiieaa, ungraoefuhkeaa ; deformity 

decency, 
Amwihrydferthu, v. to render inelegant, tm- 

gracefnl, or nnhandsome 

deform. 



AmmluydiMl, -au, •«>. a rendering out of time ; 

a becoming nnaesBonable. 
Ammhrydiwr, wyr, tm. one that does not 

keep time. 
Anunhiydl&wn, a, nnacasonable, nntimdy; 

being out of time ; ill-timed. 



L TT hjuf a ddTsiuo. 

£lu Wtnm: Rlu B. e. ii. e (US). 
Angai ammliTydiaictt, untimely death. 



Anunhrydloui, tr. to render out of season; to 
make untimely or unseasonable. 

Amiwh ry dlwyd, tm. fleabane (Srigtron). 
Ammhrydlwyd rhuddlaa, blue flcabane (Eri~ 
gervn acre).—H. Daoiet : Welsh Bot. 78, 154. 

Amnoiiryduaf a. unhandsome, uncomely ; un- 
seemly. 

Ammliiydusrwydd, «in. uncomdineos. 

Ammhrydwflddol, a. ill-looking, iU'tavonred, 
unhandsome. 

QofTDWTd i ddrn twutkr^diH^d^ luwBilli, pa 97Mf a 
ftUii roddi un fud D&tur in&i el ffnrila racir atit- 

itryMin,{L ISO. 

Ammhryd weddoldeb, tm. nnhondsomemesa. 
Ammhrydyddol , a. unpoetical. 
Ammhrydd, a. not rich or luxuriant. 
Ammliryl&eu, a. unwieldy; vast, huge; very 

great. See Amri/Jlett. 
Ammhryleu, «m. utteruice, speech. 

^ameut s ffurvnit ttjrl ■■"^*" 

TrtVBtra ampryltu genfla s. gmu— L'unadim.- H.A. I. US. 

Ammhryaur, a. 1. not diligent, busy, active, or 

2, not sedate, sad, or serious. — 8. W. 
Ammhryvurdeb, ) *>n. waut of activity, expe- 
Ammhryaurwcli, ) dition, or diligence ; free- 
dom from haste ; absence of serionaneN. 
Am m hry uriad, -an, tm. a making inactiTe; 

a not hastening. 
Ammhuch, a. [puch, pucho] free &om earnest 

or inordinate' aesire. 
Ammhur, a. impure ; full of dregs or refuse ; 
dirty; unclean. 
Hob BTUydt 711 rdt ni7d oMjwar 
A.luibw!bot\MhjtiBiaampiLr.~-CymlMK: 1LA.LMS. 
HI ddyUi bod gxir yo niiMJtar OTmiug, Hf TS with- 
trjaub i leithiwl me iawnbwyll.— Qi^iiuc* f Btirid, 11. 
Yd IdI, heb w7badiKtb Bar, 
Yn btTmudd, 71L bol divmAiir. 

Icman Brtdfdd Hir: Omitll, St. 

Ammhurdeb, \ . „ ■!_ . 

Ammhuredd -au, '?"■ ^V^^> impnrcness; 
Ammhurder, -au! ) ''™™°«m, foulness. 

Petit ym IChuii am^'liiindd riddfui. 

UgtBtlit, Otclt: M.A. L aa, 

A phs meddylkj ef« fryntsd 7 Kithuh a'r oMiiJtimilil 

■7dd dm erooiea deg. ni mddAi nod yi4iydi> Kich «nio. 

Dr. JetLK l)amUt: Llyfr 7 Ba. II. fiL 18 (ot. tl). 

Ammhrf,'/ ■ j "■ "^ '*'""*' ^^' " °^*°*«- 
Cwyn ammhol, an urgent plaint, suit, or action. 



jM.v_.(,K)t;ie 



Ammhwyll, -ion, tm. lack 
tion, imprudence ; menta 

Uuur donjr&iie ditlAat 

Englwnm I Otyvi! U.A. 



Alvch ammltwsU i'r ^wir Di 



oliTiiunTdiL 

HV ' nlman. lUuigixteg, II. 

AmmhwyU, a. wantiiig reason or discretion, 
indiscreet i insane. 

If i dli « tlw th avinh-Kjin, ■ thithan r 

\BOB.—GlKirlaidteardt: Bui. T Ffjrdd, 77 

U^nu'r imifi'iliaiil a lonBuit fj mua i. 



T nua ajudlisd crtlimiliaid ^ TutuiD llT^redl 
meddwl dyn i phynnTrf an angerdooU nntrnvyH eji 
■ ehyfeiUomi.— <?*ai*j iaiMrtti.- HuwurflTdd, 






dm. irrationality; insanity, 
devoid of reason 'or disore- 



AtmpTiwylled d, 
AmmlHrjrlldar, 
AnuKili wyll^&r f 
tion ; mad. insane. 

AehlTwrfainiMFthEhlttaOai , , . _, 

CgaluBBdrK a wiuetluLDt j ddao trwin ammkwjiUovr 
jm, . . Cima a wnaetbant. a mnted Tn obyn j ddaa 
trenm anaJnu^Ufar.—UlB Jf«. 193. 

Ammliwylliad, -au, nn. a becoming or ren- 
dering iiTBtioiial. 
Azomhwyllig, a. inconsiderate ; indiscreet ; 
foolish ; irrfriional. 

Mi bafaf iHch wjntjAa gan genedl cU rw genedl i ml. 
a cbaa gaud] nHiatHf Uijr ['giieU. ynfyd, ffalj y'ch difciit. 



AmmlivyL 
mentalff deranged; to become irrational, 
Benselese, nuul, or insane. 



>a HB brnnafr ai dmrnAvy'^TrydTin. ID 
ra eia pwyll yr ydTin, i <*wf yr ydyu- 



id oedd fl^ «flo dim o* 



IS (cf. I Tim. Ti. 4). 



Ajmnhwyllog, ) a. irrational, unreasonable ; 
AmmhwyLlua, ) inconsiderate; mod, sense- 
less, insane. 

Gan DA thairaot i dywedyd Dad ydya yn nneiittiar dim 
jn ein pUOi ni mtira Oefn, na gweddeldd-drB. ttthr bod 
pob vtsai Jn amtAmgtlu^ ao yu b eD dn n nwrnrgl. 

Hmt C^n : Diffyn. iL T. 

Ammliwyllogrwydd, ) «m. inconsiderateness; 
Anunhwylliurwydd, j irrationality; sense- 
lessness ; insanity, madness. 
Ammliwyllol, a. tending to irrationality ; 



Ammhwynt, -iau, sm. sickness, illness, indis- 
position ; an ill habit of body ; an unbealtby 
constitution; a bad state of health; un- 
heatthinesB ; ungeniality. 
AdflBt fy nolur iddl. 



Fal Da bo tally rba^ llav, a Hid ag at aefydlu beddirch 
TT fifclwTB, a darostwng yt ajukbymiaQraa preaennDl a 
odyrwyudaiiuit amom tnry anHAic*^ yr anwoedd, ouii^ 
tudd mavrhydl'T bnain. — Aei Un£vrfijid 16flS. 

Bn ttrm boU y^nbUid a g^wtbfe a nefpoh Ynyi 

Prydaln, aoluM nirbanlaetli ae ammJnpjpit ac ardynuDflr 

aflaah yr falD.—iMo Mh. 40. 

Anunhvyntio, v. to become indisposed or mi- 

well ; to fall off in oondition ; to become 

Ammhwyntua, o. indisposed, unwell; «n- 
healthy ; sore ; not in good condition. 

Mcddfgm UyJ4fiii', ti. 40«. 

Anunhwyaedd, im. imponderonsusos. 
Ammhtryaig, a. not heaTy, imponderons; un- 
important; unemphatio. 
Ammhwt/tigion, imponderables. 
Ammliwyaigrwydd, | am. want of weight or 
Ammbwyineb, j importance; unimpor- 

Ammhwyaleiaiol, a. unemphatio. 
Ammhybyr, a. not vigorous or energetic ; 

infirm, impotent. 
AmmhybyTol, a. rendering weak or infirm. 
Ammhybyru {y). v. to deprive of energy or 

vigour ; to be impotent. 
AmnUiybyTWCh, tm. look of vigour or energy ; 

impotence; infimmess. 
Anunhydraidd, a. free from rott«nnes8 or de- 

Anunhydradd, mi. freedom from corruption; 

inoormptnesa. 
Ammhydrol, a. free from decay; incorrnptive. 
Anunid, -iau, wn. fbid, mid] an enclosing or 

surroundinK fenoe Or hedge; an enclosure, a 

fence, a hedge. 



[min] bordering ; abutting (on) ; 
tonching; conjoining. 

At hull tywyHogyan kyt o»ainojjron ao ef ae herjrrynynt. 

Tiroedd anminiog, abutting or bordering lands ; 
lands which abut on some other land ; lands 
on the borders, 

Ilhot Amminiog. an upland district in Cardigan- 
shire BO called, wlira« several parishes abut. 
tm. a borderer; one 



dwelling on or near the borders [of two conn- 
trios or lands). 
Amminiogau tir, land-botderers ; borderers; 
in the Welsh Laws, witnesses in a cause for 
landed property whose lands bordered on that 
in dispute. 

Sef jn flr*>riijrojaii gwjr a jynarfo tomyneu en tyr »r 
tyi y bo haul ftmaa; areyU a dyreyt esellyr keydwiyt o 

lyflsaf m amhjnaDWH « tyr en kwTlwtfrt. 

Cn/nilAtau Cemn; li. 181 fCt. Ml, IBO. XB). 
Tt argyred hvna adanffoaet yr Deb yd^yt ydan^oa, y 
anHiiMfni n>. M y Bwydogyon jraiglwyd. 

Onfrtiliiau Sl^m, U. 460 [ct. «»). 
Y nrtioo oeddynt aaill ai pwybyddiald. aef ihal trig' 

7 tir ; al qnMHuiEflfau. Hf Thai yn byr ai ffrfflniaTi y cwm- 
mvd nnj j tir mown cyfruth : a gwell ct« oedd i dyatlol.- 
aeth ammtwioffati na rwybyddiald. 

OmUlUr Mrduif : Owaitll. 11. ISS. 



Jm V_.(,K)t;iL" 



AmdHioaDtK 1 

Ammltiiogdir, ) -oedd, am. »buttmg or adjoin' 
Anuninioctir, I ing lAud ; l&ud or Iati^ oi 

the borders ; abuttals. 
Aflunlaen, -au, -ion. sm. [blaen] tbe forepart. 

C>vd ptu (Hth dreio bydyrfmaUi hr 
Tt ^[eu goteith Beannni 
Oft unlijrl un nniim denln 

Pri(d(~M «^c*ai. .- M J. I. aaa icf . S70|. 

Rhiff pob dnrr mmlira inv^Kia drrthyll. 

A^ydd^flm.aii.- rf,A. i. 4« (of. WT, MI). 
AmiolaB, a. tasteless, insipid, without taste. 
Ammlaau, ) u. to disreliah ; to grow inaipid 
Ammlaaio, ) or tasteless. 
AmmltMUarwydd, «ni. insipidity, taateleesness. 
Ammod, -au, am-/, [famfod (cf. C. amboi): 
am-+l>od] 1. a corenant; a contract; an 
agreement or compact; oonditiou, stipulatimi. 

T caiteUwTT mdy' 



. , D--J- - — 'J jlidrwTaBWmelora 

Trr J kfrif A phob peCh or eidyut yn iach. 

nidoaregwydj: 



O DT chymuil Tr avnf aimw; 
1y»,— V«*™i dt Carpil Wn^o, i 

Ac wedl Aj^rrAyt o Yndnt Hip er amadrodion henj 
tditar vD kaa Catw^lawn e dechteuedle amiwl tiwnw. 

ttntl Or. ab ArUlur.- H.A. ii. STO. 

AmmBdtiijtMeait. 

Uga WiMicai, n. rt. 11 (cf. C.C, i, 13«; U. 6601- 

Pwy binuiAg a mel aomnij deddtairl I'u gUydd. doed 7 
ddmo KmfodwT yng nghyd, b dyiwdmt en Aom/od tid y 
mynnoit ei vibeuuiiir, » rhodd«Dt yn llaw yr uafodvyr 
ndir yr amfod ax y Uon ei baddawiuit.— Pob dadl yn ai 

Dodi ammod ■mrum llyihyr cvdfod, to put a 

covenant in a lease of land for a term of 

years. — Yitatud lihuddlan. 
Dim ammod, under oondltion ; on ocmdition ; 

conditionally. 
Ui H'lh oUynnf dan yr antnuMi bwn. 

1 Ann. XI. 34 (d. 1 Bun. li. a). 
Dvfyn ar ammod. to persuade to an agreement. 
Ammoihii, conditions, terms, stipulatioss. 
Ammodau Jteddwrh, conditions of peace. — 

Lac xiT. 32. 
Tir r/r Ammod, the Land of Promise.— 

Marchog Crwydrad, i. 1. 
r<>nw aminod, a covenant-breaker. — Sha/.i. 31. 
Owat ammod, a covenant-servant ; a hired eer- 

2. the time of bringing forth young (used of oowb 
and some other ammala). 
T mie'r (owch ar ben rl hnmnmHs^aheaei hiiJ,srbm 



c. , but in the modem language 



Modd ammodnduiy, subjunctive mood. 

erdawodadny: yoyntaf abertb- 



Ammodedig, c 
junctive. 

Modd ammodtdig, subjujictivt 

Fuoi nodd peinryddiad j sydd ; lu 

pu faneger pith ... an a>"-~t-<'" ■ 



"■E,S 



I>»iiiutb,'M. 



ChwKlL modd beif yaydd ; nid amgoi . . . amwttdtdiff 

pu unnuter pMb.— Dr. /. D. Skai.' Oram. ft. 

Ammodi, v. to oovenant ; to contract ; to enter 
into a formal agreement; to agree; to promise. 

ATanry vylchwjL a dywawt Tal hyn. byn hep of ■ 

> , _._ __ ,„^odef/t a tbydy. bm jti tirnny ^amri 

- ynp Ptydsyo wrtii dy kygbor 



i(r EaanlLidi 



rik.^: A.i. 



fabAi 



1 Bhobert 



Ammodi, v. [am- -^- modi : of. ymmod] to move 
or stir about; to move, t« stir. 
A Crvion Ba«b mab gwrHlwD Laufair ynffyghaer fiinton 
yto Mowya a loe* hi lanmioilJ j pair. 

M,Mi,a}um. m. 833 {at. U.A.I. 17). 
Aminodiftdi-BU, tni. acorenanting: stipulatian. 
Ammodiaeth, -an, tf. a ooTenanting; etipnla- 
tion ; a covenant or oondition. 

rt hvn a ddangoaodd Dmll 
soiiydd gfdr broD Duw- 

MareKog Cnegdnid, iii. 11_ 

Ammodol, a. conditional ; hypotheidcal ; con- 
ditioned; covenanted. 



'r Manhog, i wi 



CbTennyi^n heddwcQt ru ammodol a ddylem ul. 

Jfwu Cx^i.- Diffyn. tU. 4. 
Mholedigaeth ammodol, conditional election. 

Fe bnaaai 'Ual«fi>acU yn amniidsl, bnaaal bwriad Dnv f 
oironfddn e( raa yu^i oghadvedigaclb peiAaduriaid yn jm- 
dajbyno, mewn muor mawr, ar ewrlij^ dyn. 

Ofo. Leans : IJiych Yagr. 7t- 

Modd ammodol, conditional or subjuuotiTe 
mood. 

Xo4d ftmmodol a arwyddofl beth daji ammod, cymhelllad, 
nendyb-o»odiad.--BDi«-( .OmiM.- leith. Cymr. 11. iiL i. 
Aminodoldeb, »m. oonditionality. 

TrinmiM>y/iiUi'»yHyddarbrydydd; cynnaliafthyCymryf 
cynna] ouf aohau a neithiorau; a chynoal eot addyoK 
am fniniau a gvybodan oetwdl J Cymry. — BarddA*, ii. lAO. 
Ammodi' w y til, -au, tm. a binding contract or 

Oan fud eto fwy na banner ^ji ollyiwdd o'r ammodrv^m 
beb ddyfod i beo, 1«iiiilodd y meddiannwrr . . . ed bod yn 
gpUnH iddynt adaol I funnd fyned hefbfo heb ymdncnn 
ail gj-fodl y gnleQdy. — C}flehgrnwn^ I. TJ^ 

Ammodrwymo, v. to bind by contract or 

covenant ; to lease. 
Anunodus, □. conditional ; hypothetical. 
AnunodwT, wyr, em. 1. one who covenants or 

stipulates ; a contractor ; 



.— rnfrrW<iaa Cgmn, L IS 

2. in the Welsh Laws it is sometimes used for 
one before whom a compact was made, and 
so admissible as a witness to prove tbe temte 
of it ; a person chosen to witucss a contract ; 
an arbitrator. 
O derfydd i ddyn wneutliU' ammod t'a gilydd heb oia. 
nutdKj/r yn y lie. a'r llav yn eu jilydd, a'p naill yn mynn 
gwadu, niddavarna* namyn eilwei hon j'wirsdn. 

L'gii WoHfeM, II. vi. 7 (rf. C.C. 1. 1S4). 

Anunoeth, -au, im. [moeth, pi. moothsu] a 
dainty or delicacy ; a junket. — S, If'. 

AnuDoetliun, pi. anunoetbau, sm. a dainty, a 
delicacy; something rare or delicious; atrsat. 

Ammo«tl»ui, a. dainty, delicious ; delicate; rare. 
% This is the S.W. pronunciation, and is pro- 
bably the correct form of the word more 
usually BvAt ammeuthiin (q.v.), supposed to be 
derived m>m Tnaeth. 



AUHOH I 

Ammon, am. [bcu] he who or that which is 
witiiout origin or Degimuug. 
Nid bon ond amToon, ' nothing out be the stock 
from which eTerything springB, but that being 
which never had any stock from which it 
could have sprung. ' — lolo Morgantog. 

Ammonedd, »m. Ittck of lineage or pedigree; 
want of nobleness of birth ; ungentuitj ; 
ignoblenesB ; ill-breeding, rudeness. 
Bdiv Hi huifonoliut, u achllv iddi ei AmraiM'fM, 



Ammoneddig, a. ungontoel ; ungentlemanly. 
Tri mjuddvynda anf erth &il»bdTii,aca^idjfetlivitrD 
y diwBld : didwll ; Uid ; « glylbliwb ; tbtg ammannUiad 
jrermwddtau hrny.— rritnU£iMiAiiuft.' H.A.iii.!8i. 

Anunor, -au, ma. 1. fortune; luck; snoceas. 



In bwl heiidd ddau filwi- 



™4tr 



i-IyiKlyn (?w4.' ILA. 1. S 



GvaOur MtdialK : OmlUi. i. 1. 
il The relations of this word are not obvious. 
Pughe writes it am-niawr (deriving it from 
'amp, calmness; serenity; pleasantness'), 
and explains it by ' calnmoss ; pleasantness ; 
loveliness ' ; but tne existence of amp as an 
independent word is questionable. It most 
commonly occurs in the expression \avjdd 
ofRmor or haxaddammor ; hence, with omission 
of the epithet, 
2. a wish of happiness; good luck or fortune; 
success; a blessing; welcome. 

Am frdd. ddydd ■ ddiw, 

lUwreSdoe, anwiof IddiWi— ffroiiKr, Ovaa.SK. 

Er hjny amivtr iddo mm d eryllya da m'i ^ohftd iVUitli, 

Tn'maiiiirdieapaiaD "°'°' 

Prrdain oU IV arf oHl. 

Avmnr hawdd, I'w mduTdd, wl I 

Dnri W^: Blod. Arf. M. 

Ajomor, sm. [from L. amor. love]. 
Blodau amiMir, ) flower gentle [Amaranthm) : 
Uyaiau ammor, { a partial tranBlation of its 
old English name fioramor, ftorimer, or jiovxr 
omour (Pr. fiear aamour), a name which ap- 
pears to have been formed from a misco 
ception of its Latin appellation amaranthi 
as though a compound of anwr, love, and 
anthut, a flower. Floramor or Jiower at 
is sometimes further corrupted to flower ar 
Cf. Tusscr's • Husbandrie ' (od. 1S78), 95, 273; 
and Prior, 'British Plants,' s.v. Being the 
L. amoT the Welsh term should have but one m 
{amor).— Hugh Davie* ; Welsh Bot. 133, 159. 

Ammoraidd, a. pleasant; beauteous. ^ — P. 

Ha ! hoffed Riredd J tn ammaraidd turn ! 

Cain a blodionoa, pn el tiadsr lion.— Cisnul, U. U6. 

Ammoraidd,a.amaTaLnthine; fadeless; undying. 

IJ« trin eicb luiwrlioo nuatlL 

Lie tyfammioFViitd wull— yn imori i ohvi ! 

BUida. iMaitc, M. 

Anunori, v. to become pleasant.— i*. 



Ammorlya, am. flower gentle {Amarattth«t)= 
Blodau ammvr. 

AiDArmiithw*, ammcrtnt. blodmu unmn. 

KmU/gcn Vfiifai, sea. 
Ammraint, mreiniau, mreintiau, am. I. that 
which is against privilege, right, or immu- 
nity ; privation of privilege ; a breach of 
privilege ; disadvantage, detriment. 
Ac ny deruf bytti o bynn allui j eglvyi Mat Eu) yr 

Trivyr j rhodded hvy &'u hcpil byd y byddaf bjd dan 
Dwibuni eUjion. — Trioftid-- M.A. It. 7i. 

Okd nu galUl'r CymiT oddef na mhelluh yi utghyf- 
rsith, a'r ammrainl, a'r trahao^ti, h ddodai'T Ffiancod 



Fe sU bynr fad ys ammnii 



pob tordefod.— iMiin». (H.A. iii. 14T.) 
2. dishonour ; ignominy. 
mmraint, a. unprivileged ; without privilege, 

right, or immunity. 

Sev ni wnm wr yn tDHnrohf afl jn uumvvd ■ vo pflnhcD 
tenia.— Cit/rnlAkiii Ci/vini. ii. OM. 

Tri pbelh ^nvnrabtf 1 fardd ymdrAfod i hvynt, can nad 
tawn y peChan hyny iddaw,— SnnMiu. ii, W (cf. *8). 

jmnroB, mreision, a. not fat, rich, thick, or 

large; thin, lean. 



Caiq cbvHTt o It'fritb. a obeinJoffirfrth o arilee, a phwya 
nhwy a berw yn y lleTrith a'i biaio, a'i yfed toT y gnUn^ 
ac anBT o uilcg ^yda*tJi fwyd, a byw ar fwyd ammnt ac 
anbailt. — Mrdd/fgvn Myddfai. ii. 330. 

Ammrawd, mrodiau, am. [brawd, /.] what is 
contrary or opposed to judgment or law ; in- 
justice; wrong; an illegal or lawless act. 

Tair gnmua a ddaeUiant ai Yiiys Prydain, ac a ddsrfa 
cjDUf trsiDGT ; yr ail o wyitofaint 

v.:.v ,^ leymedd. 

iii. te ict. Bd). 
Oamrailamndatdiara.— CiiwJiMiF: M.A. J. SSO. 
Tri gal oTydd Tnyi Prydalu: (HI Ofrdd Orddlawl; ac 
atael mab Adnm \ a Tbryttiui ab Tallwch : a btsfBt 
Idnit dIb gell^ a cleC yn en Lerbyn 11b byona^ y mynnynt 
a Ynyi Frydaiji byd nad elynt yii MKmro,iad. 

Triotdd l-nj-. Prfdaat . ttJl.. ii. S3. 
Svyddawg nranntfldig o syfnutb yo dalTar llnnlaelh 
Dg nghyfcieth ei argiwydd, cr dyspwyllaw barn, am 
ynhenan, neu ammraufd, mcg^H srminud dcb wrtiiladd 
rfnitbiau y broiiji.— J/^1. ArtJt. Iii. 281. 

kWd, a. contrary to justice ; illegal. — 
Ct/freithiau Oymru, ii. 636. 
Anunrawdd, oddion, tm. [brawdd, brawddeg] 
circumlocution ; discourse ; conversation. 
A threuyt herwyt hcnryr wrtM nyd moca 
Ac nyd DOB eianycca eiwycu yndi 
Vamyn beirt a bsirt a biLrtaiii 
Namyn.hct a met y racwo UeeOri 
Hamyn fauwt amr^^Et yii ymroCi a bart 
A ffwyr boH beb nvt bcb galedi. 

Uyicityy F-rdd: M.A, 1. 898 (c(. «8, 241). 
Otiriof , cynnyiiar f%at 
Amiintviid am annwdd y mta. 

Aoien Qicmi,* 0Tslth.n4. 

% Amraud, in the expression itamraud {gl. 
mens est) in the Codex Juvencns (78) is pro- 
bably the same word. 
Anunreiniad, -au, im, a depriving of privOegc 

or immunity ; disfranohisement. 
Ammreiiuo, 1 v. 1. to deprive of privileges 
Ammreintio, J or immunities ; to violate pri- 
vilege; 1« disfranchise. 

T oawdd • aniiraiiuM e'«, Di ddyly o hOD) on Diwld. 

2. to dishonour. ''^ wMi.«. 



,)glc 



A wiHiB^ ai 1^ j^w , 



■. onpiiTileged. 
unprivileged; eDJojringD 



Bhtii I'l hji adraodrd un duo, i 
r dnrsCo heb ngtaxa, u heb feddi 
cr«Trdd, fto i ddTyn lunmharch mjibMt 
ed hbUefwyr bl.— (rmt Owm. lae. 

Ammriw, a. [briw] without a cut or wound ; 
unbroken ; unimpaired ; whole. 

Fml hrn T duYu d^dd RhuMn beb ndiwl gTmnumt k 
ehot amriv ei beoir u- r ddmlu.— Cirimp Mn/att. 

Anunriwadw7, a. inTulneroble. 



m dyn wai wiw. — ffvw C« Liicpd^ 

■ion, one that ia not a natiTO or 

original inhabitant of a country. 
Ammrvdoritm, non - aboriginet i foreignen; 

strangCTH. 

TtI moiwedigian Uyraedd Ynn Frrdaiii . . . CtdnUdr 
Fendigud s roddu oswdd 0*1 diroedd si bull dduedd ei 
ban i'r ffyddlmiAld ■ ffojmt rhu r Saeaoa dj gni H'r hm- 
mnidDri^iLtJ^uuiteull&dd.— IVuhM.' ILA, u. 6S. 



Cig ammrwd, raw flesh or meat. 

Na oaod ij letty 711 *«» i'r ra«dda 

8r*a Uj'hou {gnie Qjmra \] gig ammned. 

Ed. Uiikard: BngeOBSTdd, U. iS. 

I niEa Bratu Inmmwi idaw bot rn weL Kmntint pnawil- 
Icir Ini dileiUi oe impnrUi vel eafveiUait mt sic .inniV slyaeu 
ffyta ridit. uoo imporUi ini kiTumedflii iokikfel ffvled« du 
gellUweC— »iu ffr. oft ^rtitur (A| : M * il.se. 
F/rwytk ammrwd, raw fruit. 

Ebai yn amrwd mewn owd cod fn d mynmL 

Anunrwyd, -au, »ra. a fringe, laoe, or border. 
Ammrwyi, i. and a.^^mrwy^. 
Anunrwyag, a. not drunk or inebriated. 
Anunrwyigedd, *m. freedom from intoxica- 
tion; sobriety. 
Anunrycheulyd, a. spotleM, immaculate, stain- 

Tri pheth ni t^ddEot amnr^ etnj^d : dwyUw J cHHliBD- 
Tdd; olwyn mfin ^ b'rnnft nolyno ddrwv ^yfeiiiiich. 

Trvtid: M.A. 111. KS. 
0th Bud fmrodlini fal y gwedd 
1 tuobedd Ammroelitvlud, 

Ir^Morgm<i,g: Balm&u, I. llTfil. 1 |ct. U. ml. S). 

Ammryd&idd, a. not fervid or ardent. 
Anunrjrdedd, nm. la«ik of heat or warmth ; 

Ammwlch, mylchau, nn. [am-+bwlch] I. an 
opening on ajl aides ; a retreat. — P. 

AmlwG 7 Hif J waiwj aal dar 

Amvlth gled (loTwdnit yg wy»r 

Amoith CHt nrd ktnlMr nyw lur 

Aiajl y lod oe uod y ur yi rydrwm.— Jlini. AreX. i, ISO, 



2. opportunity. — P, 

NI Oatmt 711 ry awnnricl. -iXurrf. {ICA. lii. IdS.] 

^ Davies, adopting the explanation of Qwilym 
Tew, aayi : ' oui nullnm meat indie, integer. 
Ab an A hwtck.' Walter* and most modem 
lexicographers adopt Davies's exiJanation. 

AmmmltH, cyflUI.— ffnrI|(Afn> W. CymiPBf. 

AmmwT, 1 a. [am — J-bwr, of which ammurl 
Anunwl, ) seemaacorr.JcircumvaUated; sur- 
rounded with a wall or rampart. — lalo Olo»~ 

Ammwyd, -on, am. [mwyd] the soft part of » 
thing; pith. 

IVi diTiialani medk ynt: bmlb yiffymaiit, a bnth 
ammwtdon bronn, a plun Klin. 

Middffon Mfd4^ L 4G ic<. IM). 
Anunwya, a. [mwyij^^imicya. 
Ammwyth, -au, tm. [mwyth=moe(h] a c»- 
rouBal ; festivity. 

i^Swrdl ff«.- H.A. i. 108. 

Ammyllt, «m. eamphire (in some parts of Ola- 

morganahire). — loUt Olonary. 
Ammynedd, tm.^Amynedd. 
Anunywydol, a. inanimate, lifeleei; dead. 

I\Lmp rryranbia j lydd. kc o hunynt pob peth bod ■ 
byw, si bywydol al rnKmsnuj/dal j bo; nfd amgoi, oalaa, 
frvyar, awyr, ufal, % nwjfte. Uivw, mt tm^srtnditt, y 
pedwu- f^^ui, s byv y piimiaed ; u o*T punmud. Daw a 
phob bywydoldeb.— Sarfdaj, i. 380 (cf. SB). 

Asunywydoldeb, am. lifelosaness, inanimation. 

Amnabod, v. to know; to reoognixe. 

Hep nmgmaHbtfl {gt. liiia mente^. 

OiJ. Ulcu.a. 88 (SeoM, O.C lOBB). 

In the g^oBS it may be intended for a noun. 
The word is not known to occur elsewhere. 
Amnad, a. [nad-ael] keeping off on all aides. 
—P. 

Yniyddad amnad b«b «h t aond. 

falumm: U.A. L Kl (of . 88) . 
Keint annul am dins [at. diva] dy gell. 

Ai^frix! Gododin, 701. 

Aninad, a. [nad, nadu] loudly shouting ; * that 
proclaims all about.' — P. 

DyfbnUav anav r Turig dawn 

Nu card cyrd am*n ■' angbid aiubniwB. 

Ct'ddiht.- M.A. i. 8D«. 
YDgbyTfeiyf taryf t^tirf bhuuU 
TngbywvotkrvDOtkM.— C^dMv.' II-A.i.M2. 

.^tven amnad, the jHOclaiming muse. — P. 
Ardwynin ty nbad el fralv frndiindad 
AranoaiiwKlalndiiwfna.— CHlet<H<.- II.A.i,19S. 

Amnaid, neidiau, im-/. Tnaid : cf. L. nu'ua ; B. 
noif] 1. a beck; a nod; a hint given by a 
oert^n movement ; a hint or suggestion. 

Oif. aim. ii. K (Zna, G.C. IMS]. 
O glywet mjntt ymeiniii arga* 
Aimrii gorwylH gwae ym ncot BBTwin. 

RUwri;..' M.A.i.M8(ot.mi). 
Del* a gymerii jn eHau pbnniadigaetli o TJW niuit a 
dryih y duwjolder jKydh yn y drindawt.— i*<i*tr, | Ifl. 
Ac ar UD ammek j Uonyeitiiynt ell den pob peth. 

aaHanmliut PiUUut, (lI. 
Qvylis yno gael annerdi, 

C«i» n»inaid ar raiaid (eni.— D, o> OwUrm. Ixtt. ta. 
Efe a roM amiKT.rf a giyn arwjddocid I un o'l gsalyniryT. 
«r>l..: NWdL,liT. 



mi'wlurfaTd 



Amfiaid 3 llygad, I a aign or hint given hj 
Amnaid llygad, ) winnng; a wink. 
Bwrw amnaid, to tlirowont a hint o 
to bint, to auggeet. 
Ac nid hvyiuih lud yv bja jn bvne aw 

ejrmniedii>Web»'t sihanrn^ jrtoedd jrgwr h 

ym mhob petb. — /ernti OtBftt, 101. 
Bierw amiiaid at un, to beckon to one. 
Oumeuthur amnaid i un, ) to beckon ; to beckon 
Rhoddi amnaid iun, j to one ; to give one 

Qvmarth amnaid iddynt, he beckoned to them. 
2. command, will, pleaanre (of. L. nuiut). 

Ha«n a amntil Dnw j byirywyt wynt y poHhna ■ elirit 

AnuiAwdd, a. that defends in all directiona ; 
protected on all aides ; fully defended. 

BUU Hrflnwd immgd AsunwrlUg. 

Crtddelw.- ILA. i. MS (cf. MO, n7, at). 



T vthIkI Dyd hawt \ 

crBiddic: ILA. t. US (Bt. M8, 2te). 
Anmeidiad, -au, rnn. a beckoning; a nodding. 
Amn«idio, v. to beckon, to beck ; to nod ; to 
mflke a sign. 

£HKIia» [gl. innuoh—O^/. Oloa. I.S (Z«iu^ Q.C. IWa). 
Ac cMnnifiw umc ttIuIIh v Luoet.— KiiuiDyJin, 1. 1). 

(kmimu.— Bnu Or. oA Arllna': M.A. li. 380. 

.4inn«t(fio 3 llaw, to beckon with the hand. — 
Act. xix. 33. 

Amneidio 3 llygad, to wiiik with the eje or 
eyes; to wink, — Diar. vi. 13. 

Amtuidio ar, to beckon to. — Lvc v. 7. 
Anmeidljrd, a. habitually beckoning or wink- 
ing ; disposed to ndmicTy, itiimipal 

O ZBD ymddnlAd j oorff, rhald i't uvrithiwr gyiom^tjA 
goUl It iddo fad n wrwedd, K mid vn ammtidlgd. 

Hnri Arri: ^I. Pfr. xlT. a. 

Amner, -an, <m. [O.E. almimer, aurmener, atinmr, 
aimer; O.Pr. aumoruffre; L.L. a^monaria .- 
from Gb. 'iXr^fMiriini, alms ; the article origi- 
Bally agnifying an alma bog or purse] 1. a 
parse, a bag. 

Cestgilidgull 

QyaUoam cUirr awntr oiirai. 

Dil/ViU y CmI .- M.A. i. 496 (si. WT). 
Dtwrdrvrdd B whb 1 ddyn dMixr, a ChTmiildeb ■ rydd 
linyikui idiu). Ki cbjat jr aimer Iddo fife odim. 

T^tiwuSai^.- Ffwdd i Oyfoetb, » (of. IS), 
2. [O.E. aniTMr, au>ni«n«r, anicn<r,ii^m«ncr,' Mod. 
£. almoner; from L.L. a^Tnoatnariiu] an al< 
mouer, an official diatributor of alms. 
Amntr, B fydd yn Aboo elnaeDl dna wr buwt. 

W. Salaiurt, l.r. 

51 .Jmner (in both aeceptationa), altvar, and 
alawr are the game word differently modi- 
fied and applied. 
Ajnnerydd, -ion, «». a purser, a purse-bearer; 

an ftlm nnffr ; a bUTSar. 

Amneryu, -an, *t». a small pnrse ot bag. 
Amuesfta, V. to draw near on all sides; to draw 
nigh, 

Mb« dvddiBD'a bosB [ ben ju trsn, 
ICm't Bin i"!! tiBro yn amiiM*u. 



Amnifer, -oedd, rm. and #.c/. an uneven or odd 
number ; a great number ; iimumerablencss. 
Omunni ^iniBcaeixdi mel mnner 

CfnMtiK: mJa. i. an (of. us. ho), 

YDi«i«wdyT llFwyBwdTT Uyw amniueT 
Teynkoro b godw o ndamder. 

CtrnMriui: MA. L S» (ot. MS). 

Amniferaid, a. innumerable. 
Est qoi pemlOT on niiicrrii 
CoUant tfvUt netwr plwrf offeiroit. 

raJiuH: A.B. ii. 801 (U.A. I. Bi). 

Amniferedd, am.^Amni/triack, 
AmaiSoTOg, a. uneven in number ; abounding 
in number ; numerous ; innumerable. 

At wrneb iwubL jn amm^feraivc 
Netth Kodri rd rywMgBTBfn; 
CynmTiiedmDroedTndBwedawc.— Jtdlir.- H,A. i. IM. 

Amniilsrol, a. innumerable, numberless. 
Amniferwch, tm, unevenness of number; nu- 
merouaness; innumerableness. 

Xaoneaet unnBwt <nw><«CTwc* rU 

RiBiludiheMwch.— OdAJii: U.A.i.»7. 

Amnod, -an, am. a mark ; a token. 

Curd oei vsu aiijitd j drigTuir 
Dnjg Prjdsm lyll ngod. 

IJywarck li UimKl^ii .' U.A. L m. 

Amnodi, v. to mark about ; to surround with 
A des kjnwliit sslnt snwt UiBul 



■7dj. 



L.I.* 



aiking around; 



AnuLodiad, -an, am. 

marking. 
Amnoddi, v. to protect on all sides ; to guard 

all around. 

OwtUod teymon ttid avRotf 
Qolluthon dimffon dralo Enri. 

Liyx. si LlyiBtlt' : M.A. I. 381. 

Amnoddiad, -an, am. a protecting on all aides. 
AmnoddiABt, iannau, am. protection on every 

AnuLoeth, a. naked or exposed on overy side. 
Amnoetbain, a. exposed on erery aide. — F. 
Aiimo«ihaiiLt, am. esposnre on every side ; an 
expraed or denuded state. 

Am iHMMtHt (BmnoaUialiit] n ffWBrUuf naiit. 

Amnoethi, v, t« expose on every side ; to de- 
nude ; to atrip. 
AnULOethiad, -an, ) am. denudation ; an ex- 
Amnoetbiant, ) posing or exposure. 
Amnwyth, -an, am. [nwyth] pleasantry. — P. 



f Ammm/ck, in the subjoined couplet, aeema 
to be a misprint of tiie aame word : 
BoMta Ttbathynt amntTer 



Amnwytliiff, a. lively on all sides. So Pughe, 
who quotes the following pa»sage of Cjn- 
ddelw, the Isat word of which he roads ' tun- 
n-B^thig;' but as [jrintcd in the M.A. i. 208 
(without Tarisnts) it is ' ammuythig,' which, 
to all appearance, denotes the border town 
of that name (=: Shrewsbury). 



, on. a twining 



r twisting 



Anmycldiad, 

around. 

Amnjrddol, a. entwining roimd, twisting abont. 

Anmyddu, v. to twine or twist about ; to wiost. 

Amobr, -an. ] nn. [am- + gobr, gwobr, 

Amwobr, -au, fgwobrwy, gwabr] a 

Amobrwy, -on, -au, f oommatation fee ; a 

Amwabr, -an, ) maiden fee; a fee paid 

to a lord by a vassal, or a person subject to 

that payment, on the marriage of his daughter. 

' Tectigal, mercea foeminarum. pretium rir- 

ginitatis.' 6ee Davies's note, s.t. It is also 

called gobr maivh and gtmhr merch. ' Dicitur 

de pecnnia quie vol pro maritandis puellis, 

vel pro pudicitia Tiolata domino pendebatur.' 

Cf. Glossarium in Legce Wallicag, 554. In 

some caaes the fee was paid to the father by 

his daughter's suitor. 

Triohewilyd morwyn snyi : tb yw, dywednt 06 tli»t 
TTtbl ml aUirodeiA yvr ; eil fw pui el gjnw j wdr 7 
trrdyd jw pan del gya^t or g^rtily ftDpUth dTnyoD : 
T knitaf J rudir y htmabwr j Uuit i droi yr dl y 
ychowyU idi hlthf ■ •■ —'-' - ' *— — •■- 



r,s.' 



JI gm—Oji^rtMia 


Cvm 


n., i.M«(qf. MM). 


"\n- iTtfi heane vegis nadele itur Wlu Knen ™ ■bodyn «Bto 
henne nydcle giejfy talu omen TO amolior nnydoea yahy 
iibedyn nwDenoia^tw.— CV"^"" t'lmi™, i. W |rf. W). 


Dyro In dy nen^b 
MdwygaraL-JCa 


dtiK 


-, il. m. 



% The form in the Welsh Laws, allowing for 
variety of orthography, is amobr, whi<£ in 
medieval Latin documents appears as amo- 
brugiicm (tif. Du Cange, s.v.), and in ar- 
chaic Eng. as amohrage. 
Amobri, I V. to oommute ; to put one thing 
Amobrwyo, ) in the place of another. 
Amobriad, | -au, rm. commutation; the 
Amobrwyad, ) giving of an equivalent for. 
Amobrwyol, la. commutative; relating to 
Amobrawl, ) exchange or commutation. 
Amobrydd, -ion, -od. am. 1. one who commutes; 
« collector of fines of commutation; a col- 
lector of commutation foes. 
Meror ewyn ICadain ab Ueirelyn amalrryM 1 Kuri 
vivmn IJoegyT ar^wyod y «Ud hoD yn iwhymvd la Aled 

St Cftbin TBTch leuui ftb IJemJyn ab Maaan uohelvr 
yvadadto fjami yr hwn y ndd Kynmychiawl ar y bar 
nU UDfCBMh ewyn no idiwya dylcd nid untrmacb dyled 
oodflg nrllt wir Dm arnm o Twuai daoiawn vath nroDAiiv 
Edwud Tnoln TJcwyr a ddylyav t1 t> amobyr v dywod- 

2. a tax-collector 1 a publican (in the N. T. 



'.- Uau. 

Crist yn ladliiu'r dyn o'r i»rly» . . . Ef yn galir Lefi yr 
alHobrjittd.— IT. Baltthary ; Marc U. 



Amoed, a.z= ATmnorth, Ammoethunl 
Dial krbdc imvd bUa 
Am y kyrreu y mella 

OtbkairdyaaTTdiymibuewnia. — Gvfiilmo: ILA. L ISA. 
Amoiyn, V. to inquire ; to seek ; to search for. 
Usually written ymofyn ; but tiat form should 
be confined to the intransitive sense. 

i, Bolant yn cMsd gar j lair, us sauajn ao ef o Solaat 
flTw ffedernJt a pin rywjaledi luxd yny Ktiawt. 

rwrtfl dr CitreJi/ Mofiae, ool. 400- 

Ac yna y kerdavd ef ar drain teymaB Ffreinc J amtovfn 
Amlc y pedymdoitli.— .4fa/yq at Amig, col- 1090. 

At hynny llyma j m a rch airc yn dynot ma yn amo/jfn a 

nartdat.—MiMnafioii. i. asa (<J, g, t, s. u, m). 

Nachaf pedeir keiuiat yn dyfot rao brcnua j braibfb. ac 
yn Bmcuyi Babaot I'aD ^leu Sabaol y aamjni. mi bab 
ttrwjT neb yd yttymii yny amonjrii. —Boxm b Hamtum, ) m, 

Amolyu, -ion, im, an inquiry. 

T Ibrra b<nm a eilw Asi Amerr' DiHlpl aJ AUnm. 



Amofynblaid.bleidian, s/.andi.c^. an inquiring 
party; the [^aintiff. 

Doifliyf TT anutui/nbUit hrai aloob obvithen y mediaiiii^ 
"It hcrwya na wnaeth hyureitli It a»lwyd ranno wtb 



neb, emit trwy hati ir ama/ipitlrii m 



CK/rriHiau C^mm, U. 






a.jmomt]. 



UJl-iii 



A.B. ii. II 
Owae ben a goUo al di 

Amogel, v.^Ymoge 
Amolio, V. [am — |-ol] t« leave a trace, track, 
or vestige around. 

Ond T ibal hyn U lUnyn Ihunit blr 
FainEioli. gu a auJiau hyd y Uawr en tviiff. 

If. O.Pug^: CO. Tii. »e. 

Amolwg, ygon, tm. a view on all sides; a 

general view ; a survey. 
Amolygu, V. to view or look around ; to survey. 

I tylln anio yma newydd betb, 
HebbefnigiiflyDiawl; arlodapbdl 
Yr amoln"-- W. 0. ^ikt: CO. IQ. S70. 

AmoUid, -an, »f. cheering warmth. — P. 

Uab Llywarob dibauarob dyndid 
Mab Duv bef boed nartb wy rydid 

Ny myc rot yn rann edevid 
A mloben tmiKatin- otn dlUd 
Bot y Itaw abod yg gleiudid. 

i.Iy». at UyVKlya.- H.A. t. SR. 

% Pughe derives it from moll (f. of mioll), 
sultry, warm ; and ttnnslates it accordingly : 
' a kind inviting message will not create a 
denial.' Occurring bnt once, it is difficult to 
ascertain the meaning ; bnt the one given by 
Pughe is not very probable. Cf. ar/oUi. 

Amordiudd, -ion, tm. a cover on all sides ; an 
envelope. 

Amoroliuddiad, -an, *m. a covering all around ; 
an overwhelming. 

Amorchuddio, v. to cover all abont; to en- 
velop, to enwrap ; to overwhelm. 



AlfOBOmiDDlOL 1 

Amordiuddiol, a. covering or envaloping oa 

every side ; oTerwhelming. 
AmOTMtig, a. [gcvMt] open or wsste in all 

directions. 

y cbi hiA (Hi[»o D'i pblg.—Inuai BttMt, 
Amorw«ddol, a. oiroamjaoent, lying aroimd. 

Amo^re, -on, «/-m. [go- +yH- + (!re] an essen- 
tial ; an attribute. 

Ttir awiairn [al. tri TmT»n1 nob psUi : Mucr i U* ; • 
aUW.—TricaU BlHMut.' JtA. fii. MT. 

Amoagryn, *m. [gosgryn-a] sensation, emotion. 
O^ nfel T mu r Un, ■ pbob gmet ■ golenni, & phob 
Dfv, A idvo jmuwd AC awuMffrjfn.—Btrddat^ 1. 87S. 
Amosod, c. to plaoe, set, or put around; to 
■nrround; tobesege. 

Owed] hrny ete s ddrnniUH Qutell Clnnwr fwedi hir 
BntI Abrrp^ffVTm : H.A, li, DBt- 
o^ rtiai bTDiv r° amotodedig unTmlof'l ffyrdd, 7 dodc 



ifU*&ltaD 



y drnuAflff' — Barddiu, L 



nity ; pleaaant- 



H Davies inserts the word, and refers to lamp, 
at which he offers no explanation. 
Ampi»T,a-calm; gentle; pleasant; lovely.— P. 
II Not in Davies ; but given by Lhwyd {Arch. 
Brit. 213) on the authority of H. Sdeabury, 
and explained 'plaoitom.' 

rw gain tjg Bnia tagtin oethleddawg, 
T mae pompiaiuwff. ampwu bupyiuu. 

Stm JTvn-Blod-AH-SS. 

Amra&el, -ion, no. [oorr. of amryfai, or amry- 
fael] oontention, strife, variance, quarrel ; de- 
bate, dispute ; a falling ont. 
Ti jiwjt ju clyired tod amra/a^im vn eich IBjm diffi. 
1 Gnr. xl. 18 (of. a Cnm, xix. B, 10). 
Tori yr amra^ad, to break the dispute ; to settle 
tbe matter m dispute ; to split the difference. 
Amra&ttl, -ion, a. [for omTyfal] various; 
divers, diverse ; sun^y ; severu ; varied, di- 
vereified; different. 

Bwum T In a onu jn Tjdynoed ■ . . a fforcbrmjn 7 pavb 
o ludunt A onic Hndjaw BjtA jt ^TUcnudTgyDa y dyrot 
•mo . . . McervjUjjnilMaxii-wjAtrwjamraiiaelpefrytta- 
■WQ 7 ff^TTAv dcatfjw 7 ksftteu. 



IlTrisna bennrdd o bob aniVn'I iTilati chlnweddcd. 

MabiHigioii, m. asi. 
Afae:Ua Titora IhyaMUMdh M a wmuuftm InidB ^verUi- 



I>7lAi^ bAjdd kmndreiEi, HTCiAdfawr, ^yglrm, g7m- 
iii7a^*T amra/aelioit foddioa £711 or 7 cTiiffbtmeddiijp, «*r 
aiwra/tHfwq rjriviAii aj'bob cTOghAnedd, &'r amrR/o'/rcfl FTW- 
■B m 7T aoanioB, jn 7 C7(t7W todd w 7 !» amra/atl-'ba J 
afai I'r llafar 1 y gfudadketh.— C^'r'-i.uA v &>r dd, 20. 

T rtxu ft gcmned i nav anvjv^a' fun ffwyrUifawT. a Daw 
amra/arl Uwiaa, a Hair muni/iui rinweddan unTnt. 

efn bod nj ^ umfaeUwng, frwy eia J^ninv'dWloii 
£JlI/r SiKelcfi OnJjtdin [CTmmiill). 
T lUenrsB a ddvTj teddfriniaethaD smra/atlln rbag 
nob dolor a dd7t7dd o vandidaTi. 

XfUfBoo Mniijai, U. 767. 
^m™/<Mi ar, different or differing from. 

A Unma ddecbna Cadaic Hornnn, n atnra/Otl or 
CnJHiaci n Btirdd (Blia^dd. 10), 



b Bonld TuTi PrTdais. 



25 



AmraAtelgar, a. contentious, quarrelsome. 
Amrnfaalgarwch, tm. oontentioaniese, quarrel- 

Amni&eliad, -au, tm. a contending or quarrel- 
ling; contention. 
Amra&eliaeth, -au, «/. difference; variety; 
diversity; variegation. 

Ni ddylid rhoddi ^rmodd ftmcanian u- ddyobTQulITv, lu 

goTmoda dounydd yuddi, qa gnrrnodd patbau amiafad jii 

— **-^'' — *- — DAA gellir uwn-dr " 

■iMKA t Brirdd, is 

tm. variety; diversity; 



A wifft fa^^liftnt I iannan. 
disagreement. 

A cb7d bo imdiu a p)ioU 



■Crfi*~uh r Btlrdi, W (at. ^!* 
Nid oea un meanr jn gofyn ernniluti amn^nMiuU sr 
IT acenSon a'r erdd7gBD na> B7b7dedd lefn. 

Cg/riiiachg Bdrdd, 7b. 

Amra&elio, v. to contend, to quarrel, to strive: 
to debate ; to disagree ; to wrangle. . 






Tri nheth a imlnt lu ar gerdd : ann/«I> iutb ; an- 
r^adit myfjT^od ; ao amiafacl game ar f«sar. 

C^Tinad, f BarM. 4f [of. J8]. 



^m™/aeiin 



' oddi v>Tth, \ 



vary or differ from. 

crfreithiAU hwynt 



■ydd ya amrafaelio oddl wr^ yr hall bobL— KMA. 

Amrafadvi ar, to differ from. 

BHhi y banaa Msologko yn ann^/ula ar y rbui 11707. 
(7i(A>"'"^V £«rd<i, lU (at. 96). 
Jmra/iMiu lortft, to differ or vary from. 

GiFybrddlr ym mba betli yi ymrnftela no iii«flUT wrih 
tenia oral] Og/riwuh f BeirOd. 77. 

AmrafiMli'WT, wyr, *nt. a contender, a qiiar- 

Amrii&«lodl, ) a. differing in rhyme ; having 
AmrafiMlawdl, { different rhymes; poly- 
rhythmic. 

IJostodl, rasa loModTD, a f7dd pHii ro'r drydcdd nen'r 
Bdwarjdd ban o*r peanu] yn unodli Vr cbwKbed ikeu^r 



Amrafaelrif, a. of various numbers; differing 



Yr boa fraint a borth7n ar fegad o femron ; fa] y nis« 
amrsf<uiAf bauan, bcdalr bialch i nn ar bymthw. 

Cm-rmacA , BtiTM, 70. 

Atwi-afmlryTP, a. of different kinds or sorts; 
multigenerous ; heterogeneous. 

tiynolHrtli am 
o-inyarfrjm ar 

AmrafbeUain, seiniau, «/. variety of sounds. 

QreD 7W aoen aawaitad unjafealirw, a*i obyniniTig yq 
debTs i gin «a, yn llawn antni/aflHiin hTfTTdlak. 

Cn/rfniuA J Btirdd, 171. 

AmraffteUain, a. having many or varionB 

sounds; multisonoua. 
Atm-afmliia, a, contoutionfl ; quarrelsome ; 

wrangling. 
AKraJatUtt pob ymladdg*!.— i>uin». (M.A. UL ITS.) 



,)glc 



AxaxaSktAiiM, a. difFering, different; TariooB; 
Taried, diversified; contrary; inoonsisteiit. 

PvT nil tt*7T fod ziui rn tt uzuorovdd imM A meat 
ogAn, guiddTvedyd fodoFenddyn yr Y^^ryuiyT Un, a'i 
bod sn cynnwr« Belhuo amlwK amnt/aelni, >c yn gwiUi- 
WTTwbu eu gll^d. — MorvM Cjtffin: DuTriuul, i, S- 

AmrA&elwedd, -au, -ion, »f. diversity or 
varitity of forma or shapes ; multifonuity. 
AnflKvdd bnunt yw'rpri(xlolanra/a*/i«rfdaddiijionfod 
■rnnrtirirbMhrhaiganjUbcCluD.— Ch/Wiwc* jF Krirdd. 7S. 

Amr&fBeliredd, a. consisting of vtuiona formt ; 
moltiforni. 

B«Jtdd ft oMoedd dlmdd«i' ■ genklnt dilbui mlliR jn 
UDodl AT J wen a'r ltfl« a*r hir prybydedd; eithr gmn oiu 
g«lllT u- T rharn ja iaWD A rbywiw ^-hiikJ bnint ocrth 7 
mefluro tarthri artra/uf/u'''-/Jodlf|xxwb¥niTPliynyniawii 
herwrdd uawdd y iniMur.— rif/HuKA V Acinlii, BT (cT. 1ST ). 
^ Like several other words boginning with 
om-, amrafael and derivatives are sometinies 
written ym-. Both the noon and adj. am- 
rafad are modificatioiiB of amry/al ; and the 
distance from variety or differeooe to variauce 
or contention ia not great. 
AmraffOd, v. [rhogod] to circumvent.— Ouien*. 
Amrai, a.=k^niruw, q.v. A recent pedantic, 
imanalogical snMtitute for amryw before pi. 
nounB, and formed on the erroneous supposi- 
tiontbatrAaiisthepI.otrAj/u'. ifAai (^laome, 
not many) is always pi. and denotes number; 
aa, rkai lii/ni'oti^some men, a certain number 
of persons; whiler/iyu'iBbothsing.andpl.,and 
refers to kind, sort, quality, character, or quan- 
tity; as rkyw ddyniim (sg. rhyio ddynp^aoiad 
SBort of] men, certain persons, men of a oertain 
leacriptdon. Cf. the expression rAytu rot (sg. 
rkyii! un), some ones, some. Ithyw softens the 
mutable initial of the word which it qualifies ; 
rhai leaves it unaffected ; but those who prefer 
amrai to amryw overlook this distinction, and 
writ« amrai ddynion. Pughe, to whom we are 
indebted for the introduction of this novelty, 
has not inserted amrai in either edition of lus 
Dictionary, but in his other writings, both in 
-^ose and verse, it is of frequent ocoucrence. 
F, Brythim, v. 100. In the same way sciolism 
has endeavoured to convert rK/ryw into <^r~"' 
when it qualifies a pL substantive. 
crnnefnydd h ryddonled ma 
riillDalaD, ~>iin»'ndd*u die 



^. 



T«tunaa ei awni fdynt, na amlat, nrfriaol, d 
fddol, banawl, ■gsJarnuloI; bebUvan-^lenlll. 



Trwygydi 
y»Biwbi^ 



rdwdtbrediAd Hihliu) offeMald yr op 
obymhorth DUitoniu amrai jn lioi^ . . 
— Lvrhydlg aww k*i frvblb^a, 

Swallur Jf^Jkiin; Omitb. IL 
' torfoedd m?WD dvinT^faaAa yn f AWTion lAm 



Tt oedd y torfoedd rnewu attmittnxa vs fki 
Duth nmili I*T diD nm dri l^bult bnbl 1 m ,. ... 
nvya y [faun twnf o'r pendsflgion Owyddelig u unrsl o'r 
boueddwyr.— //rlaiM.- Dijenau, SOS. 

Amrain, reiniau, «m. pennywort, marsb penny- 
wort, penny rot, w6ite-rot {ffydrocotylt mii- 
garii) : also called Uyiiau y geiniog, taddaid 
uxn, toddedig, and rron y gweunydd. 
Amrain dyfrdrig, floating whit«-rot (Hydtveo- 
tyh inundala).~n. Davia : Welsh. Bot. 27. 

Amntn, -an, />/. a circular division. 

Amraniad, -au, no. a dividing round, a circular 
division. 



Amkamttk 

Amnmol, a. dividing round, 

Amrsnt, -au. annau, em. [gran ; C. abrarts 

(^eyebrow); Br. afrronf; Ir.aMnnJA.aftAraWi; 
Oa. abhmdl ; L. /ron>] I. the eyelid. 
. Settb gymeint a Lonrwyi ■ lad w aa t 

»ermuiuda«yiuy ™^^^^.^ . 0,^3,^111, MS. 



NycheUI 
Cdlariui 



olh". 



LlfK, at IJr»^r- ■• M.A. L 800. 



Lc ycbydig beppiui yi 



Da/. JM> Ai'mfihf .- ILA. I. S7S. 

Arnycb«ig™f lUyTaiimiirri™. y Uadel wOijt ijcwm. 

Inm dy lygfdt Bth uMmiiBni jn di. 

aisU^fo- Vvdd/ai, 1. 10 (cf. 1»). 

Bl lynld ■ fdiTfbuit, el anniaiuii > brofuit bhtit.dy&- 

a.—n. 0. Gsffrrdm 16«7 (BiilDI. D. *1. 

A phu Blyoh i't Bwely, tiro siBranMW dy Iremid ma tt. 

Mtddygim MfMfai, IT SIS. 



Ergydamrant, 1 the twinkling of an e^; 
?'firawf«rf ammnf, | the time of a wink; an iu- 
t'/iuxirii amraiit, J slant, a moment. 



Poed iddynt hwy, mfiddoi, ddilyn cyvod«i « ^vnffoddAn, 
Siaiadtr.- I^ngx PttW, T. 

,^ mranfeia y bore, the eyelids of the morning. — 

lob zli. IB (cf. zvi. 16). 
AmraiU llygad, an eyelid. 
2. the twinkling of an eye ; a wink ; on instant, 
a moment, a second. 
Tntbwyf Dnw a diwedd vy mut 
Tnrwjftnmtwianamra<il.—Oamtdtn: U.A. 1. US. 
Ni chytgait amrant, I did not sleep a wink. 

Ui«y< muB uwyl. a i'w pblentyn lafuln u hyd j ddi. 
• bod yu uiyoAd sc yn ubywutia, hyd poo da ulo hi yn 
fynych buna amrmi nn am yn j noa . . . ata pan gyfodo 
hi y boRu, bl a'i <Ar cf itym- 

Ai>»«ri LImrd ■■ Lhrybr Hyffordd, US. 
Otfffolodd yr annairiallon «ydd fyr, a Uawaijdd y diyg- 
[oaoa ond am annvr. 

£r. Th.Briitot: Uyfr lob, ix.a Icf. ixlv. lOi. 

Amrantiad, -an, tm. a winking ; the twinkling 

of an eye. 
Amnuitn, v. to wink ; to blink. 

Amrantu ar, to wilik at, 
Amrantun, -au, «nt. [amrant-|-hun] anap, dose, 

or short sleep. 
Ni ekytgaia 1 amrantttn heno, I have not slept 

a wink this night. 
Amrantnno, j v. [iunrant-t-hnno] to slumber, 
Amranliuuo, ) to dose ; to take a nap. 

Ai KKWuyrevlg yrai, 
Tm mron lb) yc •amranOiun.—Lrwri Hon. 
Ami&iitTii, <Tn. ashortnapordoBo; oninstant. 
Ar gtp amrafttjpt rwdld trwj y cadd 
Ebiueri fyrdd yn derohu fry ai- Chwlir 
Tnamlivfaly wswT.— IT. O. F-sIt: Ca.LtK. 



Ajnrftnw, v. [rhanj to divide round ; to dilate. 
Am ran wan, «/. [aninHit-f-^weii, m. gwyJi] 

whitewort, wild camoiiule {Matriatria). — 

Mtddggm Myddfai, 281, 237, 290. 
Amranwra Eltn Liuddog, Bpicknd, meu, bald- 

xaaoej {Mauitj^F/fitigl Slen Lueddog. 
Amrawdd, tm. [hrawdd]. See Ammrawdd. 
Amred, -ion, if. [rhed] a running about, a 

oompaMm^ ; a cinTiilBr motion ; an ambit, 

drcnit, or compass. 

O'rtuiUliiDt pTtehnen mand rrtwOffordd ■ nrbwrll- 
wjd nchod, gellir dkl y cftmuo crfnlfarog kttji ugjier 

Amred, a. running eTerrwbere about; being 
abroad. 
TmborOi, aural i'rnledfdd. 
A dudd D hODi bob d}dd.— />. ab Otcilgm, udx. SI. 



»-tall HwyddT wrth : , , . 

nil.— K^. O.Puflu; Oejuioa A*«o, 
Amrediad, -au, im. a running or going about; 

perambulation; drcumambulation. 
Amredol, u. running or going around ; ambu- 
latorf, perambulatory ; circumambient; am- 
bient; revolving. 

YmdardduiC hwy 
Hot d«s V dual Edd jTamndatDtmwl- 



La, If. to oounterfeit ; to feign ; to mimie. 
Amredydd, -ion, >m. one tbat runs or akipa 
about ; a mimic ; a harlequin. 

Antradydd, treifflirT- — GeirlfffTTpi W. C^fnwai^ 

Amrel, -laid, gm. an admiral. — LewU Morrit: 
Celtic Remaina, b.v. I have not met with the 
word thus modified; but it occurs several 
times in its ordinary Eng. form {pi. admirales, 
admiralTs] in ' Bown o Hamtwn ' : of. $§ 66, 
67,68. 

AnLreDtvii, *>n. 1. the eyeUdlialf ebnt. — P. 2. a 
short dose or nap. 3. a wink. 

Amrecymeg, -au, »f. [rhesymeg] logic ; dialec- 

Bhafd twch "Tbod, nui o'r grnlut t tffodd j 
Aelwir.dHrRirjnf«^ u nul o'r ul T taiddodd mo J wu*,, 
PfTvetMnflb. . . HAl J tnae ankrttymeg jn liiw^dA 
rnmsymii, mc i vneuQiar ^vahflLn rbwng ff^niioncaa a 
ebdwydd . . . vToniut jumSpt/eQaaebjaaytgaBrteOi' 
ebu, ac meilJiikit ja hyiwdl. 

Hmri Peni: Egl. Ffr, Ann, 1. 

AmreaTmiad, -an, •m.^I'mrMymiad. 

AmresTmu, t>. to reason, to argue. See Ym- 

rajfmii, 
Amiif, a. numerone.— 0. F. 
Amrill, -iau, a/, aborder; an edging. — O.V. 
Amrith, u. of varioua forma, kinds, aspects, oi 

appearances; variegated, diversified ; various. 

pDbuaryw.iunHllbablDedd.— Kfn. Ayi.- eoIra.mTt 8. 

Addamcv tw trwiiisd nea visK-adduni nneth, nul ft 
UrfdAb amrUh ftc unltw, i ^TDbyrfu, ac jmcbwfllyd meddyl- 
iMm nirydan Tywrsiid»w)T.— W'nri /Vm; Egi. Ffr. 1. 



Amritlider, -au, 
versity. 
Am bfin, t> Mlwwa yr 



variety, variegation, di- 



y droeU boa yn uiweddiu. 



iv (of. I 



AnLrithiad,-au,iin. variegation; divendflcatior- 
Amritbio, v. to diversify the appearanoe; to 

variegate, to diversify. 
Amrod, -au, <m. See Ammrod. 
Amrodawl, a. drcumrotatory. 
Amrodi, v. te revolve, to ciroumvolve. — P. 
Amrodiedydd, -ion, mt. [rhodio] one who 

walks about ; a peripatetic. 
Amr04lio, v. to walk or move abont ; to ramble ; 

to tread. 
Y gwulUoii hpini, u J msmwl ffll 
Ajuhrefbai. bwynt nfyiuDt wand, oa 
Aimradiatp Uvdd ■ ^nom. 

W. O. Fuilie! C.Q. iv. BBS let. TiJ. S8i|. 
Amroddawl, a. giving in all directiona. 
Amroddi, r. to give in all directions ; to lavish ; . 

to be profuse. 
Amroddi, vn.^Fmroddi. 
Anuoddiad, -au, tm. a lavishing or distributiiig 

on all aides. 
Amroago, a. [f] unwieldy; huge; vast; very 

Urge. 

CUnicdi o ddyn arnnufn ydyv.— 0rainD|r Owote. IW, 

Bbuk enf AWT fiuat yn nrrth 
Tmdnlstuit, M attromo yn m rbwyig 
Cyffnuit yi agion.— W. O. Pufii : C.Q. Til, tn. 
Ti hen ^oedon twnafol ao amrwgo bon. — C^mvl, U. 101. 

AmroagOadd, nn.unwieldine8s; hugeness, vast- 
Amroagoew, a. 1. unwieldy; huge, vast. 

Abut aydd yn dy a«am. 

Isrll Unn, jydk'reaiUiwuawr; 

Binobl ao anan glln ^loew 

Tm' yw't yi«wjd atumsBetn.—Iola Oadi, I H. MorthnflT. 

2. diagonaL 



niwdn 



ereyUyo m 



gyt ■ hynDy hpvyt ef » erebys gwnentliur dwy fford 
"s^^^^mnr: M.A. iL IM (ct. B). 

Jonrwtli, m. 1 a. yawning or opening on all 

Amroth, /. ) sides. 

Amrwy, -on, -an. am. [rbwy] 1. an armlet or 

braoelet. 

Aiorai ac aerwy y gelwid brriobrwy yn no«putb y Paid 

2. a fringe or border; purflle. 

Amrwydo, v. to entangle in every directian. 
Ainrwydd, a. free or easy in every way ; very 

free; composed. 
Amrwydd, tm. ease, calmness, tranquility, com- 

poBore. 

Nl cbyll im dedvydd ei BWydd ; 
Ni cbyll lawn ymgolB el Iwydd : 
NiDhyllymbwyUeiannoiriU.— Jr^. Arck. 111.98. 
AniTWTg, -au, a/, a rending or tearing in all 



Jfa-Aah ; Gwilth, 1. im 



Tn Dl eu dydd daeth niwi dn, 
TibIb bc iinip»jjj Iroa Oymni. 



jM.v^.(,K)t;ie 



AnwroiAi) 1( 

AtoTVrjgimA, -au, a tearing all around ; dilapi* 

dation. 
Anu-WTKOt "' to tear round. 
Amrwy^l, a. tearing or rending around. 
AmrwTin, -au, tm. a bandage, a tie. 
AmrwyniAd, -an, tm. a tying or binding 



around. 



tie or bind aiaimd. 



that which binds 



gotmB.—Mji/frdoiLi 



A-^hOaUg a 



Anurwys, a, [hrwyv, rhwys ; suggested bj a 
broeia] smbrosiiu. 



Trl pbeth jdd rmwnlA dedwydd tm frodkfA : t>M4^«itt 
cjbydilKidd ; gvlrniiieili BjibIb : ■ bulclider axrvyiinu. 

Trinald: tLA. IS. MI. 

Amrwysol, a. ambronal, ambroaiaa. 

Et djpgiut prailui b^WT^ yn r aet 
Amnirftiiitl miHtiit, u I rbodduit irtdd 

EduJiMmi.— IF. &. A#Jk<.-C.O. T. 4Sa(<i(. zl.W). 

Amrjraful, a.^iAmra/ad, Amryfai. 

A? «TttUy ffmrepedrt a Dunhoaran ^ob kyrrrir 4iitrv- 
V^mieoD • wdft (no.— Bnit Or. fll .<rt*.r ; »I.A. 11. aw. 

Amrjrallu, a, [auuTw + gallu] multapoteat, 

having mauifold powcra. 
Amryben, a. many-headed. 



Amryblith, a. heterogeneous; promisonous; 

Lie mtti tr j dncthdl noeth, b% dr*ir 
Hyd brn j mlmi yi amrgblUk dorf . 

W. O.Puflu: C.a. L«I. 
Y nuu yr uilfefllAld dlw win ni ymKTmmTvli L'n 
Rllydd rn oiKryUM. . . Tn d ddbrnddlsd mowil t mu 
djn yn wviii at y bwysOUod Lrwy ymollwng 1 fmomyiM^ 
bid a7,rfiliik. . . ^ nuc y py-iyUtUd i fpd, nld rtumg j 
rhyiragRathfri] yn dnr^ Uiui, ond yn brloda«DJ. 

" - " — 'n; Eq>.36S. 



Amiyblyg, a. manifold ; multifarioua. 

Oiieddiu oedd I'r Dsw ollddfwtb iruyd unlgvhd u1 
fftwr omrybli/g dda«tkiiieb drwy uifon d Fab I'r ijyd yn y 
cyfnod d&yviedig im,—B!<id<iH InAbtc, 111, 



Bot. 96. 

AnuTd&r, int. tumult in all directions ; a great 
tumult. 

Bui ddyfu Gadvidlaini drH el^vn Twerddon 
GbienteuAamrjrt'aruihuQiyBKn. — 7^i4sin: U.A.i.T4. 

Anuydreigl, a, heteroolitic; irregular. 

Enio amrydtexgl, a heteroclite nonn. 
AmiydreigUad, -au, vm. variety of deolen- 

AiniydTeigUsid,*.pf.heterocti tea [in grammar). 
AmrTdvIl, a. fall of boles; porous; perforated. 
AmrTdyb, -ian, tm. a paradox. 



Ambttaiadd 

Antrrdfbiol, \a. poradoxioal; of the natne 
Amiydylma, ) of a paradox. 
Anurdylladd, «m. porousness, porosity. 

A lUu^ ynte. ddim o'r dyfi«dd g»A en Uynni gu 
awu^yUrii y lUuu t~Utmad ir Cai, L M». 

Anuydyllog, a. porous ; fnU of holes or p<x«a. 
Anuyddail, 1 a. [dafl] many-leared, poly- 
Anuyddeiliog, j phylloua. 



, [dawn] endowed with Ta- 



Hmii» rw oi«i IB el fyfTrgell y tnoUs y baoaddWT a»- 
rr£Ui:i bWn a ■ibH.-i^a, ItoU 10. 1^ 

Anuryiidoniaeth, -au, «/. verBatility. 
Anuyddull, -iau, tm. Tsriety of tomu; multi- 
formity. 
TtSi ffordd yr unlbHr Uth : (anfMla Edriu eyfyityi ; 

AuurydduU, a. multiform ; various. 
Y ituTn Tw eyl(^ uifqldnil Ear, y i^sTa 
Nid ydyot and yr aa owrMiUI Nnv 1 

(/■DyKH^d, TiL US. 

Amirddulledd, »m. multiformity. 
Anuydduw, a. polytheistic 
Anurdduwi&d, iaid, sm. a polytheist. 
Amrydduwiaeth, -ao, »f. polythedsm. 
Amrvddyaginn.polymathy; varied knowledge 

or learning. 
Amryf, am. arrogance ; haughtiness. 
Ymnryf nuwr- bo amrt/ maitb. — Siff» CnU. 

AoOT&elua, a. various ; varied, diversifled ; 

different. 

lAwnnlot y ni wwdynt yn tybycit ndiubat 



u na wydynt pa Is yr oedynt.— A. Onoj. ) IS 

Amiy&l, fcUion, falion, ja. [amryw-f-mal, 

Amiryfoel, faelion, feilion, ) as m pedry/of '-- 

petrr/o/J various; divers, diverse; su ' 

several; varied, diversified; differrait. 

Amrafofl. 



Yna y djigynii— nt yr mad ■ I mill Haul yn yr bson yd 
tafA anueiryf llfloiaogTwyd o vyrda yn gvara aacoyr. a 
fwydbwyll. ao avtrujMlon ohwaiyeu erf lU. 

O unryiaul a nw gyon ao amylder gwimdea. adidlawt 
maaanaetb. ao amrbuoftom nrdeu. aAwujyvu. 

Ma^otion, u. 31 {ct. 1. T). 

ba lawl amrt/al defaydd y ^wnastbpwyt onavC dyn o 
hauDnt.— /psiii, IS. 

H^HK^iBn. ill. aoi. 
At mMBhagyon urdolyon adoeUuint yno o amrfnatlpoti 
deyrnaaaoed.— 5i. Oreal, | we (irf. 1W|. 

Amrt/nlim lawanydd ydoadd «mt ym mUiUi coicdl y 
Cymry.— «>>. .^rci). ilL 196. 
jifeum amrj^a^ /onau, in sundry places. 
Amrylbledd, 1 »m. variety; diversity; vari- 
' ' ' ableneas; dissimilitude; differ- 



Amryfaelder, ] 

OiTder y trwykn a annredaba. ao nr|i*a> 
hynny.— £rw Gr. eb ArUn-r (B) : H.A. iL m. 






Akbyfalhau 1 

AmrjrfiUlt&a, v. to divenify, to vary. 

Btfar H en IzD hwrnt a BianiAUdiil 
Md^ob gathUa Hn jt onedd wen. 

IT. O.A.f*t; CQ.T.JU. 

AmryfcUad, -an, >m. diveraificatioti, variation, 
AmTjftlu, ) t>. to vaiy ; to diversify ; to make 
AnUT&eln, } different ; to differ. 

Tr oedd r ddvy yn amrMfaviu, rtiyw jofaydlg bach, fal y 
ieugjt 7 nodiadau cut daW 

Cj^/rtxdct V BtinU (Bhag. 13]. 

Amryfiirn, -an, (/. s paradox. 
Amryfath, a. [math] of varioos sorta or kinds ; 
moltif arioua ; misoellaneouB; diverse, various. 
b y flwyddTn ITS), drfeidwyd ja America l;e4 o «■>>- 
/ul irydr.— sai>w( ioicro.- Qweftlilia, W (cf. 43). 

aOltbli TT eaw yn <imrt/aA.—Llf/7yMiatili t Cgmrf, Ml. 

AmTTtewl, a. arrogant; baaght;; proud. 

O chwanla Eoa efbrfl hawl 

T BBHCn bu a»ir kythimv o mryw 

Ad beoidad hazMTm acrbmawl. 

£Jr»>n* >>» £Jrwtr>.' H^ I. S80. 

Anuyfedd, a. [rhyfodd] wonderful in every 

way ; wonderful, marveUouB. 



Luafl Hu TTcnhin yn Uaauryaw n«dyo yn 
''haAffmiuK^ \ B (of. 



d%tiid. Amr^MtdrMi ^. ^ ^.. 

maa linwedawl mawrwelrthawc oed i 






rUtwT. 



a. having different rhymes ; 
varying in rhyme ; poly- 



Amryfeilawdl, 

Anuyfeilodl, 
rhythmic 

Anuyfeilawdl, 1 odlau, »/. diversity or variety 

Amryfeilodl, j of rhymes. 

AmrTfeilhyd, a. of different or various lengths. 

AmiTfeiliad, -au, wn. variation, diversification. 

Amryleili&eth, -au, (/. difference; variation; 
variety, diversity; variegation. 

Anuyfeiliant, <m. variation; variety, diversity. 

AmryCsilrif, a. diffMng aa to number ; of va- 
rious numbers. 

r sorts; 



Amryfbilua, a. various, divers ; difierent. 

Orttealaad jwitatr, pan fayr aralttiiirr yn cyfuunddl 
lieuaa avirffitlitt a ^wrthwyiwDus. 



idtiform. 
Amryfel, feilion, a.^Amry/al, Amra/ad. 

AH rhiUk adKyiiuiiarbd y aydd yn 
Kith OHwd Braddan amraf- — '" 



(d. iitL 1). 



Yb ef 7 bondr «Tdd ag emi a' 
rroBlwiieddioa bo Mxnion. yn Bll- 
ba laia a llafU, aa yn nawid-lwr 



[".^ff^iff 



idan anrufei ynddl. 
Bari fe^.- Bgl. Ffr. 
TrlplieUi, ann/el a ffTidd sn gochelir. 

9 emi avenvaith 

u. yn sUydd 

vid-lwyB oaWi. ■« unrjr/v. ^muu 

Amrjrfelu, v, to vary, to diversify, to variegate. 
Amryflad, -an, »m. arrogation ; presumption. 
Amryfbdd, a. of divers manners or forms; 
multifarious; various; multitudinous. 

TaiT Ifordd 7dd amlhMr faith : amnfacta eelilan ejl- 
ntyr; amrffiM g7lnieiiiaD; ao aHuywddDlT [oJ. amry- 
odDtl] Tmadrodd. — CftfrwicS f/ Bmrdd, M. 

Amryfodd, -ion, -au, am. multiformity, varied 
of f onns. 



17 AUKYOAMLAB 

Amryfoldeb, ) *in. arrogance ; presnmptioii ; 
Amryfolder, ) hanghtineSH ; exoessiveness. 
Anuyfu, v. [omryf] to artogat« ; to presume ; 

to boast. 
Anuyflia, a. I. erroneous; mistaking; mis- 
taken ; faulty ; wrong. 
Dial blai aval biyi Era . . . 
O amryu amrrvut Tuyta. 

b^TidMiD.- M.A. I. SfiO, £51 (cf. 180). 
Taamry/at, erroneously; mistakingly, by mis- 
take; orringly; ignorantly; unintentionally. 
Fe brdditi vii wnmUiuT a honof fl r> amrn/m, gyd t ml 
7 brig ^ amry fiM Bdd. — lob xix. 4. 

2. arrogant; excessive. — P. 

Amrjtvm, tm. error ; a mistake ; an oversight. 

Yd hyn 7 maa bai 7 rfaai hyn yn llai : canya 7 maent hvy 
nunm >■»)/■■ ood odid yn mono Do*.— C«i*. xUL S. 

AmryfliMdd, -au, am. an error or mistake ; an 
oversight; a misconoeptioii; ignorance; ex- 



Panl Apoatol a nnfa 7 Fath amrgfittedd a 1 
yn el amara tt.—Xoru, duO' ■ DUTir. U. 

O ddiif7g 7 GjtrYW 7«t7ried a m7fyTio 7 maa C7nuuaint o 
bn^udu M manhtKldau yn y byd. 

Dr. Jot- Divia: IJyft y Beg. i, 11, 3. 

Amryfutedd cadam, strong delusion. — 2 Thea*. 

ii. 11. 

Amryftueddu, ) v. to err, to mistake; to be 

AmiyAiao, {wrong; to exceed the bounds. 

Td 7 rwelli yn Nafydd ao yn SalorDon ; befyd yn y 
^trlfiinb, 7 prophvydi, a'r apoatolkia, 7 rhal 7n fynycha 

ddyfckllS 



HI pan Tmadawn 

Morfm LUc^ : Tmnddlad, Ui 



Hir7aff7feaiaTnaianttrw7irin,aca|pau3(^iauanf teiry 
ddjod gadam.— £^ zxrlli- T. 

A'r boD y dywedodd Crkt am dani (77 hwn ni ddkhon 
aivTfiuo) 7 ovympai hi mown omryfnaBdil. 

JTonu OjiJU.' Diffyn. Ti. IS. 

Anuyfiradd, a. having several decks or floors. 
Ty aiaryftordd, a house several stories high. 
Llong amrt/fwrdd, a ship with several decks. 
Anuryfwjd, -ydd, -an, tm. [bwyd] variety of 

viands ; vorions kinds of food. 
JUaxytjag, cm. variauce, dissension, conten- 
tion. — Mawddmif. 
Amxyfikidd, a. depraved P 

QodiDlib ywr eiraathaf umh 7 ddaTar or pecboden a^ 
amr^yhtiida/.—Jpttii, \ U. 

AnuyfBAU, a. very great or large ; huge ; vast. 
CjTiunerwn iol*n iawl »inlan 
A aynlwn ar beth o*r prwotliaa 
A "I w ddiryn terwyn toR antrhufft^, 

Da/gdd fin/ru; U.A. 1. SIS. 
Owae BybTdd a gatfi amrgJiau.—Or. Taad Cock. (P.) 

ThereadiiigintheAfs». .4reft. i. 400, is'Gwae 
gyfrydd [at. gehydd] oi gabl amryjfrnu, ' which 
is evidently corrupt. 
Carreg amryfflaa, a huge stone. 
Amryf&au, euon, tm. [amryw-|-ffi«n] variety 
of streams or springs. 

Yisl tri hep m. hep hant y amhei, 

Awnaeth fruith anen afob amrijfrai. 

J.£.li.l3 1M.A.l.a7n). 
Amrjrffiirf, a. multiform, variform. 
Anuygamlaa, a. having many channels or 

Mam lllf eirlalnt berw4ialiit baa, 

HoiBTmnUawdd amTfiamla:--L. O. CoAx, ni. V. U. 



,)glc 



Amrygaut, •au, *m. a run that goea quite 
roimo. — P. 

A Dlnbych vrthrrflh orthorTyutt ar uH 
At Vodu k Ofnuiat 
A Dinu Emnig dwr^ni 
AnuTjTT newanhp mw mat. 

/i(«, iti Ltimlr% : M.A. i. MS. 
Axorygnr, o, greatly beloved on all ddei.— P. 
Nmd sBiwen wjf ncud ■fluniu' dral 
Neum rym c<jT«fl Cfiftt Creawdyr tm^ar 

(7riuM<iiB. U.A.I. 380. 

Amrygaagl, a. collected from various sources 
orplaces; compiled; nusceUaneona; complex. 

Amry^aag'liad, -au, »m. a oollectioii from 
^'~ e; a collection of particular 



Anuy^ngl, a. polygonal, multangular. 

Amr^goU, -ion, tm. oD manner of low; per- 
dition; destruction; low; damage; loea of 
property. 

dAU kimeret «nt« meiohieu y ku edio hinmw ar t «v^ 

Mo«.-Cjym«iai. C»"irB, i. 188 (of. L. W. U. vii. S). 

A miiuwa a rrdhaaf nti girbrl oth sntrU ath amrptM 
jyt a hynny.— «(. Orm/. H8S. 

Amrygoll, a. that is a loea in every way. 

OKltiflwn ddivyn prinder er dim riifdflg a ffefsiB gan vb 
I'D el hemrdd, ao amrgfoU polled er eln damwsiniawl 
WTth jFmdaith er lied er vefwyair oleiilian a'n Iriniaw. 

br. Thnmat WUiami (Tarotl, «SJ. 

Amrygollad, -ion, «/. total lorn, perdition. 
AnuygoUi, v. to lose completely ; to be utterly 
deprived of. 



ir rr gymyiUi CrMogn , 

Troy mm-HTo'I' dasani dyn. 

MtUir ail 

Anuygur, -on, »m. [amryw+cur] torment or 
pain on all rides ; affliction; tribulation.— P. 
A tbalT Than j myr mor ynt amrjarr. 

Taliuin.- M.A. LK. 
GwlaiA TniTO [of. ymo] yn fmrj/gyr, 

ntaaUimah IC.A. i. IM [of. i»S). 
Naud nmrygiiT kjrt kyd ymarwar. 

OrfUUm: ILA. I. 130. 

^ The MsB., withoDt variants, have amn/gyr. 

Amrfigur^ Harjw for. — leic Olo»tarj/, 
Anrj/gitr i'm bir nrTS>w-— Sum jrootHi. 

1 all sidea; to alBict 
., «m, a faUiug in divers or 



Amrygwyu, -ioa, »m, a complaint on all sid 
tribulation ; great trouble. 
Kead amrrfftc^ ym ncud anu-ygaf 
Nmid amrysyt ^^ kyd ymarwar. 

CfodMy,: U.A. i. 1 

Amr^frch, -au, «m. variety of attacks; 



Jnlwf flniwl; CyfrinaA y Bdrdd |Ilha«. 10). 
Ajniy gy aa wilt, sylltau, »n. polysyndet«n. 
Amrybollt, a, having many clefts; mnltifid, 

many-deft. 
Amryiaith, a. polyglot, many-langnaged. 
Amrylaia, a. of various or many sounds; 

many- voiced ; multisonous, polyphonic. 



8 AvBYLinr 

Anurjlaia, l^siau, «m. variety of sounds or 
voices; polyphony. 
Am Bai diodddant, gan tlilMyg lie, aphwyahoedd 

wii<»H»iiiJ enyDt : nac omrKiMt Dynvhaiiedd. 

Cs[fii~uK « Bfinld. n. 

Amrylaw, a. of several hands; done or made 
by several or many hands. 

Nyt ort rnKfjiliiio nao unryloo wt 

Ny threayt bmyauryt am bmm 
NasomoatBuanmalloii.— C'^ndiMiD.' itJL.i.»a. 

Anuylawn, a, full in all directions ; filling alL 

Khal hyii,saii newtd, HoUallnawg Dad, 
NW ydyut ungen no r ii-ryioipii Dduw, 

THomai Uond Jiaei : OslDfeO Awm, IM. 

AmrylawT, a. having several floors or storiea. 

7y amrylawr, a house of several st«riea. 
Amrylef, a. at many tonea or voices; poly- 

phonoua. 
Mploiaf ydyot nn mwyaf » jr adi&viaid ar hoU f emma 
aeu beimilliun oerdd, nn eu hamrglf/ gaaiadAetii o awtn 
rt^orbwyll.— '/s/fimcA j/ Btirddf 71. 
Ti wyirt nnryl'/, mig dallh. 

A vyddost u ei gdr, 
Ei le a pha ei drwydded maiUi 
YnbeUdrMdiiamSrl 

IT. O. Ptifkr: Ctinlon Ann, 1S4. 

Amiylef, -au, «/. polyphony ; variety of sounds, 

Anaswdd angboi y grhydedd Ivfn yw bai) aalcfa sOI j a 
rbit bananmewn pemilll obedwu i ddi^ddeg; nea'rnif 
afyofv: elUir ■> barth anuy^ caniadafltli «i gaetha obed- 
mr i ddeuddeff, rbav bliiio oJiut- 

Ci/ri-ui , An'nM, S3 (Ct. 81). 

Amrylen, a. [amryw-|-lldn] of varions learning 
or knowledge ; learned iu various branches of 
knoivledge. 
Anuylen, tm. variety of learning or knowledge. 
Ao et . . . a draetbwTi oi niUd mswn Uawet cywydd 
Uaidd aa amrnlni difnt.— /ols Mu. 170. 
Amryliw, a. of various or divers colours or 
hues ; many - coloured, veraicolonr ; varie- 
gated. 
Amrrlir! oet y am.—Cr^M/lv: H.A. i. MS. 
Hi weIwh lin encUi mewn giriwoedd yn wych, 
^_ ..-, : , rnegwBdd a diych, 

Id Ddu. BIT. 
Tn of er tyvyni meim fvedd MigjbaUl, 
A blodau amrirfCw yu hullo dy anla]. 

BJoc^mU,- Cehi. Alns, 8S. 

Amryli-w, -iau, im. variety of colours or hues. 

Owyn, arwydd gwirEooedd ydyw. a denrydd a'l arwain 

yn Uwf^rwug; oanyii cyfliw goleonl a fwrnlUv dydd rv 

gwirlonsdd, ac nil g«llii aruaw amrgltia.—Barddaa, ii. 38. 

AmryUwiAd, -au, nn. variation of oolours ; 

variegation, 
Amryliwio, v. to variegate or diversif]'. 

GoTchuddld oohiaii'T mynyddoedd gan g^Hdydd, ac oai- 
rf f ivid glajiBU^ luailydd gan flodau. — ^oMfJoa, i. 
Amiyliwiog, a. of various hues or colours; 
many-coloured, veraioolourcd ; variegated. 
Chvyta yn yr entnch benlawg 

Ei hadenydd anrgliKiatpff. — Jn^ TncMrvg: Bardd, lU. 9- 

Tn Ue omryHvicv hnjtan Inf. ni tedd yn a-wr ond mdyn- 

ruddwi^redyaUI*.— ffBuUin- Jf«*aM.' Omlth, 11. 9&S. 

Anuylon, a. surrounded with gladness; very 

Nyd oet amrylav nao nnrt'oa or. 

C^nMelv.' M.A. L 168. 

Anuyluo, a. of various forms ; having many 
shapes; multiform; variform. 



AxaiyaoiHi, a. multipoteiit. 
Amryoohr, -au, «/. a polygon. 
Anuryochr, a. polygonal, polygonoiu. 
AmiyochTedd,»m. the state of beiDgapolygon; 

tlie principle of a polygon. 
Auuyochri, v. to fonn a poljrgon. 
Amryochrog, a. polygonal, moltilatenil. 
Anuyred, a. of divera or Tariona oooraea ; run- 
ning or flowing in different directionH. 
^0 jmnna rm yn beiUft ITiwd 
A mrgr td hynt i ^rwydraT llawer ^wUd 
Kodedte, jma nad tw raid en oof. 

IT. O.Ptflu: C.O.iv. M4. 
Amrya&in, a. having many or different Bonuda 

or tones ; polyphonic, maoy-toned. 
Amrysawdd, a. of Tarioug qualitiee, sorts, or 

Car rr holl rTWUguUiiii luhad o lo, a dan wyneb f tk, 
7" gTMlHtodig t hMDydil dTwodf «ai aMrjuaiMd. 

Otlc)vvm, i. MS. 

Ajnryaedd, -an, nn. [rhysedd] exoess on all 
aides ; great eioess ; excess. 

Pflrift nft o*T nlver udnd 

FnS olbcriiibTBt «rvHil.— C^iAMb.- H^. I. M3. 

AmiyuU, a. polysyllabic. 

Vta cbmiuger lill nn ohnoeg utrnt, r«l r brddont 
dd»TB0) n^n oiiarvn'', nrthdriSeT y dnfn boa. 

D. S. Eoiiu: Urtbyneth, isi (d. 98, go]. 
Amryaon (5), -au, -ion, mn. [am-+rhyw+ 
•ouP] 1. contention; strife; quarrel; discord; 
wrangle ; dispute. Of. ymryton. 
Ao 7 KTt le J kiden Aitbnr k Owmhwyimr yr amrfMtm 
■m y pom. ydyw&wt QmahiryiuT yna wrUi Artbor. 

jroMwrtsu, IL n. 

Odyiu y daw tarw yr anruufli, 

fml (^. cl> AMIitr (B) : H.A. U. IW. 

Amrfman sth gySetyb : twdnu yv It. mvjvHii ti Deb ■ 
TO moe DO thi. yuvytuuyd yw it : amrvtttn mo ano ii no 
Ull : did* pr tl.—Ut/T Oic^ Rli^ddtrck. 

2. a contest or competition. 

ka y kynhalj^awd yr arglvyd Rya vied arbennic yn 
iH AbiT Teioi, ao y soaww* dm ryv anryum va rw^ 



i. UOIcf. 1]0,M1}. 
Hyt yma t tiaetha y a t or y a a berla Reynallt . . . y tbroavd 
rysKa y TTflnUDefl. — ^omfHlH CAdrfyflvOdi. f HO. 
"^rl anvkiffn a ddygwydd ar farwolaeth bnwa cadara. 

TVwbU DotAinA: H-A. Hi. »». 

Amryaon, v, to contend ; to striTe (in words) ; 
to aebat« ; to quarrel; to wrangle; t« dispnt^. 

At ana aboaat oi hir en amnuon pni abeley an eblaea 
dmy anon Qaerit.—CtfrmMait OjfKnt, L IM. 

A phavb or teulu ar manbovyon yn antrj/aton yn cbmrw 
am y pomi. aA ar bjimy y daetbant yr llya. 

. MaMKHfiBH, IL n. 
Onavd yr dywedyd llawero betbaa aoledna am ddiwedd 
Arthur ; ac yn enwedlg chwedleuDD Prydeiniaid, a |«rr 
mni amdaw, ao ■ ndunhint iAtai.jB trw. 

Rbku ^wrM ArtSur. (P.J 

ITy edlr ef o hynny aOuta yyth y omFynni a neb or nint. 

Cudilar, ) BO. 

Amr^w>]i&, f^ydd, faoedd, «/. a contest, oom- 
petitiou, or match; a contention, sUife, oi 

Amrytoafa airedig, a ploughing match. 



Amrysongar, a. (n-g) ooutentiouB, quarrel- 
some ; given to atxife. 
AmrTaongarwch, «m. oontentiousnesa, quarrel- 



Anuysoni, v.=zAmryt<m. 

W. OvKn Paghe: C.O. iL SSI. 

Amryaoniad, -au, era. 1. a contending; eon- 
tsntion, 2. (pi, iaid) a contentious person. 
Njt ef cbibT an vwlo'.— rofiVni : H.A. L 27. 

Anuyaonolia. contendiug; oont«ntious; wrang- 
ling. 

Amryaonwr, wyr, 1 no. a contender ; a quar- 

AmrTSonjrdd, -ion, ) reller; a wrangler. 

AmxTV, a. [am--(-rhyw] 1. several; various; 
divers; diverse; sundry; many. 

Oaa Tawidnb Ooniii amrgic dnted. 

CvMHk: M.A. i.»a)(ef. 161). 
AmrfK nyd 11b boynt orodorymL 

linK.abUru^^: M.A. i. Jffl (rf.SOB). 

Na rydded gfotyt yn dy gnd aanv bvyi, mawr a tmdian. 

Na f rdded g«yt yn dy df aMrsw timax.—Diitt, uv. 13, 14. 

E ddarfn iddo cbwanwu amryv obwedlau at hanaa 

TSnnJn /hub ffrvJ.,>U HSr ■ IWh .Ta llanltB 1/» 



jimr^ui 5(Tiau, amryw dy&tau, several men, 
several minds. 
Aitirywion, vorietias, miscaUsjiias, gnndries. 
2, different, differing ; diverse. 

Tri «obofl aniTW ntld y maa rbyfedd y ddyn fot yn Itflh 
a™ aiall.-CK/rtJWlfai. Cymm, «. 980, 

Ma'ch arwalnier oddl amgylab ag athraviaelliav ohivh 
a diotbr. — Btb. nii. 0. 

Jmryto Midi wrth, different or differing from, 

Tr ydoedd efe yn aarvw oddi vrtt y bwylfllod oil r Ami 
a tnaaal o'i Baoi af.-An. tU. I (ct. S, SSJ. 

^ .Amryw geueraUy precedes its noun, which 

is uHuaUy, but not always, in the plural ; and 

is sometimes employed without a sabstantive 
Anuywaitli, a, ol variegated work ; inlaid. 
Amrywaith, weithiaii, •nt. variegated work; 

inlaid work. 
Ajniywdeb, t wn. diversity, variety; miscel- 
AniTTwder, j laneonaneas. 

Hal y bo amrfimltr ac anghyilBlybrwydd y nwydao yn 

pityn aa yn goddef.— ^nW Pml: Kgl. iTfr. iIt. 1. 
AmjywdduU, a. of various forms; multifonn; 

various. Cf. amryddull. 
Talr ffordd ydd a mlhcir ioith : anuHfaeln gaiiiau cyf- 

ystyr: amiyf odd TylmeMan : ma amrymfdnU ymadrodd. 

Ajnry-wdduwiaeth, tf.-=Am'n/dduwiaeth. 

T ouu, yn d1 ^ amgyltrediadaa i, yn Nfydln amrgtcMnii- 
itMJt o dan y ibitii o offlnro diiwlwoh. 

Cflcifniiim Cfmrarg (1783), SOS. 

Amrjrwedd, a. of many (onus; multiform; 
diversified or various as to form. 

Talr OTBD«ddf awn: budd l«ddwl i priodol feddwl i as 
amrytmJd ttHnL—Cx/rnat^ t Bardd, 43. 

Solon ddoeth ■ arfendd d gynwyri gadyddsdfrydoda 
TT ^ ****■"" ***! drwT ddangoa fod yr ben foadan yn yr ynyi 
tonno I'll hydnd o'r gwUawln i'r dwyiain, yn ol hen 
ddefod gladdu yr Atheaiaid ; ood bod y Hre^riald yn 
daddn yn anrwaU. beb ofaJa ank nn biedd mwy na'u 
gOydd — OicfUaltdti, L SSH. 

Y trydydd rynted yn y llaid a WDBi 

Aivi^idd mtfalnn.— )r. O. Pufla: C.Q. 1. 134. 



,.V^.(,K)' 



igle 



AXBTWKDDIAD i 

Amryveddiad, -ftu, mi. direndfloaldoi), varia- 

Anuyweddn, v. to diveraifj' forms or appear- 

ancea ; to djvaraify, to vaij. 
Amiywellt, t.fl. and on. Tuiet^ of graw; 

herbage. 
Amx;%iad, -au, «ni. variatioD, divereification. 

Am ■ berllirii i'r a«ir|nrudaii odd! irrth j Ujtt crnt&f . 
Ul^ Cuvddi Gfffrvlu) (Bhsgynudradd). 

Auuywiaeth, -au, »ni. variety; Tariation; di- 
Teraification ; aJt«ratioii. 

Tri itmrrma'"' «rdd : amrtmarlH mrfridDd ; amrjnu. 
in'I* imitb; me amr)fWuiiA (oloftl »rtd.-4ti aiiir|r™«» 
lifkD ; dmrvifiqi'fA fryhrdedd ; dmrirw^iA eynghuudd ^ uj 
iimrykpiafOi mosi.— Cjr/nvuA jr J)n/dd, 4C- 

Amryuriaethau, varieties, miscetlaniefl ; Taria- 



0*a fodyt»wdnT ^ ^ . . 

I STiwiii TT "mrgiiiarl^u sydd yn hinJodl 711 y ^mluuHiI 
aeh-ysgrifM.— (7ani*iHMiiT: Him. Cjm. M. 
Amiywiaethog, a. oonmstiiig of Tarietj ; tb- 
Houb; variegated. 
Mm N»tiir, jm ej llBwnder anrymaf Uloj, 
Yn f^T, th dlo^ uiddAJol ■ mmvmldw. 

Bt-tniad, ifa. 40, lU. 

Anuywiactliol, a. various; divers; misoel- 
laneous; diversiffing ; diversified; varied. 



Id jD fwT LTdderchoff ac am 

. . .y«u nag y one oddl 1 1- 

Sadwno.— Auparlil Htvlavf, ii. 71. 



tI oddl KT J modrwyau 






AmrywiaeUiu, v. to divermff, to vary. 
AtnrTwiaitli, ieithoodd, «/. a variety of lan- 
guage ; a dialect. 
Anuywi&nt, iaimau, tm. variety; vaiiation. 



}. Pufkt: C.G. tI. to*. 

Anuywiedignetli, -an, «/. variegation, varia- 
tion, diversification. 
Anuywio, v. to vary, to diverdfy; to differ; 
to make different. 
Amrywiaw oddi wrih, to differ or vary from. 

Ac yn anil a gytyd ar m hoi hsynt, ao efe a omrftBia 
oddi vrU y rliaJ oyntaf, ac a dduYHtwng dri br«Dia. 

6an.yii.a4((!f.lB|. 
Anuywiog, a. varied, diversified ; various ; 
miscellftneoue- 

Vrth bwy o^ rtial byn, byimag pa mar asti-^wioa aea 
gjtsBtiig y Mnt, y eelur cynyUtu ymwybrldlaMli f 

Bhaladran taranllyd. a ftrdlau rhuadwy, y rhai ydynt 
yn.cyterTiynny eoettir amrymof.—Adslgstilll, i. 61. 

Amrywiogttetli, -au, (/. variation, diversifica- 
tion ; an intermixture. 
Amrywiogaethol, a. multifarious. 
Asuywiogaethu, v, to diversify. 
Amrywiogi, v. to vary, to diversify, 
Antrywiol, a. 1. several; various; divers; sun- 
dry; miaoellaneous, multifarious. 

■ Y mae yt Ytgrythyi Un yn eln cynhyrtu, mewn amr^tc^ 

'BHnantt.—U. (J. Onfmfin (18*1). 

AmryvHolimt, varieljes, misoeUanies, sondrieB. 
2. differing, different. 

Aviryvnol i, ] different or differing 

Amrywiol oddi vjrth, j from. 

~ n yr amgylchiadiia 



uobod. . . ttoymae, aryUdat. drioba 
atynt, ao oU yn amri/viol idd n ^ydd. 






Anuywiolaeth, -au, »/. variation, divernfica- 

tion ; diversity ; variety. 
AmrTwioldeb, | am. diverraty, variety; mis- 
Amrywiolder, j cellaneousneas. 

Y ma« amfyvioidfr «d cbaniadJifth yn favr, a« yn aadnu 
I'r doit.— ZVjtM Sicolai <T TallHdn, L 83). 
Natoriot i ddyn ymbyfrydu rn^vn mmrrmold^b, 

rule Jfn-^iirr,* Ba&naa, Blow. '• U- 

Anuywioli, v. 1. to diversify, to vary ; to 

variegat«. 

T ityntat, i addyigu yn byirir, i atbnwn yn hyddocth. i 

nniwyiDD yn lUhyKaD ; yr ail, [ amliwlaw ymadnwdd yn 

loibu^ 1 ontr jrvioli am«L yn byfysr. 

Nmri ArW .* EgL Ttr,, Ann. i. 
2. to conjugate (a verb). 

Amaang, -au, *nt. 1 . a treading about or around ; 
a footstep; a tread; a stop. 

Amwelid dedwydd ai ammg.—Diiu^. 
"Wrtb BBflTn drtn^a'r dydd ag aivaiip boew. 

O. WfXD Jmrt : Hy(>n«T FrdiBii. iU. 
2. a parenthesiH : also written ymtartg, 
Amsathr, -au,«n). a treading about; atreading, 
a tread ; a trampling. 
A •uail.f, kyn a byit a bartani.— (TrxM''' ' H.A. I. It». 



adyfynU 

AmtalkwT yn id bon nuoQ yn si obykb. 

MyrMin .- M.A. I. ISl-l (cf. A.B, ii. 1»|. 

Lie amtathr, a place trodden on every side ; a 

tiodden place. 
Aituathr dynxon, the footsteps or footprints of 

men ; the treadings of men. 

Deulh y «Kt ynyal. muuHfr djnjm nae alanot nya 
pwdtil.— JriMiDfvn, 1. MO. 

KyUall aedyw ym bwyt aUynn ynbnal. »e auMittyr 
omiad Arthur. — MahiMcfiom, iL Ml. 

Caiafy ■imiii haf awutaAtr ganrjt. 

-• '^uu■ I^mnidJ.- If.A. i. ITU. 



rM». 



. a treading about ; a 



Amaathru, v. to tread about; to trample in 



Amaeiniad, -au, «m. a reverberation of sound ; 

a Hounding around. 
Amseiitio, v. to sound or ring about ; to rever- 

Amsel, -au, em. [sel-u] a view on all aides; a 
comprehensive view. 
Mewn dyfalgerdd dylid oyflawn gyfldybn . . . ae anunu 
pob peth, berwydd bantod. ac aniairdd, a diyw, a phwyll, 
a d«Bll, as ami€l, u HBta.—Cn/rimuli , Btirtd, SS. 

Amaent, *m. [L. obKnlia] absence. 

Bew yw affhyuanh pob petb a dywr yn aiiuAif ao ay 

■ntet.—Cf/rriAiau (TyMro, iTlM. 

Amaer, -oedd, -au, tm. [C. anuer ; Br. anurr, 
anuxr, amzir ; Ir. ameer, ainuer, aimtir; Oa. 
aimnr; Mx, rm»hir} 1. time. — Preg. iii. 1 — II, 
Eanla yn at anufivyd fa«nny ehlt agondic kemeyth am 
Br aOtjti.—CffrtiiAiaH Cgmr-. i. US. 
Amur Uoi nwdUi dyt sent 



Duirtb. IM.A. iii. 1 
A-utr I twyd, «wr [ otydnryd.— Mint. (M.A. iii. t 
' Tri phetb nl« K«lllr nuddnl anynt : Duw.; aaor 
eaogdflT. — Barddtu, 1. SOB, 



Ons a dnnlio'B ofcr b oiuanu. 

dr. Taad Oach: H.A. i. MT. 
T mae amttra^ trmiaorol tfi amtemit ynRTdol, jro ffjf- 
atabot t BAtur yr aauM m f^ddo gaarm jd ukw. 

CoAvf^ J dAW'r aMMr 7 prrd ha brdd aninr mwy, 

Edt€. Saimiil .- MfiiTch OyBuntino, 100. 
j4r onuerau, st times; Bomeliiiies; at intervAls. 
P6b {hoh) ameer, at all tiiuea ; al^^Ts. 

A jiiitA awkKT ofldfa me^yB gTuahwynn. — L^eidar, \ 2ft. 
Tr Aen amuroedd, tlie oldea times; ancieitt 

Anuer y (yr), the time that ; the time vh.ea ; 
at the tiioe ; when. 

Amtr rx <m of am Dafrd.— AhMhI.' U.A. 1. 198. 
jf sHT ■■■ panhto pudi dOlut bcnbai. 

CfnMtliiB: H.A. L 183. 

i)rM a»i«er (1), for a time; tempoiarily. (2) 
past the time ; after time. 

Afslwrd heb vyut. nent /ttiw ir« onffr ttt kjnurt dr 
TVTt.~«''lt«>V<l™, tli- *"- 

% The pL omMniu nauaUj refers to shorter 
periods than amteroedd, and IB oft«Ti egiuTa- 
lent to vrydiau ; but the diatiiictioii u not 
alwajs oMerred. 
2. a season, a time. 



Y pedtoar amaer, the four seasons ; the four 
quarters {of the year). 

Ond odid tl dr hnu 07*11 gmdu'i TisTTthpan ; u heb 
adrrch amTUt unmiCh yn b pnli»r avuWriiuhflbeiidar- 
Ileii 0*7 to fewn dmitli.— Vorfiin Lhngd: Tri Adacyn, M. 
Utum attuer, in lime; timely; in season; in 

Meipn pryd oe miner, in time and season. — 
Or. J. itarM .■ Llyfr y Ees, u. v. 24. 
3, {pi, -an) a t«liae (in grammar). 
TU amir j i^dd i tert bdrwyddiad. 

AUeym .- DoapuUi, IS. 
Y nue bort yn ddugTa9d)B i dri anuer godidqa . . . ao 
Vn nodi 711 fwy manwL ehwanegir tri nmmr aralT 

£atar( Dania: leiUi. CTinr. U. iU. B. 

Amasrach, a. [a noun nsed as an adj. in the 



seasonable. 

Tan vu umfemth nntont kTrnint hmi QO chTneduli- 7 
gT^n 7d aMbatit.— JriMw^Hii, I. iM (c(. ilL 14 j. 
Amafnteh fan^ ia izir7dd 
OaDo latm na'r gtn 7 BTdd.— Siffa f^l%, I Bdm. Pira. 

Anavrag, -an, </. chronology. 

T mae hyn in tprim amirrts 7 Dr. Davim, wf bod 
Bobin Ddn ya lliryd Aodana o ffTleffl 7 fl. 1460. 

QiiHtOUr MtrAaa : QiraUh, U. SSfi. 

I. [amser+oyff ] an epoch ; 



Amaerg^lch, -au, -oedd, im. a cycle ; a period 

of time. 
AoLSeriad, -an, em. a timing; a dating; a date. 

Nid oca owarlid l>r xgrafflad hwn. 

Lltifl-yAtinM y Crt-ry, STT. 
Kb nUo C7iiiliiry9a yr aiHaHodiiii ukghTncm a roddir 
. . . gallwiiddyindydKTaaphobtebygolrwTddaarirtidn. 

Anueriadur, -on, «m. a time-piece, a ohrono- 



AmmeTgytt, -ion, f 



rwob ddTDgyds <Awi Pr [an y 
nw> i'r pethlyDed dmiodd. 



AmMrlyfr, -an, »m. a chronicle. 



AmBerod&, faon, >/. famst 
duration of time ; a period. 



r-|-odfa] space or 



Beth bynnag a'r b. wnaed drwj jwpTjd dyn yn yr amttr- 
vifa yma, pa on bynuft^ ai da u drvs. mfiddaf, yoo Itob 
KTmitb a'i didola efbnnan mewB mpdd yBprydol. 

J(d>v<»> Mnyi-' Diag. a'l Atbr. W. 

Amserol, a. 1. relating to time ; of time ; tem- 
poral (opposed to eternal). 
Ac Tally y lemyiia yitoTya OhajrlTmasn. oe wmthredoed 
ynyiYipaeD. aays lUva WrrnaMwd «TeiU yn ttenlav 
y nochad aMttfratol dros ucbed dnurywydawl. 

a.mp<.» 6hi.H,—.tA. ) lal {a. »S). 

P<iftauam«eroI, thingsof time; t«mpoTal things. 

Tatyr o ba oyn Deled B7lwedd yr TTikddflDffTB yr boU both- 
■n anutrtA, paa fyddedi di yn y irnlininl tntrwyddol. 

Or. lt-y-»; Tnyr. i. S (M). 



2. timely, seasonaUe. 

Hi [y dbacar] a dbwv y pbrwytbau ai (rwRidbiau yit ihi- 



Amteral ffrwythau'r ddaiar, the kindly fruits 
of the earth.— Zf, G. Qyffredxn (latanl). 
3. relating to a tense, temporal. 
Amaeroldeb, ) am. timeliness, seasonablenees ; 
Amaerolder, ) temporariness. 

Cyranh N. lirybodawnetaiiawDHima^UiTin cynewyn 
a aegyddiaeUi a n d baitbted N. am d n^yddlaeth «v y 
mae Ty n^bwyn am bod Imiaa yn barawd i ordiirillaT yy 
amterMtr am priodi>lder 1 iririonedd. 

On/TtiMax Ojnini, U. 414. 

Anueroli, v. to time; to make seasonable or 

Amaeroliaeth, -au, «/. the course or revolution 
of time ; time. 

U«^dw1 am rod a diylchyned 7 ffoffFedden, a threigl 
amteroiiaeUi y flir7dd7n, AC oe« dTii. ae oeeoedd y byd. 

CalB Cgmrais (Y 0»1, IBS). 

Amaeron&i (o), ^on, »m 



Derbynir amser^nJau {almamicau) yn ffyffreduL, mceys 
tyatdon dlryTefliom Tw dilyn 711^ ngoaodiad 7 ffwjiui^ 
■ymmudolbab blwyddyn, 

GtcallUr Hit/lain; Owalth, JL 386 (ot. S88, S70]. 

H«Dr iavD anumnt 

Ei byctys a'i birfyi bl.—NiaaiAir, I Oiiawr. 

Deallaig fod y gwi da wedi llwyr fytjrio fy anammlau. 
r*. BaberU : Ffordd i OyfoBth, »». 

Betb yr ydycb yn ei ddeall wrth yr ^A mflrrani Moryddol f ' 
UaCb o Am^-rmi Cenodlacthol ydyw, oMi ci twrudu yn 
beuaf er 11» aeryddion a morwyr.— £r/i->KiH Srrffddiailh, til. 

Anueronol, a. relating to an almanac or calen- 

' dar ; oalendrical. 

Mia aT/ueronol, a calendar month. 
Anueronydd, -ion, tm, an almanac-maker. 
Aioaerthadd, tm. [serthl abruptness; readiness 
to&U. 

Nfm doroi syrtbiaw anxfsrth^dd nlar 
Naf ar 7 Odaiai nil«r ddyedd. 

Or. at Xerrdtdd.- M.A. L 43>. 

Amaeni, v. to time ; to date ; to do a thing in 

Hewn dy&Igerdd d7lid cyfiawn rrffelybo, ^weddnodl, 

UytelB, oyfieo, ac luucni pob peth.~(^KiWiiiieX r MnU, W. 

Amstru Ur/thyr, to date a letter. 



jgic 



AlCBERTDD 

Amaerydd, -icm, on. s chronologist. 
Tr YgjMld InllBidd, ■ ddrtBTddirnn nU a 

A tuDiwrd na luliiu Sr«lie«T- . . YdefDrdd , _ 

Tflpaid dTPATiiuDjirDL hwn, pr c)-inh«ni gmith unryw 
omjiruJdian »'n gdidd. 

Smon Llofd: AmairTddiuUi Ta^iTthynl, IS (ct. 18]. 
^iHHTinliJwn TOgrTthyral m i«Dent oed r byd yn saitii wb. 
Oicj/ti'dj/dd,i. 1. 
Amaeryddi&etli, -au. s/. chranology. 

ArfdanmddiBFlh. nra j hril uddj-BK : )T ho» IJlld eH- 
vulli yn adraau Tr fomidau CT^n^miiw] hyn — ftwynUeth, 
UUAayddiaetlL^ mpidrfildueth, ac aawrf/^iiivlX. 

cvvajm™ vgfr^e {una], an. 

jn dxn^oA y iTiniiyinol ddnll o fryt^ tnua^ a fu ac rtydd 
irfenyJif mcwn ainryiriol wlwlydd ( rJi«iMUiwith»u.— Dl- 
beu amrrrff'I'uirtA Tw p*»QQodi dyt^HydctiAitHUmewn huifi*- 
yddtaeth,— Simon f.fojni.- Am«erydiliiieih Yigiytbytol. i, 

Y IDA? yr ftwduT yn mmryfuaeddu yphydig ynu yn ei 
amtrrjpidiaeli.—GKalll^JlKhain: Omith, ii. XS7. 

Y mH yr nrfer o dfo blynyddan vrth y d«faa, yn rlui 
yBt^ffia. yn rhoddj lie i lawer o utgbyiriHtb ni yr aw^ 
jilJwiU.— Camt.aMiM.- HaoW Cjmni, BBS |rf. TO] . 

Humwyr diweddu & gymijvunDt syaraol uifhyd- 
gotdiad dHi^rj/ddivtA AflHyriaidd^ 

Bn.(M.' Kinefeh, Anrdniid, 8. 

Amuryddol, <t. chronological. 



ynyirwwth 
-T ddetnydd 



o'T Tipud InDkidd. 

Simon Lioj/d : AlOHayddiKetli THgl-ythyrnl, IB. 

AmMiddi, v. to circumfuse ; to spread or pour 

Tui ei lyriBd ET 
Bi Id yn cbvrai y dygai Michael^ gaa 
A-mi«ddi J ddwy OH, is ihwyBE ea p«o, 
ImrorBondig oil yn un y duent. 

IV'. o. Pufin : c.o. Ti. an. 
AniBud, -au, »m. [sud, But] appropriate quality 
, or condition. — P. 

Nyt^MmyTutynreiUi 
Ny clwri y gyomun gyvieith. 

Amaylwad, -au, tra. a looking or obeerring 

around ; circumspection. 
£(eUy aU oyn torisd dydd, mcwn rhin, 
ti cydwyboduB noo. fforpbenynt bvry, 
A COHA avuulvad t&wd oil tzefnhi-nit. 

Aina7Uu,v.to look orgaze about; to TievBTonnd. 

Amug (fl), ti. [pret. o( oiiiu^n=^<ira<Wioyij ? cf. 

rfujfrom rfiuvn] defended, guarded, protected ; 

has defended, &c. Cf. amvryn, amivg, amygu. 

Dud an maic. Don an ttorae. IMu an gnannd. 

A.B. ii. 13. 
Owydoc nens nmnc a« wayw . . . 

"" oryen gwtam^^^^ ^^^^^ ^^ ^^ IBg, 4B*, E88. 
Pan anu OwBiD biw el (m. 

Taiiaiii .■ H.A. i. SB icf. SO, es, se, n). 

Nyd ffwr ffwyr i cmiitF ami ^nd gynfedyd 
Ai Qhontii&fyd ai dumtrofoed- 

OiMlcAnut.' H.A. i. IBSdif. 107). 
Pan -muc teyrn Teill Aber.— Oddtlv.' U.A. 1. 119. 
OvT Bornanr BDTfluK pan amw.. 

LliK. ab !JB«iip>: M.A. L 380 (of. e7«). 
Ml fgj [rtli] Bdthae pla 



^nt Adatr 

Hityl aeigyr 



— ..iSeigyTdfuiTdani pmuj 

Hoetyl uicn hydyr a den a due. 

PrtdgOd Btclmn.- U.A.L387. 
^ Piigho considGra amug the iufinitave form, 
and Davioe BeomB inclined to the same vie-w. 



Gwilym K^dr^ Koelbren ^bryd I 
Owrnpidir gonnefleidr garw nmu.l«c* 



2 AXWELLAU 

Amwabr, -au, *m. [gwabr^gwobr}^.4inofrr. 
Amwain, weiniau, ireinion, »/. [cf. donnKain, 

amch u-aen] s dicumstwioe, evemt^ or aoddent ; 

a leading about. 

Yn yr b«i anueroedd ^ynt 

Dag^bod hYnt(.mm.i«n>ii.- 
Fe wnaj brydydd g«rddi dyig, 

A'a canu'ii mvsr t dvnkm. — / 
Twyll a' 

Tri oter frerddairr y aydd: ... 9. bndawli.aa iimn* 
panbua el irerdd el bmiydd irwlriaiKdd a ehaniadaatli, k 
bnintadairi cuyaniidyUd bfaintar<(K«U(iat»iui. 

Amwain, v. to lead abont ; to conduct, to lead. 

Jnlnivi, arwain. — <Jrirlg/irjfn Tr. Cgifieat. 

Amwair, wciriau, *m. [am--t-gwair] a collar 
(apparently nude of hay), a hone-collar. 

A Rlannon anydei sMiiWmi yr aiyn wedy bydyut ynkf- 
irein ^wdr am y mynVByl bfthea.->Jfa^'iwffin, ui. Id. 

Amwallt, a. covered or surrounded with hair. 

AmnvlU ywamdltavyr [Baidof ated race].—/'. 

Amwaag, -au, -oedd, mt. a prmsure on all 

sidee; compreosion. 
Amwaagiad, -au, *in. a pressing on every side ; 



Amwasgol, a. pressing on all sides; com- 

prossive. 
Amwaagi], v. to press on every side; to compress. 
Amva, -oedd, «/. [gwej a Belvedge, border, 
edging, or skirting. 

Yt ymyl-^lchoedd'neddnao fooyrwydd, y rbKi, in«97n 
amvMtdd syml, a gjlxbjatiat bob dogparth prydtnUi. 

JffjiftFniad'iit Srivey, 184. 

Amwedd, -an, ■/. [gwedd] conformity; style. 

—P. 
Amvaddi, ian, </. a supplication; a solemn 

lawyer. 

Fy m«ddvl, fy amnBeddi, 

Farw oedd chwant yn fardd i <diwi. — LetB^t Kon^ 

Amweddiad, -au, *in. conformation. 

Amweddog, a. conformable. 

Amweddu, v. to fit or agree on all sides; to 

make conformable. 
Amwel, a. looking orviewingarousd; circmn- 

Amwel, -ion, na. the view on all sides; a pa- 



AmkiI hardd ym mol hii^ddoL 

Ditf, Llvria Ttttad Qnnliiu. 

Amiroled, v. to look or see about; to view 
aronnd ; to be circumspect. 

Efs ebtcddai dalm. 
Ao auveledis yr oiaiKJai hwynt. 

W.O.P^Ht: C.O.I. M». 

Amwelediad, -an, *m. a viewing about; cir- 
cumspection; caution. 
Amweliad, -au, tm. circumspection; caataon. 

At bynna troaj d drtKdiad baloh gan orn, 

OaA amKetiad cfawil, trvT Roed, biry lal, 

. Troa fryn, troa bant, «) wib d«hrpuai efe. 

w. o. p-gut: c.a. It. sea (of. u. 4Si). 
Amwellftu, v. to improve in various ways ; to 
improve. 



Tri 



pheth buff gam ddadwydd « bod ar d law «n 
ithnr : pwirioneddn ar hn : gyni addyas ar wy- 

— ""-- bodau a onyiuieddfaa. 

Trmad Doahinrb: M.A. iiL HI. 



bodau ; ac amiBrOSH ar vybodau a ohyuiwddfi 
Triiiedd Daahiiwi : 1 
Eiisioea nid i4iydd ^wahaidd amwtUtlu ar wybodau- 



«ni. [of. anwc*] indnlgenoe ; enjoy- 

Rtt tjwji ts o rjil da.— Otiiniinardil.- Cutadkn, B. 

Aaiweso^, a. imdulged; gratified; delicate. 

, V. to indulge; to enjo;; to be at 



Oloew dull T un dmll yt (;7t¥methuit 

'jM¥ri>.' o'odDdifl. sei. 

Amwfln, r. to make a selvedge or border. 
Amwg, fgon (a), ant. [cf . amug, amwyn, amygu] 
tniTelopment ; defence. — P. 

FowTHed Bngbm PDwrmic u ;wyr 
Or gored jitamwe 
A«d«a Tieurrddnro 

Af k DO da ef ae dwB.~Ur». ot LlftHly* ; HA. 1. S9S. 
% The OGCnrrence of amtrg' aa a noun IB doubt' 
fid ; and in the preceding quotation, which 
Poghe adduces aa an example of its substan- 
tival use, it may be a verb ; bnt aa the 3rd 
pen. sing, of the prea. fut. of amygu [or per- 
haps amuryn) it is found several timea. Cf. 
Amtig, Amwyn. 
Amwib, -iau, >/. [gwib] a drcnlar course; a 

wandering, raviag, or langing about. 
Amwibiad, -au, am. a wandering or strolling 

about; circumvolution. 
Amwibio, v, to wander or rove abont; t« 
meander ; to revolve ; to roll about. 



AlB«i1>i<^, a. wandering or roving about; 

meandering; revolving. 
Amwibiol, a. roving, going, or moving about; 

gadding; roving. 

Ua] Un ammtiaKl, dw D Onnaldd darth. 

w.o.pigiu,: CO. ix.era. 
-Amwibon, -od, »f. [amwib] an amphisbtena, a 
fabled serpent. 

Ai CDlinbeT byll, 
AmwUm, ihirfai. rjnig, dytrig. al 
Hodfllerch, amad^eh.— IT. O. Faghr: C.Q, i.BM. 
T mae yr ainrilyni, nm jr neidr ddeubso. v hrnod am el 
rallu i Bjmmnd ja ol neu ym mlaen. 

y Ddaiar a-r Crmdirlaid.U.SOT. 

Amwiag, -oedd, a/. 1. a covering, an envelope, 
a wrapper ; an upper garment. 



Caia y dail hyny teb en pwyo, a dad yoe nghylch dy 
draed mal aoHUf ddydd a una.— JfeUirfiu Mni^^', U. 481. 
Emran); lyw nld aneelur, 

2. a shroud, a winding aheet. 
Amwisgad, 1 -au, am. a circumvcating, en- 
Amwisgi&d, ] veloj^g, or enwrapping; a 
clothing. 



n Tn/rtdgn. 

Linwiagi, a. [gwisgi] alert on every side ; very 

active or nimble, 
kinwiago, v. to cover round; to circumvest; 

to shroud ; to envelop ; to enwrap ; to cover. 

loaeph, yTbwaa1jryDairddliaiii,aa eltynavddef ilam. 
aK fli nnvifl^nmM yn y lliain. ac pi dodw ef meini monweut 
anaddeflido ^Tiiig-—W- Snit^iirg: Hare xr. 46. 



T darlul. yi hon a oaodwyd ar banl irrth daloen y bedd, 
■ydd i ;yd o goed, w«di d luttamagi, ( lledr. 

Cf/kMffraten, L 41. 



Amwiw, a. [gwiwj excellent every way ; very 
excellent; aupenor. 



Tryl*yli yn amwyn 

Kiglcu ym Uaalawr khwi- tbw. 

A gar* diBgyiT ywyr a ^wyth 



Amwnlad, • 
Amvmlo, v. 



igysiai 



; H.A. i. S«G. 
.. a sowing or stit«hing round. 
V or stitch around. 
Ml, »m. ft gilding about or 



u, V. to gird about; to gird; to 

begirt.' 
Bydded eich Iwyoan mdl en haMiirrrg!iK.--LiK xli. %. 



A i»M yn pori allaa koUy y TTaynt awn* acbyt y koUo 
af vraynt dxtm ny choUev cf Traynt palffray. 

Cy/rtilhioH Cyri-Tu. ii. MS. 
Emit anwydimi anmyn. 

" ■ ■■■ MA.i. *0(rf. A.B. a94,W«). 






tl(cr. iT9. S44,48l. & 



A nnael^ kedokawc ac 
Ray«.- -VaJiBojim, li. HI 

Paret Bn Qadani airoir 
ngotatareu hysUya.— Ca 

gauthair.— 3l 
Ar injit 1 1; 

Heredydd Fychan l(n d lya 



is by no means certain. 

Gwyr Teuan dlvau devawt ffnrat brwyiv-dretii 
Oirr breiac-dreul med annul [ni. am vitj. 

Catuodyn : HA. 1. 4M. 

51 The metre does not decide whether it is to 
be read aa a disayllablo or as two words ; and 
a mtuat (^E. miut, new wine) may possibly be 
intended. 
Amvrth, a. [mwth ?] rapid, quick P 

Wyf c^tllcdig {at, ooddcdi^j wen ben hlraethawv 
Cuilcie pan amipth afaf ponnawg.— i'fl^aAf ; U.A. i. Ue. 

5[ It is not known to occur except in this 
passage, which ia probably corrupt. 

Amwyd, -od {»g. -yn, in.), ».«/. [mwyd] earth- 
worms. 

Amvydyti, *m. an earthworm. 
Amwydyn y ixfn., the spinal cord. 

Amwydd, -au, am. [gw^dd] a frame. 

Amwyll, a. gloomy or ahady on all aides; 
gloomy, dismal. 



■H'. tU»», rtOwn. 



,,Co(.it^lc 



Astwyllt, a. wild all ftround ; moving irfldly 
about; very wild; wild. 



OoletuotM, in^nlHB. 

(f.JfUlaa.-B.IiiL.lxxTlLlS, 
Adwjthi Ormni Tdofldd, 
Amic,Ut d% rm UueUt oeda.- Oou'r Ol^. 
knnryUtio, v. to move with great rapidity L 
all directions ; to move wildly about. 



ifl tiiougfata. 

Amwyn, v. [ajn-+dwyn (of. Zeuaa, O.C. 536, 
822) P of. Or. 'afuww] to defend, to protect, to 

1. ohind hfnil oe Ur omt 

^.a.iLMicf. 18,81, (B, les). 

'Eaam/fntywTmiiBevrdiTOt.—Ancnri'i: OododiB, fM. 
ARh a dddwatmrUi ts iiyfuth Orynadd 
Tn .iMiiiwi rbibjd riivfsdd nwedd. 

IMw>».' U.A. i. St <cf. 3e, 8S, as, IS)]. 
Or bfd Deb ky ehofnet tc uauejfn j forulwoh 



Ifoleu T rwyf KsrD«b kuure TiHylim 
Ya osittv" nrthuk prrch y ouide. 

Uyir. atlA^Ktlyt; M.A. L MB (of. W«). 
Twrwf towed wynt ma»r mil Churftmirr (inrpn 
Tod ttmmttrifm Gerrwyu tir eurdeym. 

£'<«>». li OiRiIcJtniif.- H.A. 1. 8S0. 
Bein gaabelw nnbeith benh ryborthe* 
Td EMicf n Ednab edneiDt u toe*. 

Ci«<ldi!w: IIJl. LnB(rt. mo.SBO). 
Tma pajid «1, er ffmur^n 
Hsb B miTcb, yw llniuierch llwyn ! 

D. at SWItH, oeI. U. 
HI m Ktolynf tmh tMlden i mi ua efchi (ich navdd i 
amwm y b&ethaird bftchwya hvD. 

jr»a IFHiaw; Cotntr. 

^ The conjugation seems to be, for the most 
part, like niat of dwyn {dug, diag), tbe prin- 
cipal tenses being formed from amug and 
amwg, q.v. 
Amwyn, im. defence; protection. 

Py goryw cu ftiwd 

A-acfn Ddw ttindkwd.— TU«<it; ILA. i. M. 

a. [mwya] 1. equirocal, ambigaonB, 



doubtf 



Ir mvyo oplmo yn mmlnadh tjw tiiim a dywediadaa 

11 > ddygent Brwyddiicid anni-iii, urn a qeddynt sgored 

TDHv^iad-^Ll- O. Ggfr^in IRhA^ynudrodd). 



Oai'r amiu^j, an ambiguous word; awordwith 
a double meaning. 

Oair jfmu^i fydd pftQ fo AnmFul ddull mew 
ymadrodd; fiU y mmai I>uwm Uaira^ halpia, 

' H berthynuit aj d«ujainueth: i 
gemd deuluAid 
t blith y bwiia >iria. a^Kg^ t 
JhtrboAaa ota. — W. O. Pughe: < 
2. pleasant, witty, smart. 
AmiDfft, snb, di^rif, iijttyi.— C 
Anoetb byd bi«irt bwyo kyDDW] 
Am gyra bueJyn arnvrgt 
Bebyd ail« wieUiiFyi. 



lu, am. an equivocal or ambi- 



Amwysdar, J sm. ambigait j, ainbi|r<io*>i* 
Amwyadra, ) neas, e^ptivocalnesa, e^niToOT- 
Am-wyaedd, ) tiou; wittioiam, wit, wiHuteflB, 



Ainwy«i»d, -an, nn. equivooadon. 
Amwyao, v. to aquivocate ; to prerarioato. 
Amwyael, a. ambiguous, equivocal. doubtfuL 



Ajuwyaoldali, ) tm. equivocaloMS, ambign- 
Amwyaelder, j ouaness, ambiguity. 
Am wyatyii , a. [gwystyn, gvst] humid on all 

Amwyswr, wyr, «in. an equivocator. 
Amwyth, -au, tm. [gwyth] wrath, anger, rage ; 
fierceness. — P. 

Itu bnmv • d£8 wytli y bo yn imirM. 

Amwyth, -au, im. [mwyth] indulgence ; blan- 
dishment; pleasure. 

ataofU Qyndylui nyt eamwytli 
Heno. M- b«nii Outk Hytwyth : 
Beb oer, beb niuBr. beb miniM. 

llfumrck Hat: A.B. IL M. 

Amwytbo, v. to rage ; to act or move with im- 
petuosity ; to attack furiously. 
^ In the following quotations amwyth seems 
to be the preterite of amwya. 
Owelela I lu nodlK gin lit. un] Urisn 
Vta nsHntt *l kloD yn Lleoh W«n (Myxtan. 

Tttiittin : M.A. \. fit (A-B. 11. 188). 
Pan aiHii|rtll nd Ifcs nun o'i dymyr. 



(.' H.A.LtSl(ct.ea}. 
nid gortwy «lw medelms, 
Nid yd gloev nnyil glu.— />, ai OiMfK, xlx. II. 
Gmdf y cynbau&f yr uddld yn fu ac a h«tdd jiff n mffi 
o lyff a girvnilli, cynnynfa pA un ocdd deunaw iimnwl ar 
aw.—Ai.,uriH Owr,; AnuutbyddiHCli, Ifi (cf. S7). 
Bara ami/d,_ broad made of mixed com meal ; 
but as it is no longer usual to mix different 
grains tor the purpose of making bread, by iara 
amy d is no w generally understood barley bread. 
Amygftid, eidiau, on. [amwg] protection, de- 
fence ; B covering. 

lilav Bodri gwTt ri rwrtb amgaeid giriad 
A g*r gv'yt '•™ elrchyM. 

L^jnmrWt ab lAytotign -• V.A. L nS. 
Amygiad, -an, tm. a defending, protecting, or 

gufuiiing ; protection, defence. 
Amygu, p. [amwg: of. L. amidol to defend, 
guud, orprotect. An assumed infinitive form, 
while the real one appears to be iintict/n, q.v. 
^mu^dnnnudd Uonnwiodyt 
Men yd Ua iVabaiam yn dbam fynyt. 

Jfrilir.' 11.A. L Ut. 
An TbBo Ddw ann ty amucg. 

fuliain : M.A. L 68 {uf. 38, 74). 
Amyn (a), ^rrep. but, except; lacking, wanting; 

Pa ddyn o honocb A chandda gant o ddefald, tjt Dyll nn 
booynt, nid yv yn gadael yr amif* un pnm again yn 
yr anlalwch, ao yn myned ju of yr boa a ffoUwyd t 

Z.K IT. « (Bf. ion. iTlil. 11, 13). 

Nydhwn, nniiiii Banbu.— M'. SalutHrg: Toanxrlit 40. 

Darilened y neb a ryno, yr aium onfed benaod ugain o 
Eiwdui.— Z>r. Jo*i Damn: U.jtc y Bw. i. v, 8. 



AaiTiiedd (j), -an, tm. [Hi-+inyiir]patieiioe; 
anduzBuoe ; f orbearanoe. 

(UUf Tw imi betli ammrtiU. 

DtftU Bmifnu! UA. L S17. 
Cnmint otdd el fnint (niw muunHdd. 

Efr. »» JTm-fv^; ILA. I. <M [of. 4»r. BU; 
ID nQi aindfirTmiwD dl jn «rt>yn hmuivriilcinDjwi T 
fftUwn i, or mjiui ef (rwneathur tt jmbil nao rr nitmtfwid, 
*o « mnui ni ndiuwaBiat vj natb ukv tt dr dlootdD dl. 

Doll Badwyr dec 07T digandd 



m pob doetUwb.— JTro. Ardt. Ui. 6e. 



Amynedd, a. patient ; calmly anduring. 

Ax gsihier poen 4 ^tniit htu arnafl ebrmiwt. yr wff jnf 

AmTiwddgsr, 1 a. patient ; calmly eudiuing ; 
Amyneddiu, ) forbeariiig, endurmg. 

A diodrl rn muuldu KmHth t Bnrtwnatt relhnr 
gwjt &alau.—Bna Or. ab Arilar (B| : U A. &. SM. 
jM>r»iu Tuto Tur kodeitU. 

Urc. itb Liri^r» .- H.A. 1. ssi. 

BhaididdofadTniiiiqrMddH,— /or. OKni,I07. 
OmifQai hyny y dyn yn ddoeth, yn gMiadlawn, u yn 
hAfllionaB, onl nid yn an^HHUu. — /■». Hartit: Gimtii. IN. 
Dyl«m fnd yn amfmidfaT tiBg it Ddnw, trwy bddio 



OtB. Ltvit .' Drydi. Tigrytli. 89. 

Amynaddfrarwcb, 1 tnt. patience ; forbear- 
Amyneddnjtrwydd, ) asce ; long-suffeiing, 
Amyri&d, -au, mn, an intermeddling. 
Amyra, v. [gyru] to intermeddle ; to interpose ; 

to IiAT« to do with; to tamper. As an in- 

txandtiTe rerb, generally written Tmyru, q.T. 
AmyrwT, wyr, «n. one who meddles (about a 

thing) ; an intermeddlcr. 
AmyagaTi-oedditTn.ands.d. [L.vMcera]boweIe, 

entrails, Tisoers. Also written ymyigar. 
Ad odyu yd jtOfitagrK e hoiua. u K el yn ditqrnD y 

rvynKird y benud- ft g«Uwj ynm^'orr yrlUwT. - . Teilws 

hagoi oed yr amritcnr ■ TodylyuMJ y bnt m rwygdv u 

m dl^wydaw. — Hantt /Wiha Pitatut, \ 1*. 

Amysgsxgoel, -ion, am. amspit^, divination 

by the inspection of entrails. 
Amysgafo, \ a. [jBgafn, ysgawn] light; not 
Amyvgawn, j heavy or ponderous ; very light ; 

fleetinig; pleoMut. 

A phun dyhonirn. amjfigamuich yd ymglyvrf. lo yMh- 
aob DOT »aAl yftchu ar y htUod. 

Cam^at Chartrmam, )T8 [ef. U). 
Ac nui yaoyiiim uinu Baboot ivil y rwas yn anftgau^. 
SoKH a Hi^mWn,, |M. 
Bf heniTlld lUinyan a yydd amnAam a gorwyllt yn y 
nlloan. . . Ao amhwyUog Tydd. a gmdwo fwtnttamn 
ttaiiyt^—IpoliM, )]. 
A denlh yr smaer an^ri^iiuni gimadedlc 



Ein gwlad a'n cenajf, onr ooontiy and our 
nation. 
Eu daiotti ktvynt a'n dnog ntnmm, their benefit 

■ad OUT harm. 
3f/n a'n boddia, this pleaaea us. 
Yr hum a'n gwnatth, he who made us. 
A'n [& (4)+ein] with our. 

^•■tlandan,M4'i>IiaiatawyT, yr am ni^ <!■■ malbkia 
Ii«ty^ ao il'a nuKhed, it's datald, M ^n gwiitbt^, yr awn 

L'n [a (ll)+oin] <rar . . . goes (or wiD go). 

A gwastliaf oil yw. sad I'll llou id a fswn 90 mOHir I 
WUianublllgh.— tfninvy Oimu, Ml. 
tfid a'n Uafur y« ofer, our labour will not be 

A'n=a+yn. See Yn. 

, agan; Br. on, hon\ old 

ni a^wiaant laweoyd apliinh. 

ArnAj ybeym uedw ydenel y 

-, . ,-, By lladdiM gvyr oU. ao ydygd 

AllyM itU onbaDii yityi "" triatit dL 

MaUnafion, I. W (of. UL IH, MB). 
Adolwyn yUi dadalyaetb dl. bedydynw cu meibyao nL 
aivdi dy neodith admit. — AnUgm ttc Ami^, ool. 1087. 

Bait ytt ynat dwtyr kynryw u a lawawd m Hanlwyd ni. 
BmdKOdMair.iU. 
Pany ba Valchnwi ae hamdiffynnaipd yn ttbyn on nlyn- 
joa.—Si.enaI,iWt. 



rq pwneDtbor yn yadv. 



Amyagryu, tm. a trembling; ^notion. 
Amyt»l=am y tal.^M.A. i. B2. 
An (d), -an, «/. an element; an ingredient; 
material; an elementary principle; aprinoiple. 

Bl deddha tajtan yn dy law y lydd, 

Ae a»au bydoedd tyidd, at bod yng ngbndd. 

A'n, a compound of a (in its diffiarent sienifi< 
tions; ' - " ' — ' '^ '■ 



Saf and hynny 1 . . __ . 

Caapiu, Cltarl/nmrnn, )Sg. 

An (arf=ei'« tad, our father. 
An- [Ir, an- -■ cf. Gr. '»-, 'mm-, ''ivta; L. in-} 1. 
a negative prefix, corresponding to Eng. un-, 
t'n-, nnn-, not; and sometimeH to di»- mit-. 
It ^veras c, d, p, t, in the nasal sound ; (, g, 
m, m the soft (or middle) ; and leaves U and rh 
unaffected; as, atighufiarim (oyfiawn), annytg 
tdysg), amnherffaith (perfiaith), annhegvxh 
(tegwch), aaffrth (berth), anfarwol (marwol), 
anUywodradh (llywodraeth), anrhesyTnol (rhee- 

rol). ThecombinatiouaRn^A-, which would 
the regular form when an- is prefixed to 
words beginning with c, being hardly pro- 
nounceable, it is modified into aitgh-; as, 
onjAd/ (an--)-oof), anjAyMon (an--l-cys8on). 
In like manner g is sometimee changed to 
ng ; as, an^ra)n(KJe7o/(gramadegol)^anrama- 
degol ; and in some cases before b and m, 
especially the former, an- becomes am- by 
assimilation, and b is changed to m, while tn 
retains its radical sound ; as, amntaleh (balch), 
amnuuuroi (mesurol), aide fay side of anfalch, 
an/esurol. Of an- changing d into dd, and t 
into d, there are but few instances ; as, anddi- 
chdlgar (^anniohellgar), anddiwyd (=:an- 
niwyd), ondwyo (twyo). 
2. on- and di-, both ne^tiveo, differ in foroe 
and usage, (a) IH- is a simple negative, 
nearly corresponding to the Eng. suffix -feu ; 
and has generally the effect of converting the 
nouns to which it is prefixed into adjectives, 
which, an-, as a rule, does not; as, nerth, 
power, dinfrth, powerlees ; amynedd, patience, 
diamyntdd, impatient ; lynunfr, sense, rfi- 
«yntoyr, senseless, {b) An- is generally a 



Jm V_.(,K)t;iL" 



lasgnant ne^tive, and impllea not only a 
negation, as is the case with di-, but the 
affirmation of a contrary or oppoaiU qualit)r 
or cbaiacter; as, mad. good, an/ad, wicked, 
nefaiious ; dawiol, godly, annuut'o/, uugodlj ; 
tynuiyr, sonse, awyninyr, nonsooBe; cynghor, 
counsel, anghynghor, infatuation, (c) An- is 
usually profixod to noons, adjectiTes, and 
verbs; di- is generally restricted tc nouns and 
verbs. Forms like difdifana (^:anedifanu), 
diddytgn'diaeth (=iannyfigeidiaetb), ar« cha- 
raot^istdo of the N.W. ^slecL 

3. an- in some words is intensive or afBrmative 
(cf. Qt. t- intenaivum), and equivalent to 
«n-, of which possibly it may be a modifica- 
tion, and with which it is sometimes conver- 
tiblo; 6».a»Thyff-dd{=xnrhyfe<ld); anrhydedd 
{-itnrhydfdd). Cf. nnwirrdd and emoiredd, 
anwatda and enwaedu, anhaddo and enhuddu, 
anaele and muKle. 

Anabl, a. [abl] unable; incapable. 

Ef« T" *l<^ ■ dll uD bob voniliwTlioii tragaiw ■ wneler 
I'r uicbsDiu. er mor anail ■ (yiho-r Uaird, I'r bwn j 
gwnS&hny. idilu— Si, /oi«.- Horn. Ui. IW. 
fwiu hi 711 ddihebffoi 

tuGTi«t.<B. 

Aitabl«dd, *m. inabiUty ; disability. 

A lie munt w; yn urrdda un al tod td tiir Iwrthrnt, 
Di ddK«th bynr o ddim anwsd^vch, uird i grttvTii ^'^ 
aaabUdii b'u unmherlfaitbrwydd hwr. 

H'.&.iMti.r».-gCor.(Arg.| 
Anach {an), -an, if. [an— (•achl 1. a cause that 
hinders ; an impediment ; a bleniish. 
TrI pbrU imhebgDr gvr rbuth : bodn Qynm oynoWTO- 
Avl, uet jw hyoy, lieb anaeh twb Ifduih pAnh bouMd. 

Ct/mUUii, Oitmn, U. SM. 
OigiijTTTUn honoeh un oiwcA, fd naddflflcliynffyf- 
TdtbLnn frood yiig nghrd mewa pTiod«4. 

U. a. ayjirdiit (TreTD Priodu). 
Tin* J girelwch gTchwyn o'r niMtli o'r bUen, ■ dirfod 
oelu petb o boni, aduva y Dirrd oedd yn anocA a 
_v_K... .. .„ ■; Egt.rfr.oii.. ' 



Djno'rbrd, end onavr Hcb, — Morgatt ab Muv Lnryr. 

Enrydd pa bliid a. Paul, wedy ei rwTrtnt ma Iiiira 
duocAdb [■achonon] i ddjfod atynt wy, m ywrjienodd yr 
EpiMol hwuo UiuvdoDii.— IK. tiaUtb-ir): t Cor. (Arg.) 

FbJ Dud do uiKhof Be anu*, u o hynj ooU az fnlnt 
gynbenid.— Annum, ii. 78. 

2. (fl. -od) one that is dull or alow. — Owaii. 

Altacbaidd, a. impedimental, hindering; not 
suitable or proper for union. 
Priodai ajiachaidd, a marriage within the pro- 
hibited degrees of affinity. 

Aaachubol, a, that does not save; not saving 



riiirydd-d«b. — //' 



YDuofTyddgyflndinoludndf^bfra^^^'HH A^riypa, 90. 
Anad, a. [cf. Br. anot] especial, special. 

Or ilywy diaflpat do* vrthi. adiaapat g-wnic amuJ diaa- 
pat or byt.— HaMufuni, t SSB. 

Ac jn amal llawen oet Artbur am y anrydodo Du« yn 
ar Tnya Bryddn kfiuuK ef.— ^^(. (frfal,l6{cf.li). 

A^ iddynt yn anait ta o'u blaen hwyuC wii^w taldtb- 

Yn anad dim, above all things ; especially ; in 
particular. 

Ac rn aruid d™, pweled y Brytaniaid 4 lln cadam gajl- 
ddynt.— rAw, StKiKi: D.P.O. i. i [tO). 



)6 Anadum] 

Fn anad neb, above all {persons) ; more than 
any (person or persons) ; especially. 

I>T tardd mad, |fk murf >h«. 

Dtgroenaaddgreliiynebl— i>. aft Omlfm.stlti. H. 

Emi |na swuf iKt a *TT d tod yn p«bu.— Zhwi*. it. U- 

UorUyvredigoedddireddiFii anad >u6, al biyd yn aiu^ 
msibion dynion !— £h. lU. tl. 
AnadAradwy, a. irretrievable; not t« be re- 

covered, restored, or repaired. 

Y trakb ddinnygedig bonno. yr hon yn ^yflawn a allaaai 
Rwympo gyda dinyslr ainJfrrada!^ mr b« Wynifimdwl, • 
eatynir allu yn rajol I'w nfleidio. 

Mt/fT^odao Hirrtf. 3S>. 
Anadl, -au, a/-fn. [L. anhrUtvt ; C. anal (=W. 
anal); Br, alan, o/ozn (Catholioon) ; Ir. anai; 
Oa. anail; Ux. rnno/] oreath. 



\j drelo a weld en k] 



iau ao y^rydoedd, idntiau, 



m wycbyTflrar 
U*B yrllawr. 



'rymmod. 

U^. ^nk. iii. IW. 

r, a*r annffan, a'r owid- 



Uaver o anadJiad dynioi 



[yrawyT);L.._, 

o aaoAitu ynUuflSUud. a 



yn dyrcbafn i fyny ii 
Itaid bob matb ; IU1 



iddl 



I foul or stinking breath. 



I sbortneaa of breath ; asthma. 



(iolwg, IT. 1. 

Anadl einiott, the breath of ]iie.—Om. ii, 7. 
Perchen anadi, one that has breath ; a breatlier ; 
a breathing or living being. 

Fob perzAim aiiadi molianned yr Ajglirydd. — Sai^- d' 0- 
A nadi btr, sweet or fragrant breftth. 
Anadl ddreuitlyd, 
Anadl ddrmmig, 

Ar un anadi, in a breath ; all in a breath. 
A'r un anadl, in the same breath. 
Diffyg anadi, 
Byrder anadl, J 
Anadi vtyvt, a breath of wind. 
Cym,mfryd anadl, to take breath. 
H\T anadtau, long-drawn breathings or sighs. 

Aju] Vja ffmjaeCh hiiasth hir amnd/fu. 

Di/pdil BtKfTm : 1S..A.. i. 3U. 

Autdlber, a. having a fragrant or sweet breath. 
Anadledig, d. breathed; endowed with breath; 



Anadledigol, a. reapiratAry; aspiratory, 
Anadlfyr, m. 1 a. short-breathed; troubled with 
Anadlfer, /. ) shortness of breath ; asthmatic. 
Anadliad, -au, em. a breathing; respiration; 
aspiration ; breath. 

yr hwn ndd yn ein flnxsau, yn baiodl tyned allan wrtb 
d arcb Btl—Ifremi Owo", 61, 

£>. L*vfit r' Golwg, zlfi. S. 

Anodliadol, a. breathing, respiring; respira- 
tory, aspiratory. 

Anadlog, a. breathing, respiring; full of 
breath. 



Anadlu, V. to breathe; to respire; to take 

breatb. 

Ac mdr Iddaw ddywedrd bynr, ydd aiUdlnoM et ar- 
nwrnt,— r, Salabmri: J<iu IX. 19. 

O Kiudl, tyred oddi vtUi y t*dwRr ^wynt, ac aiuJJa u y 
UaddediffioEi hyn. — Eon:, xxivii. 9. 
ilTui(2fu olfan, to breathe out ; to exhale. 

T NmnnoniMd . . . ftddent, y rhan tfn^diaf, nid la 
□Dir ya divadJfe irUnn eu ffon ddiW&idiif yn «s1vdd &r aa- 
Mddle ; dtbr > ddein^mt hefyd nel ea daddn yn ol y 
toHdlul hwn.— flii Zn^ .- DreieUiia, B. 

Anadlwehymad, -an, nn. emigmon of breath, 
exhalation. 
Ac Telhy yd ofdh y jwynnyc 
pump niihiryT oo onnntrKVl 
aiiautefifniat ja cyflflnwi yr u 



edic wtolosb yn oyflenwi j 
Ifnch . . . sc or yuprytAv] 

»m. a breather; ooe that 
breathes. 



AnadlwT, wyr, 
Aaadlydd, -ioi 
Anadljm, »m. a nngle breathing ; a puS of 

irind ; a breath. 
Aitadnabod, -au, «m. want of acquaintanoe, 

lack of recognidon. 
AnadnabTddiaeib, -an, »/. anaoqaaiiitance ; 

want of recognition; lack of knowledge or 

acquaintance. 
Anadnabyddua, a. unknown; unacquainted. 

Xtfjt mmfjuiyiUH, u a hyny yn Utoabyddtia. 
XTn petb wejthlan n boffa bi ei wnfloChur, fel nu coa- 
Cl>. Kdwardr : Baaet y Ffydd, 76. 
Anaddaa, a. not fit, meet, proper, or suitable; 
numeet, unfit ; improper ; unsuited ; inapjav- 
priate ; disquaMod ; unseemly. 
A'r bwD ni lithrodd et dafod, iw ni muuiutbodd yr hmi 
■ydd fuubl<u iddo.— a:ccJ. ixv. e. 
Inry bn toddion anaddai, ac 1 Iw ddibeniau irwg. 

U. O. Otfndm IRbB^rnwdnidd). 
Hvy B ddadbiryliuit y mrff il't meddvl, a dd&dymobwel- 
ut dynuner ddinif-^bwyll, m a wn&nt wr yn llwyr anaddat 
i ddwyn dyledmyddau uigbenibeidiol yr nlvedigitetb boa. 

Aaaddssadwy, a. inappIicaUe; unsuitable. 

■dvf.ynuiTfaHymii].— OhoUMt JTeMm.' OniUi,ll.HB. 

Aaaddaaaidd, a. somewhat unfit or unmeet; 

rather improper. 
Auaddaaiad, -au, «ni. a making unfit, nnsttit- 

able, or improper ; disqualification. 
Anaddasol, a. unfitting; unbecoming; dis- 
qualifying. 
Am ryw beth nad madOanxwl fyM. 

W. O. Pught: CO. Tiil, SSI. 
Anaddaarwydd, \ am. unfitness, unsuitable- 
Anaddaadeb, [ ness; unbecomingness; im- 
Anaddaader, ) propriety ; inappropriate - 
neee ; inexpedience ; lack of qualification. 
Y vylwadAU pertbynol i Rywyddaa Ovlui, hyn a mwlr 
urdwifod huoyddol.— <7anAuaiuiiDc.- BuuaCymni, IIB. _ 

Anaddaon, v. to render unfit, unsuitable, or 
improper : to disqualify. 

Anaddef, v. to disacknowledge ; to disown ; to 
disavow; to deny; toignore. 

Anaddef, a. [an-'t-addef=baddef) unaccus- 
tomed; not habituated; unusual; new, strange. 
T mae yn anaddef geny/, I am not accustomed 
to it ; it is strange to me. — Dyfed. 



7 Anaddvymbdioaeth 

Anadde&ad, -au, «m. a disackuowledging, a 

disavowing; disallowance. 
Anaddafol, a. disacknowledging, disallowing; 

disallowabte. 
Anaddfed, a. 

Bfe t, ddybidls 



unripe, immature ; premature ; 

ei nwn antdrtfrd fel ^winwydden. 



Anaddfedrwydd, \ 






hynny y di 



not meek, gentle, 

unseemly. 

dmtli Madoe ac Itbel meibion Riiit me 
MwTOD By veibioQ a Bovis. jkc y tiuUu*- 

Dyoer. hflb y ^warnjidAWT. Bynu ffellwoir dyteyt, ax yn 
dnddkujm am vrenhm. . . 1>yoer. beb y pwuandawT. nyt 
rmadt^Kyn y ^mxy hwDD.— C'amjvru Char-tj/ituui,.\lti. 

Anaddfwynder, | im. ungentleness ; unkind- 
Anaddfwyndra, ] ness; unseemliness, unbe- 
comingness ; harshness. 
Gorwac ymadnwdh. uiniwfdrdeb^ anadhoytundra, anhy- 

o rwyt biyaio, nfiu onnodb o dblodydh gwpztJinawnuinon. 
ymtorU f r Bnald, 19. 

Anaddfwyno, v. 1. to make ungentle or harsh. 
2. =:^juuldviyno, q.v. 
T(^ ffordd y may cadamach rwybyddyeit no chdtif oJt ; 
gvybyddydt ny emt ae ny ddyljr eu ImnfiddftcgiviMi ; ao ef 
a nrtatidfirunir oeitweit ; eu yw ceitweit a arutdd/tcifiiir Amy 
wybyddyeit ac ardystyHr ei bteint ae deddfeu or nat geir 
en g«r, ac nyt uHaddfitgnir ffwybydydt drwy gei t W H lt 
fyth.— Ceitweit a aimdd/w^ir cyn Uw, fwybyddyal a lysiO- 
wedy llv.— (/jt/WilAum C^inru, ij. WB. 

Anaddum, -au, -oedd, am. what is no orna- 
ment; disarray; undress. 

Auaddnmiad, -au, #m. a disarraying, a disem- 
bellishing; disarray. 

Anaddumo, v. to direst of ornament ; to dis- 
embellish ; to disarray. 

Anaddvyn, a. [addwyn] not -virtuous, moral, 
becoming, or respectable; unmeet; improper; 
dishonest; dishonourable; disqualified; in- 
competent; illegal, unlawful ; inelegant; in- 
effective, inoperative. 

Trt pheth nl ddylai neb piymmeryd Ul gan ddieithr, nen 
ddyn ai ymdaiUi, H^n vo^o: Ua«tb; balen; a bara; an 
am amgen betliau gwerui, aid nnaddwj/n derbra tU. Ua a'a 
gotjaei am aU.—Triatdd DoeMntI,: U.A. ill. 281. 

YmHrtLn yw ymdoni drwy deiayfyt ^yphra medfawL 
mewn a»adkiBynion ymadradhion aeruion. 

2. uncivilized; rude. 

Canedl addwyn oaddyut y Cyrary, ac OTUnUwgT: y 8ae«n. 

Anaddwysdeb, |«Tn. want of probity, honesty, 
Anaddwyndar, !or respectability; incompe- 
Anaddwyndra, <tonce; disqualification; nn- 



rotholet^a 



TH anaddwvmltr anferth af bob dyn - . . dicbell ^ llld ; a 
glythineb.— f"Mdd Doalii^rb: Ji.A. iu, S8». 

Anaddwynedigaetb, -au, af. disqualification ; 
incompetence. 



, .. . oetb cytliraul no^ 

datrin cyfrinacb ; a^ivybtrwyd parth a^ at s 
gra«av yn ddofmortboa nn KttKrwjA hoal 
wynder ^odawl; ao anotolcb U« d^wT yi 



.ylc 



B KKMnB^ auBicvt cr diBo Z>o«. G.C. I-u^ : Br. «H>a. •aa/; O.Ir. 

«.'»:> t^tsMk : m ^um: a blot; »« — " 
r. to froTv or ibov ibu cae is — ^.'- Ksi- IT. I^ 21. S- 

J •*' BMW Wt* f* <ri 




!r.^V""?J" **••*»"• ^ Wil- 
li H-^f MO. '•-■—--■-■ I 7 I 1 n 




Aaahqttfrbdol 



Aw wfti wwydd, nn. maimednees ; monstrod^. 
JUtmtwT, wyr, *nt. one who «"""■», taaii^es, or 

matilfttei. 
AnAgVimdwy, a. tbat oumot be opened ; inex- 

I^cftble. 
An&gro, a. not Md or penEdve ; dieerful. 
An»swedd, -au, »/. a being destitute of form. 
AlUL^weddiwl, -an, am. diafignratdon, dafarma- 

Anagrweddol, )a. deformed, disflgored; nn- 
Anapweddua, j seemly; ill-faTonred, 
Anan^uol, a. not subject to death; immortal. 

Bytoyd anangeuol, inunortal life. 

Orflswndst %. ahulkd gui beddwch • gvicioiiedd, pr 

defnrddim Ajnvird anfflifAioI.--^nl4at. L MB. 

Ananghoftia, a. onforgetfoL 
An&ir, eiziaa, na. evil report ; slander, caliunny, 
infamy ; bad character ; reproach, disgrace. 



Ath^u; mis 



u u'th gil.—D. ai &K«gm, dT. 40. 



<r Sxwg fr tlr, ■ fnant ti 






Anal, -aa, 8/-Tn. [0. & Br. anal; Ir, onoj ; < 
anail ; Mx. enno/] breath ; reipirataon. 
Anadl. 

Aiui! Do* a wnfil dywydd 

Heddol Bwrdi i ddefllo jwfdd.— /auo DoiJvyiL 

^■oJ ill Hwr BhUa 

Yn ul tea rw-r ouJ tan.— rniajt £vU. 

Jfae/y nno^ ^ jNiI^u, my breath fails me. ^5. 
Aaaliad, -an, «Tn. a breathing ; respiratii 

aapiration. 
Analu, V, to breathe ; to respire ; to blow. 



Aoalwadig, a. oncalled ; not called. 
AnaUa«I, u. disabled ; helpless. 
AnaUedig, a. imposmble. 



A tJkrft baint 711 ao ondd, amaiitdig gn 



>: £^ il. 



Fob galUdig ac analttdig, everTthing possible 
and impossible. — lolo Mit. 195. 
AiumBdigaetli,-aii,«/.impoesibility; inability; 
incapability. 

Trrdrdd rw, lie DU lellir cadaii u eiitcddfod I 
H O araj anaUnlifadA tx talo WTtll getM I tmr 
cUni Wma a qhadebogioD.— AinfioK, II, Uo. 

Analla, -oedd, am. 1. inability; disability; im- 

Tair UBWfQ 7 vydd yn nghTrralth diro» ^vtred Dusp 
gadHIt : aiuKii ,' mwrbod ; as eUwEd tugheiuwl. 

O'l/rlilhiii-u Cymru, U. 4SS. 
Gwd nad wff yn cam dial ar elyn yn at anaUu^ 

lalo Mu. IS. 






hij o STUyddaa cyn ■ 
a ^laddvyd dan allai 

Anailtt Noturiol, aatnral ' 



&i ftriblon at iryrion 



Anallu Tnoetol, moral inability. 

Wrth anaUu maiurM dfalllr oiH^ii j/n DatDr r onadDTTD 

^n^edlgaetli. . . Anallu imoml gnr yr aaolla 1 foaaan ax, 

"" ' Tryiar/a, U. IS, N. 

2. impossibility. — P. 

Anallu, a. unable; impotent, weak; impossible. 

Ym nil«iyd llvyt driatyd lln, 
Dna hyn oil, diali aaaJk.— (/u«(n a» ^>«a. 
Aualluadwy, a. impossible ; impracticable. 
Unnlth ond aj ahael 
Mof hawdd oedd, eUt heb at ahaal pryllMd 
FlllpeaJiaUiui*B*.— If. O. iSi^ia; CO. Tl-MB. 

An&lluedig, a. disabled, enfeebled, impotent ; 
impossible. 

~ "" "■ yw I chirl ateb cydwybod to 



Anallnedigaetli, -an, «/. impossibility; im- 
potence. 

Anallnedd, -an, *»>. inability ; impotence. 

AnaUuo, v. to disable ; to render impotent or 
abortive. 

AnallttOg, a. unable, incapable; poweriess; 
impossible. 

Ckn yi ^fidr bmi Dnv ni bydd dink yn aiutlfmi^. 

W. Stttetbury: Ijaal. tfl- 
Trwy Tmirytnlthio Vi rha! aanUiuw i daln, 

/M. Sam..- OwsiUi. SB. 

Anallno^, n. to disenable ; to incapadtat« ; to 

disquahfy ; to make impossible. 
Analluogrwydd, nn. inability; weakness, im- 

potenoe, feebleness ; imposstUlity. 

Vrth waled attaliadau yn dywana yn olynol, a*l taaU%^ 
agnefii yntan yn Mtnn yn gated. 



Oufr.f 



um 



d.t). 



Y mM ymddyvlad Oaaar el bun ar ai ymadawlsd o'r 
ynya, yn nnwf o'i anaUtiofrvitdd i aafyll «i dir yma- 

Canrfmuiwc ; Han. Cym. M. 

Analluol, a. weak, powerless; disenabling. 

Ac ar hyn ddanvedd y gwelir daa beth a uwheaad^! 

hanfod; mfbywa auaw; da a drw^: Daw a cnylhraul; 

a thywyll yn nbywyll ; ae {matlmol taMila^—Barddat, 1. 206- 

Anolluoldeb, ) am. inability ; weakness, im- 
Analluolder, > potency, powerlessness; im- 
Analluolrwydd, ) possibility. 

TtI gvrthredlad Vr tri anfeldrolion : diygiooi ; anaUw 
oidtb; ^WTtJi^aiirgh.'— BarddrM, i. S44. 

Anambell, adv. scaroely ; seldom, rarely, infre- 
quently. — Qweiit. 

Bbaj yn byv'n wydi a ehaU a gawn, 
Ond marw^ VTVb, amambeU iaWD I 

Trftarja GvshoititOi (ino), i<n. 
Anamganedig, a. undronmsoribed ; not en- 
closed or sorronnded. 
Erygiliwyf a 

Fy honan yn anffiH^iMff^.^ IT. 0- Pughe: CO. yii. 19ft. 

AnamgTAred, -ion, tm. incomprehensibility; 

incompreheiuiou, non-oonception. 
Anamgyflfad, a. inoomprehensible ; inoon- 

ceivable. 
AnamgyAredadwy, a, incomprehensible. 

Yr hwn ay'n cyfranu'r (ath niddion anatigg^frrdaitut 
^nrOtbaT.^ilDf^rdadau Btrntii, 6*. 

Y mae yn profl bodoUotli Dawdod bagywyddol ao aiant- 
fjrJFrrdadwff. — Iloapardt Hfntany. t. ft. 

AnamgyAvdedd, nn. incomprehensibleness. 
AiiaingyAvdiad, -au, *tn. inoomprebension. 

lUUngTfiredol, a. beyond comprehension or 

conception; incomprehensible. 



Y maa swympEadaa gwrnndwyddni mewn blattiarii 
rwladiA, e^lwyslg. a tlinilDaidd, er bod ya ddynion da, 
rwanycba en bawdnidod lywodneOiol t laddau buhj 
ffrtdoi. — Iiurpk HarrU: &wmh. 33S. 



,)gle 



Anaddwyniad, -an, *m, e, disqualifying, dia> 
qufjiflcstion ; a rendering unmeet or diare- 
spectable. 

Anaddwyao, v. to prove or show that one ia 
not quuified, competent, or reapactable, or no 
legal witness ; to disqualify; to attaint; to 
render unmeet, inadequate, or iuoompeteut. 



Anaddwynol, a. disqualifying; digabling. 
Anaddyag, «m. laokof instraotionorednoation; 
iUiteroteneas. 



mtaught, uninstmcted ; 



O (dU MoRitia BuwT d eiiiieii. 

Lnael, a. terrible; awful; fierce. 

Mi ith tzwjie rt bn bralnnjnxn 
BniBOJvw oMofi had o hil ludawii. 



Urtc. ab Lirmrirt; iLA. i. aM. 



iiilUve 



Goi,.£uii:U.A. L IM (Bf. isr). 
A plisduvt T gtMVt DDst aue^n. 

Or. ai KiralftU: ILA. L m. 
Uttu wvddivi ffTdiv pomp ^riui^Q 
Oocui ring buui berw cuudc.— Jfjiii, Ani. L 588. 
Dulljduw A wiueth TT boll vymddtboiL n nrdmimiuit 
hi m OMe(<.-/Bta jr.. 175. 

Ctulan anatle, a terrific chasm, a dreadful 

Ti», o b(a J tmlam luufa, rmollTiinKm, M t gnlit 
ti ddvT «rea yn ■yrthlD o caitiiDb nsT, 1 lawr t nl 11 ailwn 
o flllttlMdd.— Elb Iffini.- Budd Cw^, 73. 

2. incurable; irremediable; past cure, healing, 

or remedy; hopeleaa (aa to recovery). 

Twi hum J nuH fr Dolnr 1 jn diuwyddol T a^ pla yn 
arHd^, (eluslllrdiuhlal— /<r. x>.li(cf. lobxxxlT.ei. 

Y Due rtui yn tebrfni d> chTfaDflddvTd mg bono yn 
vrtlirfffilwr ffn«if an uifftdd^uKawT hrd TT uuer t dAffu 
iddo dwylla d7a.-/<^'«>> Ovn, M. 

Anailt fydd ry Dolnt.— £diiwd Eitlant : Qmith, 19. 
Clefyd anode, an incurable disease. 

Tr Aiglwydd k'l Unvodd «f 7B <d jmrigUDedd t 

3. extreme ; exceeding ; intense. 

Drwg anaelt, bad in the extreme ; hopelsMly 
bad; extremely sorry. 

Fc fD yn ddnaa auela ga,jt na alluwD jni y (lywyddas 
a't Dodau unyDC atoob yD gynt. 

tJrwnBi (Jmtta, »3 (ol. WS). 
Anaala, ) *ni.a8are(witlttheaubauditionof ita 
Anaeleu, J being incuiable); a sore; a wound; 
pain. 
U*« [«*b u d u«k [of . Uaw iswb ar el JcMt.— A ir.]. 
Z).'ani. (HA. l.tM; III. 1«3.) 
0«lws [at. llaw) Dnw w ««fa.— Min». 
AnaergTTf , a. not strong or powerful in battle, 
Ovtawd o iraddBird a weddal I'r pryf 

AjmtTgTuf, wa aac^oL—D. ab UwUrm, com. W. 



>8 kaAxv* 

Anml, -an. tm. [a-+naf=nam: O.W. a«um 
(Zeuse, O.C. 1056); Br. anam, ana/; O.Ir. 
ani'ntl a blemish ; a maim ; a blot ; a wonnd. 
—Ltf. xxi. 17, 18, 21, 23. 

A tywheC bfliiDaf bob anatn. 

Or.atMrndn-ld: U^. Hit {ft. tK, SIS). 
Am\f mavT ar ddyn yw nl-wydd.— &iJ. x*. M. 
linawi el onq^Dipinr.— Marti. [ILA. UL ISt.) 
ArgtBfydd gir^ cyhnrydd Don bmddaahMh lawv- 
oedd D aui-aii oenld yn y rwaitb. , . Y inaa yn ddUdadl 
I(od] y baau nen'r nna/nx hTn yn (ynyeh. 

Oml<i Mtfyr (Owaith D. ab Owflym, Bha^. 49). 

Aikaf, -iaid, sm. a knave, rogue, scamp, viUain, 
or acoundreL 

Hall enen'T byll aia/. i tmi debyoaf, 
Sy'D cynnaa, nl 'gwelaf , o'r owulawd. 

Ana/ gwlad, the greatest knave alive ; the peat 
of a country.— S. W. 
7t km anaf ! the old knave '.—S. W. 

. that has no hold or grasp. — P. 
-an, tm. a mpim^g or ^fcwgliwg \ & 
BpoiUng or marring ; mntil^on, 
Dy^wyddal blda dduuAwaa anffodiairs . . . a fn yn 
aeblyiuj o anaJLid, — Owptigdj/tld, li- SB. 

Anafbd, I fodau, tm. a Uemish ; a soie ; an 
Ana&wd, j ulcer ; a maim ; a bruise ; maimed- 
neM; ailment. 



rant fodyroCerai laitafimd % Hhrja. 

iaut ^wirddioddof aint Ctiit) a'ilbailyngdia yn calln^mitb- 
ndnartkTvlyddiLnidTniiiiJKinadaeuaQtpHliadBn; mOa 
befyd kcbia rbal oldBan.^A'*^ Am.- Eg[. Ftt. ixlii. 

Pan fydda dM/M rwrn-goob yn J peofOBledd, nea yn t 
taUoeledd, gwthiDgtwjt yw ate.-Lef. xlU. H (ot. 43, 4S). 

Ana/od rhwUtrdlog nen bibdlog, a flstnloua 
ulcer. ^Ztonouer Ml. 4. 

Anafol, a. maiming, mutilating; hurting; spoil- 
ing ; mumed ; maned. 

Anafrwfdd, «m. indecency ; nuisance ; knn- 

A pban d?Dtb y oca pebjllyan a muieth jp y lis a alwir 
y Gla^nu. me^i ar vltltu 7 wrth eglirya Badam. Aia^^ 
ryi)id a vaactbant yn yr eglwy^—Brnf y TjfwgEogvn, ISO. 

AnaAi, v. to maim, cut, or mangle ; to disable ; 
to hurt ; ta mutilate ; to inj ure ; to mar or 

Ny allwn 1 ym amdiffyn mc yipiydyoed drm aoad ynit 
yiel am ana/umf 1 yn y mod y ffwdy di. 

m. Of»i,|3ai|cit.iea). 

Uadoed Eidol doMrwyr a tbrinninirTT or BaenoB beb t. 
a^Kod onadiint.— £rul ffr. at Anili.T: H.A. 11. KS. 
Nyohwyd ani^f^d nifei.— Sr/ii^ .■ M.A. I. BM (of. M»). 
Hyd yr uata bwn a^ y darfu iddo dwyHo dyn, ^wj vk 
pyDdynnrydd, 1 ano/y ei bun. — Iff. Owtn, fiS, 
Mi a'th anafaf di, I will cut thee to pieces. 
AnaAUf a. 1. mumed; mangled; mutilated; 
disabled; hurt; wounded. 

Vn yr oboDOAt dyn onahiw md^yi bydar nen dall noQ 
^QDi neu dyn goi<wyllawc.— C^jcrVaiUiin C^mrH. i. «I8. 

Qnawd nn bob a%aFita rvyn. 

E<^Xunw Sir, Mytid: ILA. L MU. 
Anafvaioa, maimed ones. 

A duth tta dorfi^ydd lawer, 1 idiaaddynt grd t hwynt 
■loSon. dafllioo- madloD, amafutbrn, ae «aill lawir. 

2. monatrous ; enormona ; huge. 
F ntM «/ yn /aur aiM^iu, it ia monatronaly Ing. 



—C.S 



Ku/Vi yn y cuoiiul a 



Jm V^.tltH^IL" 



AKAfueBmntD 3 

Anafiurwydd, *in. maimednees ; monrtroaitj. 
AsAftn, wyr, nn. one who maima, maiiglM, or 

matilateB. 
Anagoradwj, a. that canmot be opened ; inex- 

plicabl& 
An&gTO, a. not Had or pennve ; cheerfuL 
Au&g:wedd, -an, «/. a being destitute of form. 
Anagweddiad, -an, tm. diafignration, deforma- 



^nol, a. not sabjeot to death ; immortal. 
Bgwyd anaitgeuol, immoTtol life. 

CjttMoix B gbarlnd gan beddmh » ynirionedd, yr 

Anan^hoftu, a. tmforgetfol. 
AlMir,eiriaii, mn. eTilreport; Blander, caltumiT', 
infamy; bad character; roproaoh, disgrace. 

Q«uiit TT attatreu ednea befddrii. 

SDlyddoi.-II.A. i. 1G7. 
K-Ibitt OodoHifa'anat, 
Ath gu 1 ml ■ m u'th ^.— H. ai OwUgm, dr. 48. 



AjIAlTOTmSDOL 



Anal, -an. if-m. [C. & Br. anai; Ir.anai; Qa. 
anail; Mi. cnnoT] breath; reapiration. Bee 

^■o' Dnw & iroel d^wy^ 
Haddol (nrT<!h 1 ddellki grwf dd.— /cun iiniAiiyii. 
^hI fsl vn atalon 
Yn ul tea r<r^ aul tan.— /nuu Sadd. 
Mae fy anai ynpallti, mj breath fails me. — S.W. 
Analiad, -an, tm. a breathing ; reepiratdon ; 

Analn, v. to breathe ; to r«epire ; to blow. 



Analwedig, a. uncalled; not called. 
AnaUa«l, a. disabled ; helplesa. 
Analladig, a. impoamUe. 

A. tlin baint ja an inidd, aniMtiig grnnua l>r ynn bosn. 
Trmidd: U.A. U. «g, 

i^jfr galUdig ac analltdig, ererythiug possible 
and impossible. — lolo Mm. lOS. 
Atiitniligaeth,-an,«/.impoaaibility; inabilitj; 
incapacity. 

TMrdd rw, llenunlllT oadBiru eiitsddfod ddelockirl, 
■e hrar aiuUeivacM ar fim wrth oardd a barddonissth, 
sUen Mrdd ■ diBdeirogion.— ilanliiaj, il, 130. 

la, -oedd, im. 1. inability; diaability; im- 



Ikv •■■III T "fdd TU Dghymith dm gwared Map 
gadara: aaoHii; anwrbodi ao eUwed aoghenawl. 

Owd ud wyf jn can dial w eljii td eJ oniiUii. 



ewedi ndaal id balBt ni Dwylav al fslbion &'l v 
ni hij njiiTddaa orn A fanr achavB benalnt aa a 
afa a gU^wyd dan allawr Dellev. 



Anaiiw naiuridl, natoral or physical inability. 



Anallu mottol, moral inability. 

WRh amlla lUiurM d«tUr daa^ TD natm t smador yn 
al Kri^aigtetb. . . AnalU matml fv JT aioUa 1 (iHaail da, 
ardd mewn '"g-"™ a dnioa BntUediK. 

Tf»wrfc, U. le, »0. 

2. impossibility. — P. 

Anallu, a. unable; impotent, weak; impossible. 

Ym mhoiyd Uiryr dnatrd lln, 
Droa hfa oil, dnii muUk.— (JvUria at S^m. 
Aualluadwy, a. imposaiUe ; impiaoticaUe. 
Cnvaitb and d eluel 
Mar hawdd otdd, sto heb el ibaal pwrlUld 
Falpea«i«aaAE«._H'. 0. Piflu: C.O. tL MS. 

AnaJluedig, a. disabled, enfeebled, impotent; 
impossible. 

Fetb mtalititdig tw 1 ohwl aleb crdtrrtiiid tiiae ato, 

/M. flami; OwBith, 4>. 

AiutUnadigaetli, -an, «/. impossibiUty ; im- 



Analloedd, -au, tm, inability ; impotence. 
An&Iluo, u. to disable; to render impotent or 

abortive, 
Analluog, a. nnable, incapable ; powerleaa ; 
impoBaible. 
Caa ri soir hnik Dqt nl bydd dim yn aimlluiwa. 

tf. SaiaiKiy : Lno i. ST. 
TrwT Tmgyfralthlo Vi chal anaUvtf I dalti. 

Analluogi, v. to disenable ; to incapacitate ; to 

disqua&y ; to make imposaiUe. 
Analluogrwydd, ttn. inability ; weakness, im- 
potence, feebleness; impoaaiUlity. 
Wrth weled attaliadan yn dTwanu r" otrnol, a'l muUk- 
ooTvmdd yntaa ra fcfaiu yn nlfid- 

Cgfr. , BtMd (Hlu«dd. S). 
T mae ymddniad Caaar si hnn ar a ymadairiad o'r 
rnri, T* bmwt a'i aauUaiifruinU j MfTll «l dlT gnoa. 

CanAuanatec: Hbd. Cfm. SB. 

Anallool, a. weak, powerless ; disenabling. 
Ac ar hyn a ddarwedd y gwelir dau beth o ans heneddyl 

hajifod ; Hrf bjrw a mHAV ; da a dnrg ; Duw a caythiaiil ; 

athywyUTBnhrwTll; »e<uaUual*atila.—BaTMat,i.%Oa. 
Analluoldeb, ^ «m. inability ; 
Analluolder, ! potency, powerlesi 
Analluolrwydd, ) poadbui^. 

Tri fwRbndiad ft tri anf eidioUon : drrgiont; anaUu- 



Anamb«ll, adv. scarcely ; seldom, rarely, infre- 
quently. — Owent. 
Khal yn byw*n wrch a chaU a gawn, 
Ond marw'D wych, amambtU iavn I 

Trttorfa Gvi)iadatlh (1770), lOT. 

Anam^auediff, <t. unctroumsoribed; not en- 
closed or snrronnded. 

ErydUwytfl 

FThoiulIiyn anamgaiudit.— W, 0, PUflK: C.a. tU. 190. 

Anamgylfred, -ion, on. incomprehensibility; 

inoomprehennon, non-oonoeption. 
Anamgyfftad, a. inoomprehenaible ; incon- 

Anam^yfEredadw?, a. incomprehensible. 

Yr hva ly'n cyfranu'r fath roddiui amantffi/ffredadiBM 

Y mac yn prnfl bodoUeth Duvdod ttagT*Tddl>l ae anam- 

AziamgT&ededd, sm. incomprehensibleneaa. 

Anam gyj&ediad , -au, »m, incomprehenaion. 

Anam^yfEredol, a. beyond oomp 

conception; incompruienBible. 

Y ma« owympladatr ^waradwyddnA mi. 

gvladol, egliryil^, ■ ttwoloaidd, er bod yn ddynion da, yn 
ffiniajcbQ en nawaurdod lywodraethut 1 ruddaa aitamaih' 
Jttdoi.—Iiatf)i Harrit: Owelth. 33S. 



,)glc 



Anauoyftebikildeb 2 

Yt ORTrf ^*n annrdi]oci4 anj/mff ^ndobhr Ln|f y wjddol- 
deb, — BtU jtincu; DTAielJiUi IC- 

Cyhoeddiu ddrTgui cybTdd'dod ydnit ddlm lloi niD 
lluongrvydd us j^TOt a mn atmxjiufmdviilrli eu nulut. 



kiiaml, a. notmiuiy' 
rare ; infrequent. 
Sji nuinirl T Tilt lieb orcbatysa. 

Llf^ad (?■«■.' H.A. LS40 {et. E. 
Tr oedd>iih Awl ni ojiniirfn/' "'r boll bobloedd. 

Dni. Tli. T (cf. Iv. 1 
Tii phetb ■ tmnilluit busb i wr o'n bud u ed wraig : 
dda fli cbyiuuddfau ; jn aiun' ei e^irUo ; dc fs tni 
gvrbiidiia.-TVuaU OwUiwi.- M.A. Hi. M*. 

1 tm. fewness; paucity; bcbi 



Anamldra, 

Aniunledd, ) frequoncy; tliinneM. 

At fikAAn A dug«Mei GUbot k]nuio byimy j gjHeawi j 

hAJSCb. — Brut n TifVffiiogipH, 130, 

Ynol omldn TblynTddo«dd t chwmnwl fli bria, icynol 
a.a«Mra y blynfddoedd j lleib^ dl el \mt.-U/. ixv. 10. 

ModdedlgnMli useth ft dduinnlirTd o'r dochrfibAd, o 
h1»id ufaAW piiiute ma anamUUr ntriBU, 

HmH PfTTi! ^1. Ffr. L 

Anamlwaitli, a. infrequent ; T«re. 

Osllir el lledufeT td axamhuaiA irrth ncboa trn. 

CsfH-acH y BrirM, M. 



1.0. tB. 



Pfthun mor tywylb nmr anamlt 
itJBaj.—LuiMar, | m. 
Nid oes emidur aiumJiiy yn d otvff of - 

ffcA.lT, ISld. Lunxi. 44). 
Ydj bo awMk'v^ al aobon irrth r^Sd pwlad 1 

Aniunlygadwy, a. inexplicable. 
Anamlygder, ) »m. indiatinctness; want of 
AnamlygTwydd, ) clearness or obviousness. 
Anamlygiad, -an, »m. indistinotion. 
Au&mlygol, a. not explanatory; not mani- 
fostmg or exhibiting; unapparetit, 
Ad eaayna byd I dymp 
O Uliui odd yr atamln/aiirl ddwfD. 

If. O. ftj*t.- C.O, tH. lis. 

Anamlyyui "■ ^"^^ ^ numifeat or disclose ; to 

render indistinct. 
AnSLHunliou&dwv, a. indnbitable ; unquestion- 

Ananunheuaeth, -au, ^. indubitabUneie ; 
freedom from doubt. 

Anatninheuol, a. not doubting ; indubitable. 

Anammodadwy, a, not to be coTCinant«d or 
contracted ; uat cannot be agreed to. 

Aiumuiiodol, I a. unoonditioua] ; unoondi- 

Antunmodus, j tioned; absolute. 
Elholedigaetk ai)iiTnnioi{aI,unconditional election. 
Trugaredd/iuanammodol, uncovenanted mercies. 

AuamrvftM, a, not erroneous, unerring; un- 
mistaken ; not apt to faU. out or quarrel. 

AnanuyfOMdd, -au, tm. freedom from error 
or mistake; uneningnosa ; non-eioass; free- 
dom from strife, contention, or quarrel, 

Anamaer, -an, -oedd, »m. an improper, unfit, 
inoonveniont, or unseasonable time ; unsea- - 
sonableness, untimelincsa, 



Cynnal <ad&ir & gortedd yn umoiouthiu o le BC u 
jaalfti yn uaiucr liiui bnal ■ UeavL—BardOaa, tL 48 



r, a. untimely, unseasonable. 

TVl pbeUk m uiurddAnt gndd : cd didgui rn amawit, 
Bb el gtifjm: biihAfla yn UDmberthyuKA, lud amgeii a 
t neb Big dylnl ; u eineu onddHT iV buna. 

iUrjn.' Do^IWth. K (Dt. ICE 

«rol, ) a. untimely ; unseasonable ; i 
. ) opportune. 

Trj tyw ■ngmn yHydh. uwr aiumumncl. mtgja nn 



^wedl gwneuthur iddo ef <£ 
msgyi yn ddair.—Dafik. iln, 1.,, 

An&mMroldeb, "i «m. untimeliness; unisea- 

Anamaerolder, | sonableness; non-oppor- 

Anamsarolrwydd, I tuneness. 

Anamaem, v. to anachroniie ; to put into a 
wrong chronological position ; to render un- 
timely. 

Anamwynadwy, a. indefenmble ; nnt«nable. 

Anamwya, a. unambiguous ; unmistakable ; 
explicit 1 plain; decided. 

AwgrynuD awmwyr oyfenaoddwyr j TfelmndAO. 

Blodau Icuaine, ISt. 

Anamynedd (y), tm. impatience. 

Ynudrodd anami/muld yw, ' 1 ba betb y dligiryliRf T * 

lot. Barrii: OwoiUl. 180. 

Anamyneddgar, '\ a. impatient; inconsiderate, 
Anamyneddua, [hasty, precdpitat«; notcogi- 
Anamyneddol, ; tative. 

Anamyneddgarwch, \ «m. impatience; in- 
Anamynaddusrwydd, | oonsiderateness, pre- 
Anamyuaddoldeb, ) dpitancy, bastinefia. 



unnatural, nonnatural; unge- 

Ananianolivn, nonnaturals. 

Nonnatuittls . . . amaniaHaliaii ; mepyi bwyd, diod, oweg, 

dibunedd. Un, ftwyr, Ac. y rlul, er nnd ydynt yn nAtnriol 

vfloch, ydynt ya Atnlwg mnho^an o'r ttinn PwfmJ o ^lefydAQ. 

Dr. r. iiatanfa, tv. 

Ananianoldeb, ) »m. unnataralness ; oon- 

Ajianianolrwydd, ) trariety to nature. 

Ajiatkianolif f , to unnaturalize. 

Anannoath, a. not unwise ; not simple. 

Anaut (4},«.pf.minstrelB; poets; poet-musidanB. 

Ha mymiei SD8fc]d«h byt Eldol mwRi, 

Atttirii, ,- Oododm, S4a. 
Py dkmnt arum u pbryduit rnvd. 

Qmiew Elnnymim cnolaini ireoliuiwvyd a Ud 

A litbya ffuuw Uwyd 
UwytMiid y oul j n'—— ' 

T uuiw ■ daw ■ dytnad 
Y aiwnl y eoi bo ni»d. 

Uyts. ab UtiBelgn : K.A. L ITS [of , HO; KA, 800). 
A%a%i al oirynut mwyniAnt mwynxed. 

bTTlrn/nu ,- H.A, 1. SKI. 



Synbnuiuit oiinuit muni uu 

Eryiuf dy Ted dy nod e wnef 

Eryuant nuiin- • 



U.A. L SN (of. 430). 



£MiiH all Gwf» .- ILA. 1. fm. 
Orvf. ai XtMdrM: U.A. i. M7 (cf. M8). 
Owrn ai frd di«iw< ffwrllt ffyniukt ffawd. 

tlyiKj^. 0«*.- M-A. i. MS. 
IM etia*d gwdedd no aannl, 

C<i;l. £<rv Mymrdd: lf.A. i. Hfi. 

Pn' I ImTiDddyfri lys.— L. <?. CaM, ii. ix. I. 

E« Owynedd ddrtfl awMf 

O